custom-page111custom-pagetrophies-baseball1"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498852-310.45811.6Quick TrophyPlaquesInsert1:14%,3:14%"Baseball Awards"Baseball Holographic Plaque. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.qsinplaq3dbaseballBaseball / T-Ball, Coach, Sportscustom-pageholographic-insert-plaques1"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498852-310.45811.6Quick TrophyPlaquesInsert1:14%,3:14%"Bowling Awards"See this Stunning Bowling Pins "Strike" Plaque and other Holographic Plaque Awards at TrophyCentral.qsinplaqbowlingBowlingunused-products1"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"498552-3811.61Find These Stunning Cherry Finish, Holographic Decal Plaques Discounted At TrophyCentral. Price Includes Engraving!quick-holographic-plaquescustom-pagetrophies-swimming-diving1"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498852-310.45811.6Quick TrophyPlaquesInsert1:14%,3:14%"Swimming Awards"See this stunning Swimming plaque and other Holographic Plaques at TrophyCentral.qsinplaqswimmingSwimming / Diving, Sportscustom-pageholographic-insert-plaques1"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498852-310.45811.6Quick TrophyPlaquesInsert1:14%,3:14%"Music Awards"Find This Music Holographic Decal Plaque With a Cherry Finish Discounted At TrophyCentral. Price Includes Engraving! Fast 1-2 Day Shipping!qsinplaqmusicMusic / Band / Choruscustom-pageribbons1-tiaras1"1-3 business days" "Topeka, Indiana" "UPS (Post Office Priority Mail also available)"465711-21 260.8244.4Tower RibbonSashes / Crowns / TiarasTiaras1:22%Find These 1 1/2" Economical Budget Tiaras Discounted At TrophyCentral! High-Quality, Yet Inexpensive!rtp661208-20-2019custom-pagehonorrollpinsplasticpinboxvelapinbox10105502-30.31150030.3Classic Medallicslapel-award-pins11:22%,50:30%,100:33%,500:47%Find These Honor Graduate Pins Discounted At TrophyCentral. Each Honor Graduate Pin Features A Clutch-Back. Fast 1-2 Day Shipping!Honor-Graduate06-14-2019Honor Roll, Academiccustom-pagemusicartpins1plasticpinboxvelapinbox1"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsMusic, Drama, Art, Dance1:30%,50:34%,100:38%"Music Lapel Pins" "Band Lapel Pins" "Band Awards" "School Pins"Find these In Honor of Music Excellence pins discounted at TrophyCentral. Our lapel pins feature a high quality finish and clutch pin back.br571Music / Band / Choruscustom-pagecertificate-diploma-covershonor-society-plaque-ihonor-roll-plaque-i1trophies-academic1Shop honor roll and honor society trophies, medals and pins for every grade and recognition program. Hundreds of styles for schools and quarterly awards. Free engraving. Fast shipping.

Custom Honor Roll & Honor Society Trophies & Awards — Recognize Every High Achiever

Honor roll and honor society trophies celebrate the academic dedication, consistent effort, and intellectual achievement that set high-achieving students apart at every grade level. From elementary students earning their first Principal's List recognition to middle schoolers qualifying for National Junior Honor Society, from high school students maintaining 4.0 GPAs across demanding course loads to graduates honored at end-of-year academic banquets, quality awards give lasting recognition to achievements that define a student's academic record. Our selection includes participation insert trophies and economy series awards ideal for recognizing every honor roll student affordably each marking period, single and column insert trophies in both Honor Roll and Honor Society designs, champion's trophies for top academic honors and valedictorian recognition, insert plaques suitable for permanent display in school hallways and offices, medals in multiple finishes perfect for large-scale quarterly or semester recognition programs, and lapel pins providing an everyday wearable reminder of academic achievement that students display on backpacks, jackets, and lanyards.

Frequently Asked Questions

Should I use trophies, medals, or pins for honor roll recognition?

The right award depends on your budget, how often you recognize students, and the occasion. Trophies work best for end-of-year academic banquets, top GPA honors, valedictorian and salutatorian recognition, and honor society induction ceremonies where a display piece reflects the importance of the occasion. Medals are a practical choice for quarterly or semester honor roll programs that need to recognize large numbers of students without straining the school budget. Lapel pins are well suited to semester honor roll programs, honor society membership, and classroom achievement milestones where students want something they can wear every day.

What details should honor roll trophy engraving include?

Include the student's name, the award title, the school name, and the year or marking period. When your program distinguishes between recognition levels, noting the tier on the award, whether that is Honor Roll, High Honor Roll, Principal's List, or 4.0 Award, helps students and families understand what the recognition represents. Honor society induction awards are worth adding the society name and chapter. On smaller trophies and medals where space is limited, lead with the student name and award title and trim from there.

Should schools give every honor roll student an award or reserve trophies for top academic honors?

Most schools do both, using different award types for different levels of recognition. Medals and pins work well for broad quarterly or semester honor roll programs because they are affordable at scale and still feel meaningful to students. Trophies are better reserved for end-of-year ceremonies, top GPA distinctions, valedictorian and salutatorian honors, and honor society inductions where a more substantial award fits the occasion. Separating the award type by achievement level also helps students understand the difference between making the honor roll and earning a top academic distinction, which gives the higher honor more weight.

Be sure to see our expert guides:

]]>
trophies
custom-pagehonor-roll-certificates1certificates290631-31 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,25:24%,100:40%,500:50%Find These Printed Honor Roll Airplane certificates at TrophyCentral. Each Honor Roll Airplane certificate measures 11 x 8 1/2 inches.967Honor Roll, Academiccustom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceCertificates / CoversEmbosser Seals1:22%,3:28%,5:31%Find these Honor Roll (Paw) Embossed Certificate Seals discounted at TrophyCentral.803hrpawHonor Roll, Academiccustom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceCertificates / CoversEmbosser Seals1:22%,3:28%,5:31%"Honor Roll" "Honor Society" "Honor Society Awards" "Honor Roll Awards" "Honor Roll Trophies"Find these Honor Roll Embossed Certificate Seals discounted at TrophyCentral.802hrHonor Roll, Academiccustom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceCertificates / CoversEmbosser Seals1:22%,3:28%,5:31%Find these Honor Roll (Round) Embossed Certificate Seals discounted at TrophyCentral. Seals are easy to apply with a pressure-sensitive backing.803hHonor Roll, Academiccustom-pagehonorrollmedals20medals498552-40.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful Honor Roll 2" Epoxy-covered insert decal discounted at TrophyCentral. Fast 1-2 day shipping.Honor Roll, Academiccustom-pagehonorrollpinsplastic-pinbox-t5498551-30.550040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find our 3D Series gold honor roll pin discounted at TrophyCentral. Fast 1-2 day shipping.Honor Roll, Academic11Complete guide to honor roll, honor societies, and academic awards. Learn requirements, benefits, and strategies for achieving academic recognition in high school and college.custom-pagetrophies-honor-roll-society11Creative honor roll award ideas with engraving examples for schools and academic ceremonies. From Valedictorian to Most Improved Scholar, discover 15+ unique ways to recognize academic achievement with actual trophy wording templates.custom-pagehonor-roll-certificates15"1-3 business days" "Columbia, South Carolina; Marquette, Michigan" "UPS (FedEx available on request)"certificates290631-21 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,50:38%,100:42%"Honor Society" "Honor Roll"Find these Honor Roll certificates discounted at TrophyCentral. Each Honor Roll certificate measures 8 1/2 x 11 inches and typically ships in 1-2 days.7022Honor Roll, Academiccustom-pageachievement-certificates-awards1"Download Only"free-academic49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"See this Honor Roll Certificate designed exclusively for TrophyCentral! Honor Roll Certificates can be downloaded for free! Each Honor Roll Certificate measures 11 x 8 1/2 inches.honor-roll-certificatesHonor Roll, Academiccustom-pagehonorrollpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"Honor Roll" "Honor Roll Pins" "Honor Roll Trophies" "School Pins"Find this Honor Roll Award Pin at TrophyCentral. Honor Roll Award and other pins ship in just 1-2 business days!br316Honor Roll, Academiccustom-pagetrophies-honor-roll-society1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Honor Roll Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Honor Roll, Academiccustom-pagetrophies-honor-roll-society703792192692870229677038honorrollhonor-roll-free1awardcertificates11Recognize academic excellence with custom honor roll certificates. Quality USA printing, personalized details, fast shipping. Low minimum order. Order now.Recognize Academic Excellence with Distinctive Designs

Choose from elegant borders, vibrant school colors, and motivational graphics that make each honor roll certificate memorable and meaningful.

Our design library includes classic academic themes, modern layouts, and customizable templates that reflect your institution's unique character. Each certificate features high-quality printing that ensures crisp text and brilliant colors that students will proudly display.

Customization Options to Celebrate Every Achievement

Personalize every honor roll award certificate with student names, dates, grade levels, and other information using our intuitive online design tool. Upload your logo and select custom colors. Digital proofs ensure accuracy before printing, guaranteeing perfect results for your recognition ceremony.

Why Choose Trophy Central for Honor Roll Awards

With over 25 years of experience in academic recognition, Trophy Central delivers exceptional quality certificates printed in the USA with fast turnaround times. Our competitive pricing makes recognition affordable for any budget. Professional customer service and a satisfaction guarantee ensure your complete confidence in every order.

Order with Ease and Reward Success

Our user-friendly online platform makes creating printable honor roll awards simple and efficient, with low minimum order requirements. Bulk discounts automatically apply for larger quantities, and most orders ship within 1-2 business days after approval. Download free templates or design custom certificates that perfectly match your recognition program.

Frequently Asked Questions

How do honor roll certificates encourage students?

Professional certificates validate the hard work that students put in and provide tangible recognition of their success. Quality awards with personalized details motivate continued excellence and create pride in school and at home.

What details can I customize on the certificates?

Customize student names, dates, grade levels, administrator signatures, logos, and more. Every element can be personalized to match your recognition program.

Can I order different certificates for various honor roll levels?

Yes! Create multiple designs to recognize different levels of excellence, like Principal's Honor Roll, A Honor Roll, A/B Honor Roll, and more. Each certificate can feature unique details while maintaining consistent branding.

Are these certificates suitable for classroom display?

Absolutely! Our certificates are designed for display in classrooms, hallways, and homes. Premium cardstock ensures durability, and professional printing quality makes these awards worthy of prominent display.

]]>
trophies-honor-roll-society trophies
custom-pageachievement-certificates-awards1"Download Only"free-academic49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Honor Roll template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Honor-Roll-Certificatehonor-roll-freeHonor Roll, Academiccustom-pagetrophies-honor-roll-society1trophies498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Honor Roll insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-Honor Roll-InsertHonor Roll, Academiccustom-pagetrophies-honor-roll-society1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our honor roll single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - Honor RollHonor Roll, Academiccustom-pagetrophies-honor-roll-society1trophies498551-311821.06TrophyCentraltrophies1Honor Roll, Academiccustom-pagetrophies-honor-roll-society1trophies498551-310.71217.38trophies1Honor Roll, Academiccustom-pagetrophies-honor-roll-society1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Honor Roll Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Honor Roll, Academiccustom-pagetrophies-honor-roll-society1medals498552-30.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Colorful Honor Roll insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Honor Roll, Academiccustom-pagetrophies-honor-roll-society1medals498552-40.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Honor Roll insert medal With A Personalized Front Rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Honor Roll, Academiccustom-pagecherry-insert-plaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these honor roll insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Honor Roll, Honor Societycustom-pagehonorrollmedals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Honor Roll" "Honor Roll Medals" "Honor Roll Trophies" "Award Medals" "School Medals" "Award Medals - All Subjects" "Honor Student Awards"Buy these high-quality Honor Roll Inserts at TrophyCentral. Each Honor Roll Insert can be used to create a unique plaque, medal or trophy.518156Honor Roll, Academic
11Find honor roll medals and honor society medals discounted at TrophyCentral. Each medal includes a free ribbon. Fast 1-2 day shipping.

Honor Roll Medals & Academic Achievement Awards - Celebrate Student Excellence

Honor roll medals transform academic milestones into cherished keepsakes that students proudly display for years. These distinguished awards celebrate consistent excellence across elementary classrooms, middle school honor societies, high school achievement programs, and university dean's list recognition. Featuring timeless educational symbols like lamps of knowledge, open books, and laureate wreaths, each medal combines meaningful design with practical durability through premium metal finishes and custom engraving. Choose from compact 1.25-inch medallions perfect for frequent recognition events to substantial 2.75-inch statement pieces befitting major accomplishments. Every medal includes complimentary neck ribbons available in any school colors, plus personalized engraving that captures the student's name, specific distinction, institution, and date. Whether acknowledging quarterly honor roll status, cumulative GPA excellence, subject mastery, attendance dedication, or honor society induction, these awards create powerful motivation while honoring the hard work behind academic success.

Expand your recognition program: Explore Academic Medals and Explore Academic Trophies for comprehensive educational recognition. Learn more: Honor Roll History and Academic Recognition.

Frequently Asked Questions About Honor Roll Medals

How do I choose the right medal size for different achievement levels?

Medal size should reflect both the significance of achievement and the age of recipients. Elementary students respond enthusiastically to 1.25-inch medals they can wear immediately after award ceremonies, making these ideal for frequent quarterly recognition where affordability matters. Middle schoolers appreciate 2-inch insert medals featuring vibrant academic imagery and ribbon selections matching team colors, striking the right balance between significance and practicality. High school seniors, honor society inductees, and valedictorians deserve the visual impact of 2.5-inch to 2.75-inch premium designs with antique finishes and substantial weight. Consider implementing a medal hierarchy using gold for top-tier distinctions, silver for standard honor roll, and bronze for academic improvement, allowing you to recognize diverse achievement levels without exceeding budget constraints.

What engraving details make academic medals more meaningful?

Thoughtful engraving transforms a generic award into a personal achievement record. Essential elements include the student's full name, precise honor designation, school or institution name, and term or year. Consider this example: Jordan Chen, Summa Cum Laude, Roosevelt High School, Class of 2025. For honor society recognition, always specify which organization such as National Honor Society or Phi Theta Kappa. GPA achievements become more impressive with specific numbers like Highest Honors 4.0 GPA or Dean's List 3.85 GPA. Subject awards gain clarity through discipline identification like Advanced Chemistry Award or Creative Writing Excellence. Graduating seniors particularly value including their graduation year, while multi-term achievers benefit from notation like Four-Year Honor Roll or Eight-Semester Achievement to highlight sustained excellence rather than single-term success.

What recognition strategy works best for different academic milestones?

Smart recognition programs layer different award types to maximize impact while controlling costs. Certificates serve as versatile, economical options for acknowledging every quarterly honor roll student, particularly when managing hundreds of achievers across large schools. Reserve medals for genuinely notable accomplishments that deserve permanent keepsakes: consecutive term honor roll, principal's list designation, year-end cumulative recognition, or honor society membership. This approach gives medals greater prestige while keeping them financially sustainable. Many administrators find success presenting certificates during quarterly classroom celebrations while saving medals for annual awards ceremonies, creating anticipation and elevating perceived value. Trophies then cap the recognition pyramid for your absolute top performers including valedictorian, salutatorian, and departmental excellence, while perpetual plaques displayed in trophy cases immortalize rare four-year perfect achievement records.

]]>
academic-general-medals
custom-pagehonorrollmedals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects" "Honor Student Awards" "Honor Roll" "Honor Roll Medals" "Honor Roll Trophies"Buy these quality Mylar Honor Roll Decal Inserts at TrophyCentral. Each Honor Roll Decal can be used to create a unique plaque, medal or trophy.489733Honor Roll, Academic
custom-pagetrophies-honor-roll-society1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our honor roll insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - Honor RollHonor Roll, Academiccustom-pagequickshiptrophies-spellingap05ap06ec67hp12hp10hp08br317hp654-pbhp14br3531school-pins1Shop honor roll pins, 4.0 pins, and honor society awards for student recognition. Quality academic pins with bulk discounts. Fast 1-2 day shipping.

Honor Roll Pins and Honor Society Pins - Academic Recognition for Every Achievement Level

Honor roll pins are among the most widely used student recognition tools in schools because they combine immediate wearable acknowledgment with the kind of affordable per-unit cost that makes it practical to recognize every qualifying student every grading period rather than only at year-end ceremonies. A student who earns their honor roll pin at the end of each quarter has a tangible, accumulating record of sustained academic effort that a single annual award cannot replicate. Our honor roll pin collection covers every academic recognition tier, from honor roll and high honor roll pins that distinguish achievement levels within a single program to 4.0 and perfect GPA pins that recognize the highest academic standard, to honor society pins suited for NHS, junior honor society, and subject-specific honor society induction ceremonies. Each pin features a secure clutch back that attaches safely to backpacks, lanyards, jackets, and ID holders without damaging fabric, and bulk pricing makes it financially practical for schools, districts, and booster organizations to order in quantity for every eligible student across every grade level and every recognition period throughout the academic year.

Frequently Asked Questions About Honor Roll Pins

What is the difference between honor roll pins, high honor roll pins, and 4.0 pins?

Honor roll, high honor roll, and 4.0 pins correspond to the tiered academic achievement levels that most schools use to differentiate student GPA performance within a recognition program. Honor roll pins typically recognize students meeting the baseline GPA threshold set by the school, commonly in the 3.0 to 3.4 range depending on the institution, acknowledging consistent academic effort above the average student performance level. High honor roll pins recognize students in the upper tier, generally 3.5 to 3.9 GPA, distinguishing them from the broader honor roll group and providing an aspirational target for students currently at the standard honor roll level. The 4.0 pin is reserved for students achieving a perfect grade point average for the grading period, representing the highest academic recognition a school can present at the GPA level and carrying a distinction that both students and parents value highly. Using all three pin styles together creates a clear and immediately visible recognition hierarchy where the different pin designs communicate achievement level without any additional explanation, motivating students at every performance tier to maintain or improve their standing each grading period. Schools that present only a single honor roll pin design miss the opportunity to distinguish between a 3.1 student and a 4.0 student in a way that motivates the higher achiever to maintain their standard and encourages the lower achiever to reach the next level.

How do honor roll pins differ from honor society pins?

Honor roll pins recognize GPA achievement for a specific grading period and are typically presented multiple times throughout the academic year to students who meet the threshold each quarter or semester. They are recurring recognition items tied to periodic performance rather than permanent membership in an organization. Honor society pins recognize induction into a formal honor society such as the National Honor Society, National Junior Honor Society, or a subject-specific honor society like the Spanish National Honor Society or Mu Alpha Theta mathematics honor society. These pins represent a one-time formal recognition of membership in a selective organization that considers GPA, leadership, character, and service alongside academic performance, making them a more prestigious and permanent form of recognition than a periodic honor roll pin. Honor society induction ceremonies are typically formal events where the pin is presented as part of a ceremony that includes candle lighting, recitation of the honor society pledge, and recognition by faculty advisors and school leadership. Both types of pins serve important and distinct purposes within a school recognition program, with honor roll pins providing regular motivation throughout the academic year and honor society pins marking a formal milestone of organizational membership that students often wear on graduation attire and include in college applications.

How should schools present honor roll pins to maximize their motivational impact?

The presentation moment significantly affects how much motivational value an honor roll pin delivers, with public recognition producing measurably stronger effects than simply placing a pin in a student's locker or mailing it home with a report card. Presenting honor roll pins at a brief assembly where names are called and students receive their pins in front of peers and teachers creates a social recognition experience that reinforces the academic behavior being rewarded and signals to the broader student body that academic achievement is valued and celebrated. For schools where full assemblies are impractical, classroom presentations where the teacher calls each honor roll recipient by name and presents the pin in front of their classmates still creates meaningful public acknowledgment at an accessible scale. Consistency matters as much as ceremony: students who know they will receive a pin every grading period they qualify develop a genuine incentive to maintain their performance each quarter rather than treating recognition as a one-time event. Allowing students to wear their pins on their school ID lanyard, backpack, or uniform creates ongoing visibility that reminds them daily of their achievement and prompts conversations with teachers and peers that reinforce the positive association with academic effort. See our complete collection of academic medals and award pins for additional recognition options that complement honor roll pins in a complete academic achievement program.

If you need more information before deciding, see our expert resource section:
]]>
trophies-honor-roll-society trophies
custom-pagehonorrollpinsplastic-pinbox-t5lapel pins498551-20.550040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find this Honor Roll Gold Enamel lapel pin discounted at TrophyCentral. Features a clutch-pin back for easy attachment to clothing.. Fast 1-2 day shipping.honor-roll-u-pbHonor Roll, Academiccustom-pagetrophies-honor-roll-society1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Honor Roll Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Honor Roll, Academiccustom-pagehonorrollpinsplastic-pinbox-t1498551-30.5200040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find this sleek black honor roll lapel pin discounted at TrophyCentral. Each pin features a clutch back for easy attachment to clothing. Fast 1-2 day shipping.honor-roll-u-pbHonor Roll, Academiccustom-pagemotivational-stickers1"1 - 2 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-21 2 3 230.451224.45Certificate SourceCertificates / CoversStickers1:22%,3:24%Find these popular Honor Roll Motivational Stickers discounted online at TrophyCentral. Fast 1-2 day shipping!bstick5Honor Roll, Academiccustom-pagemedallion-inserts-academic-medallion-inserts20498552-40.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful Honor Society 2" Epoxy-covered insert decal discounted at TrophyCentral. Fast 1-2 day shipping.Honor Society, Academiccustom-pagehonorrollpinsplastic-pinbox-t5498551-30.550040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find our 3D Series gold honor society pin discounted at TrophyCentral. Fast 1-2 day shipping.Honor Society, Academiccustom-pagetrophies-honor-roll-society1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Honor Society Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Honor Society, Academiccustom-pagetrophies-honor-roll-society1trophies498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Honor Society insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-Honor Society-InsertHonor Society, Academiccustom-pagetrophies-honor-roll-society1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our honor society single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - Honor SocietyHonor Society, Academiccustom-pagetrophies-honor-roll-society1trophies498551-311821.06TrophyCentraltrophies1Honor Society, Academiccustom-pagetrophies-honor-roll-society1trophies498551-310.71217.38trophies1Honor Society, Academiccustom-pagetrophies-honor-roll-society1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Honor Society Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Honor Society, Academiccustom-pagetrophies-honor-roll-society1medals498552-30.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Colorful Honor Society insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Honor Society, Academiccustom-pagetrophies-honor-roll-society1medals498552-40.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Honor Society insert medal With A Personalized Front Rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Honor Society, Academiccustom-pagecherry-insert-plaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these honor society insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Honor Roll, Honor Societycustom-pagehonorrollpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:28%,100:32%,500:42%"Honor Roll" "Honor Roll Pins" "Honor Roll Trophies" "School Pins"Find Honor Society pins at TrophyCentral. Each AP Series Honor Society pin includes a clutch back.al73Honor Roll, Academiccustom-pagetrophies-honor-roll-society1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our honor society insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - Honor SocietyHonor Society, Academiccustom-pagehonorrollpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:30%,100:35%,500:48%"Honor Roll" "Honor Roll Pins" "Honor Society" "Honor Society Awards" "Honor Roll Trophies" "School Pins"Find These Fabulous Honor Society Pins Discounted At Top-Rated TrophyCentral.hp11Honor Roll, Academiccustom-pagehonorrollpinsplastic-pinbox-t5lapel pins498551-20.525040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find this Honor Society Gold Enamel lapel pin discounted at TrophyCentral. Features a clutch-pin back for easy attachment to clothing.. Fast 1-2 day shipping.honor-soc-u-pbHonor Society, Academiccustom-pagetrophies-honor-roll-society1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Honor Society Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Honor Society, Academiccustom-pagehonorrollpinsplastic-pinbox-t10498551-30.5200040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find this sleek black honor society lapel pins discounted at TrophyCentral. Each pin features a clutch back for easy attachment to clothing. Fast 1-2 day shipping.honor-soc-u-pbHonor Society, Academiccustom-pagehonorrollpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:28%,100:32%,500:42%"Honor Roll" "Honor Roll Pins" "Honor Roll Trophies" "School Pins"Find Honor Student pins at TrophyCentral. Each AP Series Honor Student pin includes a clutch back.ap06Honor Roll, Academiccustom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects" "Honor Student Awards"Buy these high-quality Honor Student Inserts at TrophyCentral. Each Honor Student Insert can be used to create a unique plaque, medal or trophy.518163Honor Roll, Academic
custom-pagetrophies-honor-roll-society12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsAcademic1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "School Medals" "Honor Roll" "Honor Roll Medals" "Honor Roll Trophies"These inexpensive economy 1 1/4 inch Honor Student Medals offer a high quality, but low price for those on a tight budget.e997912-20-2020Honor Roll, Academic
custom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these quality Mylar Honor Student Decal Inserts at TrophyCentral. Each decal can be used to create a unique plaque, medal or trophy.489720Honor Roll, Academic
custom-pagemedallion-inserts-general-medallion-inserts20498552-40.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful Honorable Mention 2" Epoxy-covered insert decal discounted at TrophyCentral. Fast 1-2 day shipping.custom-pageplace-medals1498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Honorable Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Shipping is free over $99.Honorable Mentioncustom-pageplace-trophies1trophies498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Honorable Mention insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-Honorable-Mention-Insertcustom-pageplace-trophies1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our honorable mention single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - Honorable MentionHonorable Mentioncustom-pageplace-medals1498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Honorable Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Shipping is free over $99.Honorable Mentioncustom-pageplace-medals1medals498552-30.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Colorful Honorable Mention insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Honorable Mentioncustom-pageplace-medals1medals498552-40.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Honorable Mention insert medal With A Personalized Front Rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Honorable Mentioncustom-pagecherry-insert-plaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these Honorable Mention insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.1st / 2nd / 3rd / Etc., Honorable Mentioncustom-pageplace-trophies1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our honorable mention insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - Honorable MentionHonorable Mentioncustom-pageplace-medals1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Honorable Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Honorable Mentioncustom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceCertificates / CoversEmbosser Seals1:22%,3:28%,5:31%Find these Honors Certificate Seals discounted at TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.803hsHonor Roll, Academiccustom-pagedraprib138x111105503-610.4511236.45Classic MedallicsRibbons1:0%Shop for Hooks For Drape Ribbons from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.custom-pageawri11"5-7 business days" "Topeka, Indiana" "UPS (Priority Mail also available)"ribbons465715-71 260.4620016.46Tower RibbonRibbonsAwareness Ribbons1:22%,50:36%"Customized Ribbons" "Yellow Ribbons"Find Hope Ribbons discounted at TrophyCentral. Each yellow awareness ribbon features choice of backing and optional imprint.hoawriHopecustom-pageglass-crystal-awards1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"general410187-1013630JcharlesCrystal Awards1:22%,25:24%Find this beautiful Horizon brushed crystal and aluminum award discounted at TrophyCentral.custom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceCertificates / CoversEmbosser Seals1:22%,3:28%,5:31%Find these Hornet / Bee Embossed Certificate Seals discounted at TrophyCentral. Seals are easy to apply with a pressure-sensitive backing.803hntcustom-pagemascot-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Find Hornet Mascot Badges Discounted At TrophyCentral.mascotbadges-hornetcustom-pagemedallion-inserts-general-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these quality Horse Head English Inserts (Litho) at TrophyCentral. Each Horse Head English Insert can be used to create a unique plaque, medal or trophy.504881Equestrian, Sports
custom-pagetrophies-funny-horses-rear1"1-4 (typically 1-2) business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.85Quick TrophyTrophiesGeneral1:14%,10:18%,50:22%,100:25%"Gag Trophies" "Gag Trophy" "Joke Trophies" "Joke Trophy" "Funny Trophies" "Funny Trophy"Find this popular horses rear figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at trophyCentral. Ships in a fast 1-2 days!qthorseplFunny / Gag, 1st / 2nd / 3rd / Etc.custom-pagetrophies-funny-horses-rear1"1-4 (typically 1-2) business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.85Quick TrophyTrophiesGeneral1:14%,10:18%,50:22%,100:25%"Gag Trophies" "Gag Trophy" "Joke Trophies" "Joke Trophy" "Funny Trophies" "Funny Trophy"This popular Horses Rear Gag trophy features a real marble base, column, figure and trim indicating year of award. Includes up to three lines of free engraving!qthorseyrFunny / Gagcustom-pagetrophies-funny-horses-rear1trophies498552-311821.06TrophiesGeneral1Find this achievement cup trophy with gag horses-rear figure discounted at TrophyCentral. Includes free text engraving!cup-horse-pFunny / Gagcustom-pagetrophies-funny-horses-rear1trophies498552-312421.33TrophiesGeneral1Find these horses-rear gag budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqthorsescbFunny / Gagcustom-pagetrophies-funny-horses-rear1498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Find this budget horses rear gag award trophy discounted at Trophy Central. Features a real marble base and plastic horses rear figure. Engraving is free. Fast 1-2 day shipping.bdg-horses-rearFunny / Gagcustom-pagetrophies-funny-horses-rear1"1-4 (typically 1-2) business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.75219Quick TrophyTrophiesGeneral1:14%,3:19%,10:27%"Gag Trophies" "Gag Trophy" "Joke Trophies" "Joke Trophy" "Funny Trophies" "Funny Trophy"Find these fabulous two-tier Horses-Rear Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qthorsettFunny / Gagcustom-pagetrophies-funny-horses-rear1"1-4 (typically 1-2) business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-411.215Quick TrophyTrophiesGeneral1:14%,3:19%,10:28%"Gag Trophies" "Gag Trophy" "Joke Trophies" "Joke Trophy" "Funny Trophies" "Funny Trophy"See this championship trophy with a Horses Rear figure at TrophyCentral. Be sure to see all of our Horses Rear figure awards.qthorsettwFunny / Gagcustom-pagetrophies-funny-horses-rear1"1-4 (typically 1-2) business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.452421.33Quick TrophyTrophiesGeneral1:14%,100:28%"Gag Trophies" "Gag Trophy" "Joke Trophies" "Joke Trophy" "Funny Trophies" "Funny Trophy"This popular Gag Horses-Rear Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qthorsescFunny / Gagcustom-pagetrophies-funny-horses-rear1"1-4 (typically 1-2) business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.05Quick TrophyTrophiesGeneral1:14%,10:15%"Gag Trophies" "Gag Trophy" "Joke Trophies" "Joke Trophy" "Funny Trophies" "Funny Trophy"These quick-ship trophies from TrophyCentral feature a Horses-Rear figure, real marble base and marble trophy figure platform, choice of column size and color.qthorsedmFunny / Gagcustom-pagetrophies-funny-horses-rear1trophies498552-311218.84TrophiesGeneral1Find this unique cup trophy with Gag Horses-Rear figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-horse-scbFunny / Gagcustom-pagetrophies-funny-horses-rear1"1-4 (typically 1-2) business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-411.418Quick TrophyTrophiesGeneral1:14%,3:19%,10:24%"Gag Trophies" "Gag Trophy" "Joke Trophies" "Joke Trophy" "Funny Trophies" "Funny Trophy"Find these fabulous Horses-Rear Line Champions Line 3-Column Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qthorse3cFunny / Gagcustom-pagetrophies-funny-horses-rear1"1-4 (typically 1-2) business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.453633.4Quick TrophyTrophiesGeneral1:14%,100:28%"Gag Trophies" "Gag Trophy" "Joke Trophies" "Joke Trophy" "Funny Trophies" "Funny Trophy"Our popular Funny Horses-Rear participation trophies feature a real slant-front marble base and free engraving.qthorsencFunny / Gagcustom-pagemedallion-inserts-general-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these quality Horseshoe Pitching Inserts (Litho) at TrophyCentral. Each Horseshoe Pitching Insert can be used to create a unique plaque, medal or trophy.50476106-01-2019Horseshoes
custom-pagetrophies-billiardshorseshoes-eihorseshoes-plaque-i1trophies1Find horseshoe trophies and horseshoe medals discounted at TrophyCentral. Horseshoe trophies include personalization. Medals include a ribbon.Custom Horseshoe Trophies and Awards

TrophyCentral has been supplying horseshoe leagues, equestrian events, county fairs, and competitions with quality awards since 1999. All horseshoe trophies include up to three lines of free engraving. Need awards in a hurry? Orders typically ship in 1-2 business days and sometimes the same day, depending on time of year and when the order is placed. Browse our complete trophy collection for additional styles and designs.

Horseshoe Trophy FAQ

What types of events are horseshoe trophies used for?

Horseshoe trophies and medals are popular across a wide range of events. The most common include backyard and recreational horseshoe tournaments, organized league play, county and state fair competitions, equestrian shows, and 4-H events. Whether you are recognizing a casual summer tournament winner or a competitive horseshoe league champion, TrophyCentral has styles to fit every occasion and budget.

Can I personalize a horseshoe trophy with event and competitor information?

Yes. Every horseshoe trophy includes up to three lines of free engraving. Common examples include "2026 County Fair Horseshoe Champion - John Smith" or "Riverside Horseshoe League - Most Improved Player." Medals can also be engraved to add a personal touch at an affordable price per unit.

How quickly will my horseshoe trophies ship?

Orders typically ship in 1-2 business days and sometimes the same day, depending on time of year and when the order is placed. Engraved orders ship within 1-3 business days in most cases, making it easy to meet event deadlines without last-minute stress.

Are horseshoe trophies available for equestrian and fair events as well?

Yes. Many of our horseshoe-themed awards work equally well for equestrian competitions, county fairs, and 4-H programs where horseshoe imagery is a natural fit. If you are looking for awards specifically designed for equestrian events, be sure to also check our equestrian trophies section for additional styles.

Do you offer bulk pricing for leagues and tournaments?

Yes. TrophyCentral offers quantity discounts on trophy and medal orders. The more you order, the lower the per-unit price, which is ideal for tournament directors and fair organizers recognizing multiple divisions or age groups. Discounted pricing is shown on each product page.

]]>
custom-pagehorseshoes1498551-30.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful Horseshoes 2" Epoxy-covered insert decal discounted at TrophyCentral. Fast 1-2 day shipping.Horseshoescustom-pagefreeawardcertificates1"Download Only"free-sports4985501Trophy CentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Horseshoes template is free and designed exclusively for Trophy Central. Horseshoes certificate templates measure 11" x 8 1/2" and can be easily downloaded and printed.horseshoes-certificatehorseshoes-frHorseshoescustom-pagehorseshoes1498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Horseshoes Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Horseshoescustom-pagehorseshoes1498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Horseshoes insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-Horseshoes-InsertHorseshoescustom-pagehorseshoes1498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Horseshoes single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - HorseshoesHorseshoescustom-pagehorseshoes1498551-311821.06TrophyCentraltrophies1Horseshoescustom-pagehorseshoes1498551-310.71217.38trophies1Horseshoescustom-pagehorseshoes1498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Horseshoes Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Horseshoescustom-pagehorseshoes1498551-30.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Colorful Horseshoes Insert Medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Horseshoescustom-pagehorseshoes1498551-30.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Horseshoes insert medal With A Personalized Front Rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Horseshoescustom-pagecherry-insert-plaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these Horseshoes insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Horseshoes, Equestriancustom-pagehorseshoes1498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Horseshoes insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - HorseshoesHorseshoescustom-pagehorseshoes1498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Horseshoes Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Horseshoescustom-pagename-badges-tagswoyoulipr100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom House Shaped (Realtor) Badges Discounted At TrophyCentral.namebadges-housecustom-pageask-trophy-expert11Arrange trophies by size with largest at eye level center. Learn pyramid arrangement, chronological vs hierarchical display, and spacing tips for professional presentation.custom-pageask-trophy-expert11Order trophies 2-3 weeks before your event for stress-free planning. Learn timing for different order sizes and how to avoid rush fees and delays.custom-pageask-trophy-expert11Most trophy orders ship within 3-5 business days. Learn about production time, shipping options, and how to get trophies faster when you need them quickly.custom-pagecustom-pennants-guide11Custom pennants typically require 250-piece minimums. Learn to calculate team needs, understand bulk pricing, and plan orders for teams, schools, and booster clubs.custom-pageask-trophy-expert11Order one trophy per player plus extras for coaches and MVPs. Learn how to plan trophy quantities for your youth sports team without over or under-ordering.custom-pageexpert-baseball-trophies11Plan your youth baseball trophy budget with our complete cost breakdown. Includes per-player costs, money-saving tips, and sample budgets for teams of all sizes.11Section prizes, upset awards, rating milestones, and year-end traditions. A practical guide for chess coaches and tournament directors who want recognition that actually builds a lasting program.custom-pageemployee-resource-hub11Learn how to celebrate retirees with meaningful awards and recognition ideas. Discover creative titles personalizations and event tips to honor years of service.11A comprehensive guide for teachers and others on how to host a spelling bee, including planning, preparation, execution, and follow-up.Spelling Bee, Teacher Guide, School Competition, Education Tips1custom-pageproduct-engraving-resource-hub111Learn how to present trophies and awards with style! Whether you're honoring young athletes, dedicated employees, selfless volunteers, or top-notch students, this guide offers fun, motivational tips for a memorable award ceremony. Visit Trophy Central for the perfect award.custom-pageemployee-resource-hub11Learn how to recognize and celebrate donors effectively with creative awards gifts and appreciation strategies. Boost engagement and loyalty through meaningful donor recognition.1custom-pagescholarship-resource-hub11Complete guide for students on how to request strong recommendation letters from teachers and coaches. Includes timing, what information to provide and request templates.custom-pagetrophies-campers11A step-by-step ceremony playbook for camp directors: order of awards, who presents what, pacing tips, and how to close the night on a high. From TrophyCentral.custom-pageemployee-resource-hub11Volunteer appreciation ideas organized by tenure and budget -- from first-year recognition to long-service honors. What to give, what to say, and how to build a tiered program.custom-pagemascottrophies1"4-6 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511016.25Classic MedallicsTrophiesAcademic1:22%,5:24%,10:28%,50:32%"Mascot Awards"Buy this Howling Wolf mascot trophy and other mascot awards at TrophyCentral.mt203404-15-2018Mascotcustom-pagehonorrollpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:30%,100:35%,500:48%"Honor Student Awards" "Honor Awards"Find these popular 4.0 HP Series Pins Discounted at TrophyCentral. Fast 1-2 Days Shipping. Buy in Bulk and Save!hp1405-23-2022Honor Roll, Academiccustom-pagecitizenship-awardsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:30%,100:35%,500:48%"School Pins" "School Lapel Pins"Find these popular Citizenship HP Series Pins Discounted at TrophyCentral. Fast 1-2 Days Shipping! Quantity Discounts Available!hp05Citizenshipcustom-pageschool-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:30%,100:35%,500:48%"School Pins" "School Lapel Pins"Find these popular Excellence HP Series Pins Discounted at TrophyCentral. Fast 1-2 Days Shipping. Buy in Bulk and Save!hp07Academic, Business, Generalcustom-pagehonorrollpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:30%,100:35%,500:48%"Honor Roll" "Honor Roll Pins" "Honor Roll Trophies" "School Pins"Find these popular Honor HP Series Pins Discounted at TrophyCentral. Fast 1-2 Days Shipping. Buy in Bulk and Save!hp0802-01-2020Honor Roll, Academiccustom-pageschool-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:30%,100:35%,500:48%"School Pins" "School Lapel Pins"Find these popular Leadership HP Series Pins Discounted at TrophyCentral. Fast 1-2 Days Shipping. Buy in Bulk and Save!hp1302-25-12Academic, Business, General, Leadershipcustom-pageec34plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:30%,100:35%,500:48%"School Pins" "School Lapel Pins"Find these popular Perfect Attendance HP Series Award Pins Discounted at TrophyCentral. Fast 1-2 Days Shipping. Buy in Bulk and Save!hp1502-27-2020Academiccustom-pageschool-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:30%,100:35%,500:48%Find these popular Physical Education HP Series Pins Discounted at TrophyCentral. Fast 1-2 Days Shipping. Buy in Bulk and Save! Quantity Discounts Available!hp2006-01-2011Physical Educationplasticpinboxvelapinbox1"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"105502-31150030lapel-award-pins1"School Pins" "School Lapel Pins"Our HP series school and wreath pins are available in a large number of subjects - honor roll, honor society, yearbook and much more!1hp-series-school-pinsAcademiccustom-pagebr584plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:30%,100:35%,500:48%"Science Awards" "School Pins"Find these popular Science HP Series Pins Discounted at TrophyCentral. Fast 1-2 Days Shipping. Buy in Bulk and Save! Large Quantity Discounts Are Available!hp1806-15-2013Sciencecustom-pagestudent-council-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:30%,100:35%,500:48%"School Pins"Find these popular Student Council Lapel HP Series Pins Discounted at TrophyCentral. Fast 1-2 Days Shipping. Buy in Bulk and Save!hp2309-01-2015Student Council, Academic11Find hunting and shooting medals discounted at TrophyCentral. Choose from rifle medals, pistol medals and more!

Hunting and Shooting Sports Medals for Gun Clubs and Competitions

Recognition drives excellence in shooting sports organizations and hunting clubs. Whether you manage a local gun club, coordinate trap shooting leagues and skeet competitions, or organize competitive rifle marksmanship events, unique quality medals strengthen your program by honoring marksmanship skill development, celebrating shooting achievements, and reinforcing the firearm safety and sportsmanship values central to shooting sports traditions. From trap and skeet competitions to rifle shooting tournaments and sporting clays events, the right medal awards create memorable moments that keep gun club members engaged season after season.

Our unique shooting sports medals collection features designs specifically crafted for hunting clubs, gun clubs, and marksmanship organizations. Each medal includes a free neck ribbon in your choice of colors to coordinate with your club or competition categories. With quality construction, fast shipping, and budget-friendly options for ordering multiple medals, you can build a complete recognition program that celebrates everyone from first-time trap shooters to expert marksmen. Browse our selection above, and be sure to check our shooting trophies and plaques with free engraving. Also see our view our comprehensive shooting sports awards guide for detailed recommendations on the best unique medals and awards for your hunting club or gun club organization.

]]>
trophies-marksman-shooting-rifle
custom-pagetrophies-marksman-shooting-rifle11Creative hunting award ideas with engraving examples for clubs and competitions. From Marksman Award to Camp Chef Champion, discover 15+ unique ways to recognize hunters with actual trophy wording templates.custom-pagetrophies-marksman-shooting-rifle1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Shooting single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - Shootingcustom-pagetrophies-marksman-shooting-rifle1trophies498551-310.71217.38trophies1custom-pagetrophies-marksman-shooting-rifle1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our shooting insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - Shootingcustom-pagequickshiptrophies-graduate12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these quality Mylar I Graduated From Kindergarten Decal Inserts at TrophyCentral. Each decal can be used to create a unique plaque, medal or trophy.489829Graduation, Academic
custom-pagequickshiptrophies-graduate12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these quality Mylar I Graduated From Preschool Decal Inserts at TrophyCentral. Each decal can be used to create a unique plaque, medal or trophy.489828Graduation, Academic
custom-pagetm9901whitcarboarbvelourbox1105502-41lapel-award-pins1Find these 'I Love to Read' pins discounted at TrophyCentral. Each pin features a clutch-back. Fast 1-2 day shipping!br371Readingcustom-pageteacher-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"Find 'I Make a Difference' pins discounted at TrophyCentral. Each lapel pin features a clutch-back. Perfect for teachers and volunteers.br27109-20-2016General, Volunteer, Thank You, Academiccustom-pageawardcertificates11certificates290631-31 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,25:24%,100:40%,500:50%Find These Printed 'I Was Caught Being Good' Certificates discounted at TrophyCentral. Each 'I Was Caught Being Good' Certificate Measures 8 1/2 x 11.909Academiccustom-pageletter-shaped-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find these popular I-shaped custom mascot badges at TrophyCentral. Great for fundraising! TrophyCentral is a top-rated Yahoo merchant.letterbadges-icustom-pagefree-sports-templates1"Download Only"free-sports4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Ice Hockey template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Ice-Hockey-Certificateice-hockey-freeHockey, Sportscustom-pagetrophies-ice-hockey12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Hockey Medals" "Ice Hockey Medals"Buy these quality Ice Hockey GENERAL Inserts (Litho) at TrophyCentral. Each Ice Hockey GENERAL Insert can be used to create a unique plaque, medal or trophy.506661Hockey, Sports
custom-pagetrophies-ice-hockey12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Hockey Medals" "Ice Hockey Medals"Buy these quality Ice Hockey Inserts (Litho) at TrophyCentral. Each Ice Hockey Insert can be used to create a unique plaque, medal or trophy.502451Hockey, Sports
custom-pagesoccerwaterbottles48"6-8 business days from receipt of camera-ready artwork" "New Kensington, Pennsylvania" "UPS (FedEx available on request)"150686-810.75LeedsPromotional ProductsWater Bottles1Icon Marathon PC from TrophyCentral. See our great selection of engraved and personalized gifts!Sports / Water Bottlescustom-pagesoccerwaterbottles48"6-8 business days from receipt of camera-ready artwork" "New Kensington, Pennsylvania" "UPS (FedEx available on request)"150686-810.453611.25LeedsPromotional ProductsSports / Water Bottles1"Basketball Water Bottles" "Logo Sports Bottles" "Sports Bottles" "Promotional Sports Bottles" "Aluminum Sports Bottles" "Stainless Water Bottles" "Aluminum Water Bottles" "Bike Water Bottles" "Bicycle Water Bottles" "Baseball Water Bottles" "Football Water Bottles" "Promotional Water Bottles" "Soccer Water Bottles"Icon Polycarb Bottle from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.Sports / Water Bottlescustom-pagescholarship-resource-hub11Comprehensive guide for teachers to identify and document scholarship-worthy character. Observable indicators for compassion and sportsmanship with real-world examples custom-pageribbons1-tiaras1"1-3 business days" "Topeka, Indiana" "UPS (FedEx available on request)"465711-21 260.8244.4Tower RibbonSashes / Crowns / TiarasTiaras1:22%This Elegant Imperial Series Tiara Measures Almost 2 3/4" Inches High And Is The Perfect Addition To Any Pageant Or Homecoming Gown.03-15-2016custom-page11This page includes an important message regarding the latest tariff situation.1custom-page11Click here to get the latest TrophyCentral COVID updates, including hours of operation and safety procedures.1custom-pageeawardmedals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsAcademic1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "School Medals"These inexpensive 1 1/4 inch Academics (In Honor of Academic Achievement) Medals offer a high quality, but low price for those on a tight budget.e914107-20-2012General, Academic
custom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these high-quality In Honor Of Academic Excellence Inserts at TrophyCentral. Each In Honor Of Academic Excellence Insert can be used to create a unique plaque, medal or trophy.518208General, Academic
custom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these quality Mylar In Honor of Academic Excellence Decal Inserts at TrophyCentral. Each In decal can be used to create a unique plaque, medal or trophy.489779Achievement
custom-pagetm9779plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"Find this In Honor Of Academic Excellence Pin at TrophyCentral. In Honor Of Academic Excellence and other pins ship in just 1-2 business days!br326Academiccustom-pagecorporatepinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsBusiness1:30%,50:32%,100:35%,500:39%"Employee Lapel Pins" "Corporate Lapel Pins"Find In Honor of Excellence pins discounted at TrophyCentral. Each In Honor of Excellence lapel pin features a quality clutch back. Large quantity discounts.br398Business, Generalcustom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these high-quality In Honor Of Excellence Inserts at TrophyCentral. Each In Honor Of Excellence Insert can be used to create a unique plaque, medal or trophy.518234General
custom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these quality Mylar In Honor Of Excellence Decal Inserts at TrophyCentral. Each decal can be used to create a unique plaque, medal or trophy.489778Achievement
custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these high-quality In Honor Of Your Retirement Inserts at TrophyCentral. Each In Honor Of Your Retirement Insert can be used to create a unique plaque, medal or trophy.518220General, Service / Retirement
custom-pagemascot-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Indian-Shaped Mascot Badges Discounted At TrophyCentral.mascotbadges-indian2custom-pagemascotpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:30%,100:33%,500:47%"Mascot Awards" "Mascot Pins"Find these Indian Chief Lapel Pins and other colorful mascot pins at TrophyCentral. Fast 1-2 day shipping!em12Mascotcustom-pagemascot-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Indian Mascot Badges Discounted At TrophyCentral.mascotbadges-indiancustom-pagemascotinserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsMascots1Buy these quality Indians Mascot Medal Inserts at TrophyCentral. Each Indians Insert can be used to create a unique plaque, medal or trophy.489938Mascot
custom-pageenclosed-bulletin-boardsovg1-f90ovg1-f91ovg1-f93ovg1-f95ovg1-f96ovg1-f97ovg1-f98ovg2-f90ovg2-f91ovg2-f93ovg2-f95ovg2-f96ovg2-f97ovg2-f98ovg4-f90ovg4-f91ovg4-f93ovg4-f95ovg4-f96ovg4-f97ovg4-f98ovg5-f90ovg5-f91ovg5-f93ovg5-f95ovg5-f96ovg5-f97ovg5-f98ovk1-f90ovk1-f91ovk1-f93ovk1-f95ovk1-f96ovk1-f97ovk1-f98ovk2-f90ovk2-f91ovk2-f93ovk2-f95ovk2-f96ovk2-f97ovk2-f98ovk4-f90ovk4-f91ovk4-f93ovk4-f95ovk4-f96ovk4-f97ovk4-f98ovk5-f90ovk5-f91ovk5-f93ovk5-f95ovk5-f96ovk5-f97ovk5-f98pa12418f-90pa12418f-91pa12418f-93pa12418f-95pa12418f-96pa12418f-97pa12418f-98pa12418kpa12418tr-bkpa12418tr-cfpa12418tr-tnpa12418vx-181pa12418vx-183pa12418vx-185pa12418vx-191pa12418vx-193pa12418vx-195pa12418vx-199pa13624f-90pa13624f-91pa13624f-93pa13624f-95pa13624f-96pa13624f-97pa13624f-98pa13624kpa13624tr-bkpa13624tr-cfpa13624tr-tnpa13624vx-181pa13624vx-183pa13624vx-185pa13624vx-191pa13624vx-193pa13624vx-195pa13624vx-199pa13630f-90pa13630f-91pa13630f-93pa13630f-95pa13630f-96pa13630f-97pa13630f-98pa13630kpa13630tr-bkpa13630tr-cfpa13630tr-tnpa13630vx-181pa13630vx-183pa13630vx-185pa13630vx-191pa13630vx-193pa13630vx-195pa13630vx-199pa13636f-90pa13636f-91pa13636f-93pa13636f-95pa13636f-96pa13636f-97pa13636f-98pa13636kpa13636tr-bkpa13636tr-cfpa13636tr-tnpa13636vx-181pa13636vx-183pa13636vx-185pa13636vx-191pa13636vx-193pa13636vx-195pa13636vx-199pa23648f-90pa23648f-91pa23648f-93pa23648f-95pa23648f-96pa23648f-97pa23648f-98pa23648kpa23648tr-bkpa23648tr-cfpa23648tr-tnpa23648vx-181pa23648vx-183pa23648vx-185pa23648vx-191pa23648vx-193pa23648vx-195pa23648vx-199pa23660f-90pa23660f-91pa23660f-93pa23660f-95pa23660f-96pa23660f-97pa23660f-98pa23660kpa23660tr-bkpa23660tr-cfpa23660tr-tnpa23660vx-181pa23660vx-183pa23660vx-185pa23660vx-191pa23660vx-193pa23660vx-195pa23660vx-199pa24860f-90pa24860f-91pa24860f-93pa24860f-95pa24860f-96pa24860f-97pa24860f-98pa24860kpa24860tr-bkpa24860tr-cfpa24860tr-tnpa24860vx-181pa24860vx-183pa24860vx-185pa24860vx-191pa24860vx-193pa24860vx-195pa24860vx-199pa33672f-90pa33672f-91pa33672f-93pa33672f-95pa33672f-96pa33672f-97pa33672f-98pa33672kpa33672tr-bkpa33672tr-cfpa33672tr-tnpa33672vx-181pa33672vx-183pa33672vx-18511Find non-illuminated outdoor bulletin boards discounted at TrophyCentral. Choose from a variety of styles and sizes. Start browsing now!1custom-pageenclosed-bulletin-boardspa33672vx-191pa33672vx-193pa33672vx-195pa33672vx-199pa34872f-90pa34872f-91pa34872f-93pa34872f-95pa34872f-96pa34872f-97pa34872f-98pa34872kpa34872tr-bkpa34872tr-cfpa34872tr-tnpa34872vx-181pa34872vx-183pa34872vx-185pa34872vx-191pa34872vx-193pa34872vx-195pa34872vx-199pa34896f-90pa34896f-91pa34896f-93pa34896f-95pa34896f-96pa34896f-97pa34896f-98pa34896kpa34896tr-bkpa34896tr-cfpa34896tr-tnpa34896vx-181pa34896vx-183pa34896vx-185pa34896vx-191pa34896vx-193pa34896vx-195pa34896vx-199pak10pak2pak3pak4pak5pak6pak7pak8pak9pakl10pakl2pakl3pakl5pakl6pakl8pakl9pn12418f-90pn12418f-91pn12418f-93pn12418f-95pn12418f-96pn12418f-97pn12418f-98pn12418kpn12418tr-bkpn12418tr-cfpn12418tr-tnpn13624f-90pn13624f-91pn13624f-93pn13624f-95pn13624f-96pn13624f-97pn13624f-98pn13624kpn13624tr-bkpn13624tr-cfpn13624tr-tnpn13630f-90pn13630f-91pn13630f-93pn13630f-95pn13630f-96pn13630f-97pn13630f-98pn13630kpn13630tr-bkpn13630tr-cfpn13630tr-tnpn13636f-90pn13636f-91pn13636f-93pn13636f-95pn13636f-96pn13636f-97pn13636f-98pn13636kpn13636tr-bkpn13636tr-cfpn13636tr-tnpn23648f-90pn23648f-91pn23648f-93pn23648f-95pn23648f-96pn23648f-97pn23648f-98pn23648kpn23648tr-bkpn23648tr-cfpn23648tr-tnpn23660f-90pn23660f-91pn23660f-93pn23660f-95pn23660f-96pn23660f-97pn23660f-98pn23660kpn23660tr-bkpn23660tr-cfpn23660tr-tnpn24860f-90pn24860f-91pn24860f-93pn24860f-95pn24860f-96pn24860f-97pn24860f-98pn24860kpn24860tr-bkpn24860tr-cfpn24860tr-tnpn33672f-90pn33672f-91pn33672f-93pn33672f-95pn33672f-96pn33672f-97pn33672f-98pn33672kpn33672tr-bkpn33672tr-cfpn33672tr-tnpn34872f-90pn34872f-91pn34872f-93pn34872f-95pn34872f-96pn34872f-97pn34872f-98pn34872kpn34872tr-bkpn34872tr-cfpn34872tr-tnpn34896f-90pn34896f-91pn34896f-93pn34896f-95pn34896f-96pn34896f-97pn34896f-98pn34896kpn34896tr-bkpn34896tr-cfpn34896tr-tnpw12418f-90pw12418f-91pw12418f-93pw12418f-95pw12418f-96pw12418f-97pw12418f-98pw12418kpw12418tr-bkpw12418tr-cfpw12418tr-tnpw13624f-90pw13624f-91pw13624f-93pw13624f-95pw13624f-96pw13624f-97pw13624f-98pw13624kpw13624tr-bkpw13624tr-cfpw13624tr-tnpw13630f-90pw13630f-91pw13630f-93pw13630f-95pw13630f-96pw13630f-97pw13630f-98pw13630kpw13630tr-bkpw13630tr-cfpw13630tr-tnpw13636f-90pw13636f-91pw13636f-93pw13636f-95pw13636f-96pw13636f-97pw13636f-98pw13636kpw13636tr-bkpw13636tr-cfpw13636tr-tnpw23648f-90pw23648f-91pw23648f-93pw23648f-95pw23648f-96pw23648f-97pw23648f-98pw23648kpw23648tr-bkpw23648tr-cfpw23648tr-tnpw23660f-90pw23660f-91pw23660f-93pw23660f-95pw23660f-96pw23660f-97pw23660f-98pw23660kpw23660tr-bkpw23660tr-cfpw23660tr-tnpw24860f-90pw24860f-91pw24860f-93pw24860f-95pw24860f-96pw24860f-97pw24860f-98pw24860kpw24860tr-bkpw24860tr-cfpw24860tr-tnpw33672f-90pw33672f-91pw33672f-93pw33672f-95pw33672f-96pw33672f-97pw33672f-98pw33672kpw33672tr-bkpw33672tr-cfpw33672tr-tnpw34872f-90pw34872f-91pw34872f-93pw34872f-95pw34872f-96pw34872f-97pw34872f-98pw34872kpw34872tr-bkpw34872tr-cfpw34872tr-tnpw34896f-90pw34896f-91pw34896f-93pw34896f-95pw34896f-96pw34896f-97pw34896f-98pw34896kpw34896tr-bkpw34896tr-cfpw34896tr-tnsilh20410silh20411silh20412silh20415silh20416silh20417silh20419silh20470silh20471silh20472silh20475silh20476silh20477silh20479silh20494silh20495ovg1-bbgovg1-bbkovg2-bbgovg2-bbkovk1-bbgovk1-bbkovk2-bbgovk2-bbkpa12418b-bgpa12418b-bkpa12418bx-bkpa13624b-bgpa13624b-bkpa13624bx-bkpa13630b-bgpa13630b-bkpa13630bx-bkpa13636b-bgpa13636b-bkpa13636bx-bkpa23648b-bgpa23648b-bkpa23660b-bgpa23660b-bkpa23660bx-bkpa24860b-bgpa24860b-bkpa24860bx-bkpa33672b-bgpa33672b-bkpa33672bx-bkpa34872b-bgpa34872b-bkpa34872bx-bkpa34896b-bgpa34896b-bkpa34896bx-bkpn12418b-bgpn12418b-bkpn13624b-bgpn13624b-bkpn13630b-bgpn13630b-bkpn13636b-bgpn13636b-bkpn23648b-bgpn23648b-bkpn23660b-bgpn23660b-bkpn24860b-bgpn24860b-bkpn33672b-bgpn33672b-bkpn34872b-bgpn34872b-bkpn34896b-bgpn34896b-bkpw12418b-bgpw12418b-bkpw13624b-bgpw13624b-bkpw13630b-bgpw13630b-bkpw13636b-bgpw13636b-bkpw23648b-bgpw23648b-bkpw23660b-bgpw23660b-bkpw24860b-bgpw24860b-bkpw33672b-bgpw33672b-bkpw34872b-bgpw34872b-bkpw34896b-bgpw34896b-bk11Find indoor bulletin boards discounted at TrophyCentral. Each indoor bulletin board is made in the USA by Ghent Manufacturing.1trophy-and-award-buying-lists11Explore a wide range of inexpensive trophies that are perfect for any occasion. Discover top picks under $10, $25, and $50 to reward and motivate achievements without breaking the bank.trophiescustom-pageribbons1-tiaras1"1-3 business days" "Topeka, Indiana" "UPS (Post Office Priority Mail also available)"465711-21 260.8244.4Tower RibbonSashes / Crowns / TiarasTiaras1:22%This Popular Infinity Series Tiara Is Sure To Be A Stand Out At Your Next Event! Ships In A Fast 1-2 Days.rtp6620custom-pagefreeawardcertificates1"Download Only"certificates49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Innovation Award template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Innovation-Award-Certificateinnovation-freeEntrepreneurshipcustom-pageaward-medalsmedallion-inserts-academic-medallion-insertsmedallion-inserts-general-medallion-insertsmedallion-inserts-military-medallion-insertsmedallion-inserts-motivational--recognition--salesmedallion-inserts-arts-and-music-medallionsmedallion-inserts-government-agencies-and-logosmedallion-inserts-fraternal-organizational-insertsmedallion-inserts-occupational-subjectsmascotinsertsmedallion-inserts-organizationssports-inserts50111111Find insert medals discounted at TrophyCentral. Each insert medals features a frame, 2" insert and ribbon. Each medal includes a neck ribbon. Fast 1-2 day shipping.Insert Medal Awards If you are looking for a unique or hard to find subject, this section is for you. Choose from hundreds of inserts, 2" discs that fit inside a medal frame. Inserts are generally available in color or a gold, silver, or bronze finish. You also can also choose the medal frame which is available in several styles and sizes. Medals in the above sections include a neck ribbon or military-style drape ribbon. Optional engraving is available on the back of any of the medals.]]>11These fabulous insert medals feature and customizable outer ring and a colorful 2" subject insert. Fast 2-3 day shipping; free over $99.1custom-pageplaquescherry-insert-plaquesholographic-insert-plaques5x7plaque5x7blacmarplps5866ps586412-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
498555-8.52Shop for Insert Plaques at TrophyCentral. Free Engraving on Insert Plaques.

Plaques with Inserts

The plaques in this section all accept inserts - 2" or 4" discs that depict various images and subjects. Inserts offer an alternative to traditional awards and trophy figures. Insert subjects include sports, school, business, religion, military, organizations and charities and many more. We also carry a large number of generic inserts - Rising Star, Most Improved, Excellence and many more - that can be used for any number of events. Many inserts are available in color or in gold, silver, bronze finishes to recognize different levels of achievement. Start by choosing the your plaque finish and size. Then select the desired options and enter engraving. Each insert plaque includes engraving (the number of lines depends on the size of the plaque). Most plaques ship in 4 to 6 business days.
]]>
custom-pageaward-medalsengravablemugcomsoonintrohandsawardblank-part-iblank-single-itorch-part-itorch-single-i1achievement-trophies-awards1Find insert trophies discounted at TrophyCentral. Each insert trophy features free personalization. Fast 1-2 day order processing!

Custom Insert Trophies & Awards - Recognition for Every Achievement

Insert trophies deliver flexible, affordable recognition across hundreds of activities, subjects, and organizations. From youth sports leagues honoring every participant at end-of-season banquets to schools presenting awards across academics, arts, and athletics in a single ceremony, insert trophies eliminate the need for separate trophy lines for every occasion. The interchangeable 2-inch subject discs snap into participation bases and single-column designs alike, making it easy to recognize football players and honor roll students, chess champions and volunteer coaches, all within a consistent, professional award format. Engraving plates personalize each trophy with recipient names, award titles, team or organization names, and the season or year, ensuring every insert trophy becomes a meaningful keepsake reflecting the specific achievement it honors.

Frequently Asked Questions About Insert Trophies

What are insert trophies and how do they work?

Insert trophies combine a standard trophy base with an interchangeable 2-inch subject disc that identifies the specific activity or achievement being recognized. Rather than purchasing separate sport-specific or activity-specific trophies for every occasion, coordinators select a base style, either participation height for youth programs or single-column height for individual award categories, and pair it with the appropriate disc from hundreds of available subjects. Subjects span every major and minor sport, academic disciplines including spelling, math, science, and reading, performing arts categories like music and drama, service roles such as coaching and volunteering, and recreational activities ranging from chess and cooking to cornhole and pinewood derby. The engraving plate on the base is then personalized with the recipient's name, award title, organization, and year, creating a fully customized award from a single flexible product line. This approach benefits multi-activity programs ordering in volume, since consistent base styles present a unified, professional appearance across an entire awards ceremony regardless of how many different activities are being recognized.

When should I choose insert trophies over sport-specific or activity-specific trophies?

Insert trophies are the practical choice when recognizing multiple activities within a single program or budget, when ordering participation trophies in volume for large youth leagues, or when an activity falls outside the most popular sports where dedicated figurine trophies are widely available. A recreation department running spring soccer, summer swim league, and fall flag football can stock a single participation base and simply swap subject discs, keeping ordering simple and costs predictable. Schools presenting end-of-year awards across a dozen academic and extracurricular categories benefit similarly, presenting a consistent award format while still honoring the specific achievement each student earned. Activity-specific trophies with dedicated figurines, such as a quarterback mid-throw or a batter mid-swing, remain the stronger choice when the sport is central to the award's meaning and the presentation warrants maximum visual impact, such as championship trophies, MVP awards, or all-star recognition where the figurine itself communicates the achievement. For participation recognition, multi-activity programs, budget-conscious leagues, and less common activities where figurine options are limited, insert trophies deliver equally meaningful recognition at an accessible price point.

Can insert discs be used in medals and plaques as well as trophies?

Yes. The standard 2-inch subject disc is designed to work across multiple award formats, not just trophy bases. Insert medals incorporate the same subject discs into a wearable medal format, making them ideal for track meets, field days, and multi-event competitions where participants receive awards immediately after competing rather than at a banquet. Insert medals include a ribbon and offer the same broad subject selection as trophy inserts, providing consistent visual identity across an entire awards program whether presenting trophies to top finishers and medals to all participants, or using medals exclusively for a large outdoor event where carrying trophies home is impractical. Plaques can also incorporate subject inserts for wall-mounted recognition displays, making them suitable for permanent hallway displays in schools and recreation centers honoring seasonal champions or outstanding students year over year. Mixing formats, such as trophies for top individual award winners, medals for broad participation recognition, and plaques for permanent display purposes, allows program directors to manage budgets strategically while maintaining a cohesive look across every piece of recognition presented at a single event.

If you need more information before deciding, see our expert resource section:
]]>
trophies-victory insert-trophies-awards
custom-pagegeneral-corporate-awards1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"410187-1010.45424.45JcharlesCrystal Awards1:22%,25:24%"crystal awards"This fabulous Inspiration Series Award with Crystal Base is individually crafted. Price includes personalization and gift box! Check out our discounted prices!030xGeneral11Discover the ultimate instrumental music trophy and medal guide! From concert bands to jazz ensembles, find creative award ideas that celebrate musical excellence and dedication.custom-pageglass-crystal-awards11"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"458221510.45636.45Vision AwardsTrophies1:22%,26:32%Interlude Award from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.custom-pagehigh-end-awards1"14 business days" "Erlanger, KY" "UPS"general410187-1010.451 2 3 4 5 6 7 8 9661JcharlesGeneral Awards1:22%,25:25%Intrigue Awards and Trophies from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.See all:glass-crystal-awards12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105503-60.7530036.751These medals come in gold, silver and bronze finishes and are perfect for recognizing different place winners.1ir-medals-all
custom-pagemedals-ir-series12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic Medallicsaward-medalsAcademic1:22%,10:27%,100:36%"School Medals" "School Awards"These 1 1/2 Inch Academic Achievement medals come in gold, silver and bronze finishes and are perfect for recognizing different place winners.ir23Academic
custom-pagemedals-ir-series12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic Medallicsaward-medalsGeneral1:22%,10:27%,100:36%"School Medals" "School Awards"These 1 1/2 Inch Achievement medals come in gold, silver and bronze finishes and are perfect for recognizing different place winners.ir2509-05-2012General, Torch, Achievement, 1st / 2nd / 3rd / Etc.
custom-pagemedals-ir-series12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,10:27%,100:36%"Sports Medals" "Sports Awards"These 1 1/2 Inch All Sports medals come in gold, silver and bronze finishes and are perfect for recognizing different place winners.ir19General
custom-pagetrophies-baseball12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,10:27%,100:36%"Baseball Medals" "Baseball Awards"IR Series Baseball Design - 1 1/2 Inch Medals in Multiple Finishes. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.ir13Baseball / T-Ball, Sports
custom-pagetrophies-basketball12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,10:27%,100:36%"Basketball Medals" "Basketball Awards"IR Series Basketball Design - 1 1/2" Medals. Ideal for leagues, schools, and tournaments. Fast shipping.ir12Basketball, Sports
custom-pagetrophies-football12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,10:27%,100:36%"Football Medals" "Football Awards"IR Series Football Design - 1 1/2" Medals. Ideal for leagues, schools, and tournaments. Fast shipping.ir11Football, Sports
custom-pagetrophies-golf12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,10:27%,100:36%"Golf Medals" "Golf Awards"IR Series Golf Design - 1 1/2" Medals. Ideal for leagues, schools, and tournaments. Fast shipping.ir18Golf, Sports
custom-pagemedals-ir-series12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic Medallicsaward-medalsGeneral1:22%,10:27%,100:36%"School Medals" "School Awards"These 1 1/2 Inch In Honor of Excellence medals come in gold, silver and bronze finishes and are perfect for recognizing different place winners.ir24Academic (General)
custom-pagemedals-ir-series12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic Medallicsaward-medalsAcademic1:22%,10:27%,100:36%"School Medals" "School Awards"These 1 1/2 Inch Lamp of Learning medals come in gold, silver and bronze finishes and are perfect for recognizing different place winners.ir33Academic
custom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,10:27%,100:36%"Track Medals" "Track Awards"These 1 1/2 Inch Marathon medals come in gold, silver and bronze finishes and are perfect for recognizing different place winners.ir36
custom-pagereadingawards12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic Medallicsaward-medalsAcademic1:22%,10:27%,100:36%"Reading Medals" "Reading Awards"These 1 1/2 Inch Reading medals come in gold, silver and bronze finishes and are perfect for recognizing different place winners.ir31Reading
custom-pagetrophies-soccer12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,10:27%,100:36%"Soccer Medals" "Soccer Medals and Trophies" "Soccer Trophies and Medals"IR Series Soccer Design - 1 1/2 Inch Medals. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.ir14Soccer, Sports
custom-pagestar-trophies12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic Medallicsaward-medalsGeneral1:22%,10:27%,100:36%"School Medals" "School Awards"These 1 1/2 Inch Star Performer medals come in gold, silver and bronze finishes and are perfect for recognizing different place winners.ir26General, Star
custom-pagetrophies-swimming-diving12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,10:27%,100:36%"Swimming Medals" "Swimming Awards"These 1 1/2 Inch Swimming medals come in gold, silver and bronze finishes and are perfect for recognizing different place winners.ir16Return to the section for other great styles.swimmingmedals1Swimming / Diving, Sports
custom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,10:27%,100:36%"Track Medals" "Track Awards"These 1 1/2 Inch Track medals come in gold, silver and bronze finishes and are perfect for recognizing different place winners.ir15
custom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,10:27%,100:36%"Track Medals" "Track Awards"These 1 1/2 Inch Track Runners w/Scroll, Female medals come in gold, silver and bronze finishes and are perfect for recognizing different place winners.ir38
custom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,10:27%,100:36%"Track Medals" "Track Awards"These 1 1/2 Inch Track, Female medals come in gold, silver and bronze finishes and are perfect for recognizing different place winners.ir21
custom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,10:27%,100:36%"Track Medals" "Track Awards"These 1 1/2 Inch Track w/Scroll, Male medals come in gold, silver and bronze finishes and are perfect for recognizing different place winners.ir39
custom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,10:27%,100:36%"Track Medals" "Track Awards"These 1 1/2 Inch Track, Male medals come in gold, silver and bronze finishes and are perfect for recognizing different place winners.ir20
custom-pagetrophies-wrestling12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,10:27%,100:36%"Wrestling Medals" "Wrestling Awards"These Boy's Wrestling IR Series Medals come in three finishes, measure 1 1/2" and are perfect for recognizing different place winners.ir17Wrestling, Sports
custom-pagetrophies-wrestling12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,10:27%,100:36%"Wrestling Medals" "Wrestling Awards"Find These 1 1/2 Inch Wrestling Hold Medals Discounted at TrophyCentral. Available in gold, silver and bronze finishes.ir35Wrestling, Sports
custom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,10:27%,100:36%"Track Medals" "Track Awards"These 1 1/2 Inch Track w/Scroll, Female medals come in gold, silver and bronze finishes and are perfect for recognizing different place winners.ir40
custom-pageplace-medals1first-place-ribbons2-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,10:27%,100:36%"School Medals" "School Awards"These 1 1/2 Inch First Place Olympic Medals come in gold, silver and bronze finishes and are perfect for recognizing different place winners.ir27See our complete selection ofin other popular styles.award-medals11-01-2019General, Torch, Achievement, 1st / 2nd / 3rd / Etc.
custom-pagemedals-ir-series12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
"PT1=Medals" "PC11=105503-60.7530036.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,10:27%,100:36%"School Medals" "School Awards"These 1 1/2 Inch Third Place Medals come in gold, silver and bronze finishes and are perfect for recognizing different place winners.ir29See all of our fabulousin a huge variety of styles.award-medals03-15-2015General, Torch, Achievement, 1st / 2nd / 3rd Place
custom-pagebadgeribbonsholders1"7-10 business days from receipt of camera-ready artwork" "City of Industry, CA" "UPS (FedEx available on request)"917457-10146022BNRibbonsBadge Holders1nw-3613irblcustom-pageletter-shaped-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find these popular J-shaped custom mascot badges at TrophyCentral. Great for fundraising! TrophyCentral is a top-rated Yahoo merchant.letterbadges-jcustom-pageacrylicawards11"1-2 business days" "Marquette, MI" "UPS"general498552-310.453021.45JDS-SCrystal Awards1:14%"New Products"Find this fun Jade Acrylic Award with Black Base Discounted at TrophyCentral. Price Includes Engraving of Logo and Text! Fast 1-2 Day Processing!Generalcustom-pagestar-trophies1"1-2 business days" "Marquette, MI" "UPS"trophies498552-310.453021.45Quick TrophyCrystal Awards1:14%"New Products"Find these fun Jade Acrylic Rising Star Awards with Brass Base .custom-pageclocks11"6-10 business days w/engraving, 1-3 without" "Chicago, Illinois" "UPS (FedEx available on request)"personalized gifts606306-101 3 230.451619.65RS OwensGiftsClocks1:22%Jade Awards Clock from TrophyCentral. See our great selection of engraved and personalized gifts!Engraved Clockscustom-pageglass-crystal-awards11"5-10 business days w/engraving" "Mt. Vernon, NY" "UPS (FedEx available on request)"105505-1010.4511216.65Classic Medallics1:22%,5:34%"Minuteman" "General Recognition Awards" "Crystal Globe Awards" "Engraved Crystal Awards" "Crystal Star Awards" "Optical Crystal Awards" "Etched Crystal Awards" "Crystal Awards" "Corporate Crystal" "Crystal Trophies" "Crystal Award Section" "Crystal Trophy Section" "Crystal Corporate Gifts" "Crystal Corporate Awards" "Crystal Corporate Award Section" "Corporate Crystal Awards" "Crystal Trophy"Find these jade glass awards discounted at TrophyCentral! Each jade award features free engraving and a gift box. Shipping is also free over $99!custom-pagetrophies-swimming-diving1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.552417.35Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,50:29%Find These Swimming 3D Acrylic Relief Awards Discounted At TrophyCentral. Price Includes Up to 4 Lines of Engraving!qtswimacrSwimming / Diving, Sportscustom-pagemascot-plaques1plaques498552-41JDSPlaques1Find this jaguar plaque discounted at TrophyCentral. Our jaguar mascot plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Mascotcustom-pagemascottrophies1"4-6 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)""PT1=Trophies" "PC11=105503-610.4511016.25Classic MedallicsTrophiesAcademic1:22%,5:24%,10:28%,50:32%"Mascot Awards"Buy this Jaguar mascot trophy and other mascot awards at TrophyCentral.mt200612-20-2040Mascotcustom-pagetop-awards-by-category11An in-depth look at the James Beard Award and its 2024-2025 candidates, including a list of previous winners from the past 10 years.1custom-pagemusicartpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsMusic, Drama, Art, Dance1:22%,50:28%,100:32%,500:42%"Music Lapel Pins" "Band Lapel Pins" "Band Awards" "School Pins"Find Lyre - Jazz Band pins at TrophyCentral. Each AP Series Lyre - Jazz Band pin includes a clutch back.ap6108-01-2024Music / Band / Choruscustom-pagenoname1111"3-4 business days" "Marquette, Michigan" "UPS"display case498552-410.451134.0011Hockey, Sports11Join the TrophyCentral Mailing List and receive exclusive special discounts and promotions.custom-pagemedallion-inserts-occupational-subjects12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these high-quality Judicial Award Of Excellence Inserts at TrophyCentral. Each Judicial Award Of Excellence Insert can be used to create a unique plaque, medal or trophy.518778Occupations
custom-pagedraprib138x111105502-410.45183.65Classic Medallics1:14%Find jumprings for attaching your ribbons to medals at TrophyCentral. Sold in bags of 100.custom-pagemedallion-inserts-occupational-subjects12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Justice Inserts (Litho) at TrophyCentral. Each Justice Insert can be used to create a unique plaque, medal or trophy.501491General, Occupations
custom-pagemedallion-inserts-occupational-subjects12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these high-quality Justice Inserts at TrophyCentral. Each Justice Insert can be used to create a unique plaque, medal or trophy.517835General
custom-pageletter-shaped-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find these popular K-shaped custom mascot badges at TrophyCentral. Great for fundraising! TrophyCentral is a top-rated Yahoo merchant.letterbadges-kcustom-pagecoaching-teaching-guides11Transform your elementary classroom with engaging educational games, brain breaks, and learning activities. Includes free award certificates and proven classroom management strategies.custom-pagecrystalgifts6"7-10 business days" "Kentucky" "UPS (FedEx available on request)"personalized gifts410187-1010.451218.45JcharlesGiftsCrystal Gifts1:22%,100:22%"personalized gifts"Find the Kaleidoscope Paperweight at TrophyCentral. Add engraving to your paperweight for a special touch!Crystal Giftscustom-pagetrophies-karate-martial-arts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Karate Medals"Buy these quality Karate (501161) Inserts (Litho) at TrophyCentral. Each Karate (501161) Insert can be used to create a unique plaque, medal or trophy.501161Karate / Martial Arts, Sports
custom-pagetrophies-karate-martial-arts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Karate Medals"Buy these quality Karate (507129) Inserts (Litho) at TrophyCentral. Each Karate (507129) Insert can be used to create a unique plaque, medal or trophy.507129Karate / Martial Arts, Sports
custom-pagetrophies-karate-martial-arts1trophies498551-310.452429Trophies1Find this popular Karate trophy discounted at TrophyCentral. Features a real marble base, free engraving and fast shipping.karate-cup-place-trophy-tccustom-pagetrophies-karate-martial-arts1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular karate figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at trophyCentral. Ships in a fast 1-2 days!qtkarateplKarate / Martial Arts, 1st / 2nd / 3rd / Etc., Sportscustom-pagetrophies-karate-martial-arts20498552-40.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful Karate 2" Epoxy-covered insert decal discounted at TrophyCentral. Fast 1-2 day shipping.Karate / Martial Arts, Sportscustom-pagetrophies-karate-martial-arts1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%This popular Karate trophy features a real marble base, column, figure and trim indicating year of award. Includes up to three lines of free engraving!qtkarateyrSee morefor all of your individual and team needs.trophies-karate-martial-artsKarate / Martial Arts, Sportscustom-pagetrophies-karate-martial-arts1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with karate figure discounted at TrophyCentral. Includes free text engraving!cup-karate-pKarate / Martial Arts, Sportscustom-pagetrophies-karate-martial-arts1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Karate Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Karate / Martial Arts, Sportscustom-pagetrophies-karate-martial-arts1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these karate budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtkaratescbKarate / Martial Arts, Sportscustom-pagetrophies-karate-martial-arts1498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Find this budget karate award trophy discounted at Trophy Central. Features a real marble base and plastic karate figure. Engraving is free. Fast 1-2 day shipping.bdg-karateKarate / Martial Arts, Sportscustom-pagetrophies-karate-martial-arts1trophies498552-411229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find this karate champion's cup trophy discounted at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's Cup - KarateKarate / Martial Arts, Sportscustom-pagetrophies-karate-martial-arts1trophies498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Karate insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-Karate-InsertKarate / Martial Arts, Sportscustom-pagetrophies-karate-martial-arts1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous two-tier Karate Three-Column Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtkaratettKarate / Martial Arts, Sportscustom-pagetrophies-karate-martial-arts1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.215Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%See this championship trophy with a Karate figure at TrophyCentral. Be sure to see all of our Karate figure awards.qtkaratettwReturn to thesection to see our complete selection.trophies-karate-martial-artsKarate / Martial Arts, Sportscustom-pagetrophies-karate-martial-arts1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Karate single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - KarateKarate / Martial Arts, Sportscustom-pagetrophies-karate-martial-arts1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%This popular Karate Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtkaratescKarate / Martial Arts, Sportscustom-pagetrophies-karate-martial-arts1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451623.65Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%These quick-ship trophies from TrophyCentral feature a Karate figure, real marble base and marble trophy figure platform, choice of column size and color.qtkaratedmKarate / Martial Arts, Sportscustom-pagetrophies-karate-martial-arts1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Karate figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-karate-scbKarate / Martial Arts, Sportscustom-pagetrophies-karate-martial-arts1trophies498551-310.71217.38trophies1Karate / Martial Arts, Sportscustom-pagetrophies-karate-martial-arts1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Karate Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Karate / Martial Arts, Sportscustom-pagetrophies-karate-martial-arts1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous two-tier, 3-column champion Karate Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtkarate3cSee morefor your champions!trophies-karate-martial-artsKarate / Martial Arts, Sportscustom-pagetrophies-karate-martial-arts1medals498552-30.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Colorful Karate insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Karate / Martial Arts, Sportscustom-pagetrophies-karate-martial-arts1medals498552-40.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Karate insert medal With A Personalized Front Rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Karate / Martial Arts, Sportscustom-pagecherry-insert-plaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these karate insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Karate / Martial Arts, Sportscustom-pagetrophies-karate-martial-arts1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our karate insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - KarateKarate / Martial Arts, Sportscustom-pagetrophies-karate-martial-arts1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%,25:23%,50:29%,100:34%Our Karate and Martial Arts Participation Trophies feature a real slant-front white marble base and free personalization. Significant quantity discounts available.qtkaratencReturn to the section for other great choices.trophies-karate-martial-artsKarate / Martial Arts, Sportscustom-pagetrophies-karate-martial-arts1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.4234Quick TrophyTrophies1:14%,3:15%,10:16%"Karate Awards" "Karate Trophies"Find this Perpetual Karate Trophy Discounted at TrophyCentral. Each Trophy has enough room for 32 names. Ships in just 1-2 days.qtkarateperpKarate / Martial Arts, Sportscustom-pagetrophies-karate-martial-arts1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Karate Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Karate / Martial Arts, Sportscustom-pageshop-by-categorykarate-plaque-ikarate-ei5011615071291trophies1"Karate Awards" "Sports Trophies"

Custom Karate Trophies & Awards - Honor Every Belt, Kata, and Champion

Karate trophies celebrate the discipline, perseverance, and martial arts excellence that define a sport where progress is measured one belt at a time and victory is earned through months of dedicated training. From youth recreational programs where young students earn their first colored belt and take part in their first dojo tournament, to competitive club and school programs where advanced students compete in kata and kumite events, from regional open tournaments drawing competitors across multiple styles and weight classes, to black belt promotions and instructor recognition ceremonies honoring years of mastery, quality martial arts awards honor athletes and sensei across every level and discipline. Our versatile selection includes participation trophies and budget series awards ideal for youth class recognition, single and double column trophies featuring karate figure figurines in dynamic action poses, place trim trophies for 1st, 2nd, and 3rd in kata and sparring divisions, two-tier and three-column championship trophies for tournament overall winners, perpetual trophies ideal for passing between annual dojo champions, insert plaques customizable for any school or tournament name, and medals in gold, silver, and bronze perfect for large tournaments recognizing multiple divisions and weight classes.

Frequently Asked Questions About Karate Trophies

What trophy sizes work best for different karate award categories?

Youth class programs and belt promotion ceremonies benefit from 6-inch to 9-inch participation trophies ensuring every student receives recognition for their progress and dedication, building confidence and encouraging continued training. Division placers and category winners at local and club tournaments deserve 10-inch to 14-inch single column trophies with karate figurines that distinguish competitive achievement from participation awards. Overall winners and top finishers across multiple divisions warrant 15-inch to 18-inch premium trophies with substantial presence reflecting superior performance across a full tournament bracket. Grand champions and annual dojo title holders demand 20-inch to 24-inch two-tier or three-column trophies whose height and weight convey the prestige of the achievement. Medals in gold, silver, and bronze work especially well for large open tournaments recognizing multiple divisions, weight classes, and age groups where awarding every placer a trophy is impractical.

What details should karate trophy engraving include?

Essential elements include athlete name, award title, dojo or school name, tournament or event name, and year. For competitive tournaments, adding the division, weight class, and place finish creates a complete record of the achievement. Belt promotion awards gain meaning from including the belt level earned. Instructor and sensei recognition awards benefit from noting years of service or rank. Keep text concise and readable, prioritizing the most meaningful details when space on smaller trophies requires choices.

Do you offer bulk discounts for karate tournaments and dojos?

Yes, Trophy Central offers significant bulk discounts on karate trophies and medals that scale with order quantity, keeping award budgets manageable for tournaments and programs of any size. Tournament directors purchasing medals across multiple divisions and weight classes, dojo owners buying year-end awards for an entire student roster, and schools ordering belt promotion trophies for a full class all benefit from bulk pricing. Browse our karate medals above for the most budget-friendly option when recognizing large fields.

If you need more information before deciding, see our expert resource section:
]]>
trophies
custom-pagefloor-standing-keepsake1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake Carmel oak floor display case w/ clear glass back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-mkFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake Carmel oak floor display case w/ clear glass back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-mkFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake Carmel oak floor display case w/ clear glass back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-mkFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake Carmel oak floor display case w/ mirror back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-mkFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake Carmel oak floor display case w/ mirror back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-mkFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake Carmel oak floor display case w/ mirror back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-mkFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake Carmel oak floor display case w/ plaque fabric back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-mkFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake Carmel oak floor display case w/ plaque fabric back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-mkFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake Carmel oak floor display case w/ plaque fabric back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024pb-bz-akFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake Carmel oak lighted display case w/ clear glass back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D .4124cb-bz-akFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake Carmel oak lighted display case w/ clear glass back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D.4124cb-bz-akFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake Carmel oak lighted display case w/ mirror back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D .4124mb-bz-akFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake Carmel oak lighted display case w/ mirror back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"h x 24"W x 24"D.4124mb-bz-akFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake Carmel oak lighted display case w/ mirror back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D .4124mb-bz-akFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake Carmel oak lighted display case w/ plaque fabric back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D .4124pb-bz-akFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake Carmel oak lighted display case w/ plaque fabric back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D .4124pb-bz-akFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake Carmel oak lighted display case w/ plaque fabric back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D .4124pb-bz-akFloor-Standingcustom-pagefloor-standing-keepsake1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake driftwood oak floor display case w/ clear glass back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-dkFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake driftwood oak floor display case w/ clear glass back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-dkFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake driftwood oak floor display case w/ clear glass back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-dkFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake driftwood oak floor display case w/ mirror back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-dkFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake driftwood oak floor display case w/ mirror back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-dkFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake driftwood oak floor display case w/ mirror back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-dkFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake driftwood oak floor display case w/ plaque fabric back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-dkFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake driftwood oak floor display case w/ plaque fabric back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-dkFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake driftwood oak floor display case w/ plaque fabric back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-dkFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake driftwood oak lighted display case w/ clear glass back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D .4124cb-bz-akFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake driftwood oak lighted display case w/ clear glass back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D .4124cb-bz-akFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake driftwood oak lighted display case w/ clear glass back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D .4124cb-bz-akFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake driftwood oak lighted display case w/ mirror back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D .4124mb-bz-akFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake driftwood oak lighted display case w/ mirror back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D .4124mb-bz-akFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake driftwood oak lighted display case w/ mirror back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D .4124mb-bz-akFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake driftwood oak lighted display case w/ plaque fabric back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D .4124pb-bz-akFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake driftwood oak lighted display case w/ plaque fabric back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D .4124pb-bz-akFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake driftwood oak lighted display case w/ plaque fabric back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D .4124pb-bz-akFloor-Standingcustom-pagefloor-standing-keepsake1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake light oak vinyl floor display case w/ clear glass back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-lvFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake light oak vinyl floor display case w/ clear glass back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-lvFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake light oak vinyl floor display case w/ clear glass back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-lvFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake light oak vinyl floor display case w/ mirror back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-lvFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake light oak vinyl floor display case w/ mirror back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-lvFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake light oak vinyl floor display case w/ mirror back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-lvFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake light oak vinyl floor display case w/ plaque fabric back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-lvFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake light oak vinyl floor display case w/ plaque fabric back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-lvFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake light oak vinyl floor display case w/ plaque fabric back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-lvFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake light oak vinyl lighted display case w/ clear glass back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D.4124cb-bz-akFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake light oak vinyl lighted display case w/ clear glass back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D .4124cb-bz-akFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake light oak vinyl lighted display case w/ clear glass back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D .4124cb-bz-akFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake light oak vinyl lighted display case w/ clear glass back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D.4124cb-bz-akFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake light oak vinyl lighted display case w/ mirror back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D .4124mb-bz-akFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake light oak vinyl lighted display case w/ mirror back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D.4124mb-bz-akFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake light oak vinyl lighted display case w/ mirror back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D .4124mb-bz-akFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake light oak vinyl lighted display case w/ plaque fabric back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D .4124pb-bz-akFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake light oak vinyl lighted display case w/ plaque fabric back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D .4124pb-bz-akFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake light oak vinyl lighted display case w/ plaque fabric back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D . Model: 4124pb-sn-lv.4124pb-bz-akFloor-Standingcustom-pagefloor-standing-keepsake1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake natural oak floor display case w/ clear glass back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-akFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake natural oak floor display case w/ clear glass back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-akFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake natural oak floor display case w/ clear glass back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-akFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake natural oak floor display case w/ mirror back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-akFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake natural oak floor display case w/ mirror back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-akFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake natural oak floor display case w/ mirror back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-akFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake natural oak floor display case w/ plaque fabric back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-akFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake natural oak floor display case w/ plaque fabric back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-akFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake natural oak floor display case w/ plaque fabric back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-akFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake natural oak lighted display case w/ clear glass back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D.4124cb-bz-akFloor-Standingcustom-pagefloor-standing-keepsake1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake natural oak lighted display case w/ clear glass back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D .4124cb-bz-akFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake natural oak lighted display case w/ clear glass back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D.4124cb-bz-akFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake natural oak lighted display case w/ mirror back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D .4124mb-bz-akFloor-Standingcustom-pagefloor-standing-keepsake1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake natural oak lighted display case w/ mirror back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D .4124mb-bz-akFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake natural oak lighted display case w/ mirror back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D .4124mb-bz-akFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake natural oak lighted display case w/ plaque fabric back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D .4124pb-bz-akFloor-Standingcustom-pagefloor-standing-keepsake1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake natural oak lighted display case w/ plaque fabric back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D .4124pb-bz-akFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake natural oak lighted display case w/ plaque fabric back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D .4124pb-bz-akFloor-Standingcustom-pagedisplaycases14024mb-gd-mk4024mb-gd-ak4024mb-gd-wv4124mb-gd-mk4024mb-gd-dk4124mb-gd-ak4124mb-gd-wv4024mb-gd-lv4124mb-gd-dk4124mb-gd-lv4024mb-bz-mk4024mb-bz-ak4024mb-bz-wv4124mb-bz-mk4024mb-bz-dk4124mb-bz-ak4124mb-bz-wv4024mb-bz-lv4124mb-bz-dk4124mb-bz-lv4024mb-sn-mk4024mb-sn-ak4024mb-sn-wv4124mb-sn-mk4024mb-sn-dk4124mb-sn-ak4124mb-sn-wv4024mb-sn-lv4124mb-sn-dk4124mb-sn-lv4024pb-gd-mk4024pb-gd-ak4024pb-gd-wv4124pb-gd-mk4024pb-gd-dk4124pb-gd-ak4124pb-gd-wv4024pb-gd-lv4124pb-gd-dk4124pb-gd-lv4024pb-bz-mk4024pb-bz-ak4024pb-bz-wv4124pb-bz-mk4024pb-bz-dk4124pb-bz-ak4124pb-bz-wv4024pb-bz-lv4124pb-bz-dk4124pb-bz-lv4024pb-sn-mk4024pb-sn-ak4024pb-sn-wv4124pb-sn-mk4024pb-sn-dk4124pb-sn-ak4124pb-sn-wv4024pb-sn-lv4124pb-sn-dk4124pb-sn-lv4024cb-gd-ak4024cb-gd-dk4024cb-gd-lv4024cb-gd-mk4024cb-gd-wv4124cb-gd-ak4124cb-gd-dk4124cb-gd-lv4124cb-gd-mk4124cb-gd-wv4024cb-bz-ak4024cb-bz-dk4024cb-bz-lv4024cb-bz-mk4024cb-bz-wv4124cb-bz-ak4124cb-bz-dk4124cb-bz-lv4124cb-bz-mk4124cb-bz-wv4024cb-sn-ak4024cb-sn-dk4024cb-sn-lv4024cb-sn-mk4024cb-sn-wv4124cb-sn-ak4124cb-sn-dk4124cb-sn-lv4124cb-sn-mk4124cb-sn-wv3148ht-gd-lb3160ht-gd-lb3148ht-bz-lb3160ht-bz-lb3148ht-sn-lb3160ht-sn-lb3148sd-gd-lb3160sd-gd-lb3148sd-bz-lb3160sd-bz-lb3148sd-sn-lb3160sd-sn-lb11Find Keepsake Series display cases from Waddell discounted at TrophyCentral. Each Keepsake display case is made in the US by Waddell.displaycases1floor-standing-merchandiser wall-mounted-legacycustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake tabletop display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 48"W x 38"H. Model: 3148ht-gd-lb.3148ht-sn-lbTabletopcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake tabletop display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 60"W x 38"H. Model: 3160ht-gd-lb.3160ht-bz-lbTabletopcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake tabletop display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 48"W x 38"H. Model: 3148ht-bz-lb.3148ht-sn-lbTabletopcustom-pagefloor-standing-keepsake1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake tabletop display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 60"W x 38"H. Model: 3160ht-bz-lb.3160ht-bz-lbTabletopcustom-pagefloor-standing-keepsake1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake tabletop display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 48"W x 38"H. Model: 3148ht-sn-lb.3148ht-sn-lbTabletopcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake tabletop display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 60"W x 38"H. Model: 3160ht-sn-lb.3160ht-bz-lbTabletopcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake tabletop display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 48"W x 38"H. Model: 3148sd-gd-lb.3148sd-bz-lbTabletopcustom-pagefloor-standing-keepsake1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake tabletop display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 60"W x 38"H. Model: 3160sd-gd-lb.3160sd-gd-lbTabletopcustom-pagefloor-standing-keepsake1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake tabletop display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 48"W x 38"H. Model: 3148sd-bz-lb.3148sd-bz-lbTabletopcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake tabletop display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 60"W x 38"H. Model: 3160sd-bz-lb.3160sd-gd-lbTabletopcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake tabletop display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 48"W x 38"H. Model: 3148sd-sn-lb.3148sd-bz-lbTabletopcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake tabletop display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 60"W x 38"H. Model: 3160sd-sn-lb.3160sd-gd-lbTabletopcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake walnut vinyl floor display case w/ clear glass back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-bz-akFloor-Standingcustom-pagefloor-standing-keepsake1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake walnut vinyl floor display case w/ clear glass back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-bz-wvFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake walnut vinyl floor display case w/ clear glass back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-bz-wvFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake walnut vinyl floor display case w/ mirror back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-bz-wvFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake walnut vinyl floor display case w/ mirror back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-bz-wvFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake walnut vinyl floor display case w/ mirror back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-bz-wvFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake walnut vinyl floor display case w/ plaque fabric back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-bz-wvFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake walnut vinyl floor display case w/ plaque fabric back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-bz-wvFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake walnut vinyl floor display case w/ plaque fabric back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-bz-wvFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake walnut vinyl lighted display case w/ clear glass back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D.4124cb-bz-akFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake walnut vinyl lighted display case w/ clear glass back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D .4124cb-bz-akFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake walnut vinyl lighted display case w/ clear glass back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D.4124cb-bz-akFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake walnut vinyl lighted display case w/ mirror back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D .4124mb-bz-akFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake walnut vinyl lighted display case w/ mirror back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D .4124mb-bz-akFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake walnut vinyl lighted display case w/ mirror back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D .4124mb-bz-akFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake walnut vinyl lighted display case w/ plaque fabric back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D .4124pb-bz-akFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake walnut vinyl lighted display case w/ plaque fabric back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D .4124pb-bz-akFloor-Standingcustom-pagefloor-standing-keepsake145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake walnut vinyl lighted display case w/ plaque fabric back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D .4124pb-bz-akFloor-Standingcustom-pagepersonalized-giftspk51-cmpk67-cmpk56-cmpk70-cmpk69-cmpk73-cmpk68-cmpk80-cmpk66-cmpk87-cmpk106-cmpk99-cmpk58-cmpk62-cmpk88-cmpk57-cmpk81-cmpk100-cmpk89-cmpk95-cmpk75-cmpk96-cmpk109-cmpk110-cmpk108-cmpk111-cmpk107-cm11"School Products"These pewter key chains are available in a variety of subjects and have the option of engraving on the back.

Engraved Keychains - Personalized Keychains for Sports, Coaches, and Every Occasion

Engraved keychains occupy a practical sweet spot in team and personal gifting that trophies and medals cannot fill on their own. They are small enough to be affordable for large group orders, useful enough that recipients carry them every day rather than storing them in a closet, and personal enough that optional engraving on the back with a name, date, or message transforms a simple item into a genuine keepsake. Our pewter keychain collection features sport-specific and activity-themed designs spanning football, soccer, baseball, basketball, swimming, track and field, and dozens of additional subjects, making it easy to match the keychain design to the recipient's activity and the occasion being recognized. Youth sports leagues use engraved keychains as affordable end of season gifts that complement trophies and medals in a complete recognition package, while individual coaches, parents, and families give them as personal appreciation tokens that travel with the recipient long after the season ends. Volume pricing makes it practical to order engraved keychains for every player on a roster without straining a team gift budget.

Frequently Asked Questions About Engraved Keychains

What occasions are personalized keychains most commonly used for?

Engraved keychains are one of the most versatile recognition and gift items available precisely because they are appropriate for virtually any occasion where a personal, affordable, practical gift is needed. Youth sports leagues present them at end of season banquets as individual player keepsakes that complement trophies and medals in a complete recognition package, giving every athlete something to carry with them that represents their season. Coach appreciation gifts are among the most popular keychain occasions because a sport-themed keychain engraved with the coach's name and season year is a personal, thoughtful gift that a coach will actually use rather than add to a shelf full of generic plaques. Team bag tags for sports equipment bags are a practical application that keeps the recognition visible at every practice and game throughout the following season. Graduation gifts, confirmation keepsakes, and milestone birthday presents suit engraved keychains when the giver wants something personal and lasting without the cost of a larger gift. Corporate programs use them as event giveaways, trade show items, and new employee welcome gifts where a branded or personalized item makes a better impression than a business card alone. The combination of sport-specific pewter design on the front and optional personal engraving on the back makes them meaningful across all these contexts without requiring a large per-unit budget.

What should I engrave on a keychain?

Keychain engraving is the most space-constrained of any recognition item, so concise and specific text always produces the best result. The back of a pewter keychain typically accommodates two to three short lines of text, making every word count. For sports gifts, a player name with team name and season year covers the essential elements in two clean lines: Alex Rivera, Warriors Soccer, 2025. Coach appreciation keychains work well with the coach's name on the first line and a brief sentiment or season detail on the second: Coach Thompson, Thank You, Fall 2025 or Coach Martinez, 10 Seasons, Lincoln Baseball. For personal milestone gifts, name plus occasion plus year is always a reliable format: Emma Walsh, Confirmed 2025 or Michael Torres, Class of 2025. Team gifts where every player receives the same keychain with individual name personalization benefit from a consistent format across the full order so the overall presentation looks intentional rather than improvised. Avoid long phrases or full sentences since they reduce the font size to the point of illegibility on a small engraving surface. When in doubt, less text engraved at a larger, more readable size makes a stronger impression than cramming every detail onto the available space.

How do engraved keychains fit into a complete team recognition program?

Engraved keychains work best as part of a layered recognition approach rather than as a standalone award, complementing trophies, medals, and other recognition formats at different price points and for different purposes within the same program. In a typical youth sports end of season recognition package, trophies or medals serve as the primary award that every player receives at the banquet to mark their participation or competitive achievement, while an engraved keychain functions as a secondary personal gift that adds individual recognition without significantly increasing the per-player budget. This layered approach means every athlete goes home with both a display award for their shelf and a daily-use item they will carry for the next year, reinforcing the recognition long after the banquet ends. For coach and volunteer recognition where a trophy might feel too formal and a plaque requires wall space the recipient may not have, a quality engraved keychain paired with a handwritten thank you note creates a personal, low-cost recognition package that coaches and volunteers consistently appreciate. For programs working within a tight budget per player, keychains can serve as the primary individual gift while a single championship trophy or team plaque covers the collective recognition, keeping costs manageable while still ensuring every participant receives something personalized. See our complete collections of award medals, trophies, and engraved gifts for all the recognition formats that pair well with engraved keychains in a complete team award program.

If you need more information before deciding, see our expert resource section:
]]>
custom-pagegavelplaques1crkeytoci2-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
plaques105503-610.451828.45ClassicPlaquesKey Plaques1:22%This key to the city plaque is a perfect way to honor visitors and special guests. Each key to the city plaque includes free engraving!key-to-the-city-plaqueKey, Key to the City
custom-pagebadgeribbonsholders1"7-10 business days from receipt of camera-ready artwork" "City of Industry, CA" "UPS (FedEx available on request)"917457-10146022.6BNRibbonsBadge Holders1Find these khaki neck wallets discounted at TrophyCentral. Price includes a free one-color imprint!nw-3633khkcustom-pagetrophies-cheerleading-spirit1"2-4 business days + shipping time" "Marquette, MI" "UPS (FedEx available on request)"trophies498552-310.452419.65JDS-STrophiesSports, Hobby, Org, Livestock1:22%,100:36%"Cheerleader Awards" "Cheerleader Trophies" "Cheer Awards" "Cheerleading Awards" "Cheerleader Awards"Shop for Classic Economy Cheerleader Trophies at TrophyCentral. We offer quick shipping and free trophy engraving!iachrfCheerleading, Sportscustom-pageschool-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"Find these Kids First pins discounted at TrophyCentral. Each Kids First lapel pin features a gold finish and clutch-back.br36312-20-2020Academiccustom-pageachievement-certificates-awards1"Download Only"free-academic4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Kindergarten Diploma template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Kindergarten-Diploma-Certificatekindergarten-diploma-freeDiploma, Academic, Graduationcustom-pagequickshiptrophies-graduate1certificates290631-31 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,25:24%,100:40%,500:50%"Graduation Award" "Graduation Awards"Find These Printed Kindergarten Diploma certificates at TrophyCentral. Each Kindergarten Diploma certificate measures 11 x 8 1/2 inches.961Kindergarten, Academiccustom-pageribbons1-tiarasc803c802c8051ribbons11"School Products" "Quick-Ship Items" "Homecoming Sashes" "Sashes" "Homecoming Sash" "School Sashes" "Pageant Sashes" "Custom Sashes" "Beauty Pageant Sashes" "Graduation Sashes" "Pageant Sash" "Prom Sashes" "Prom Sash"Find king crowns discounted at TrophyCentral. Each king crown ships in just 1-2 days. Perfect for homecoming, parades and other events.

Crowns for Homecoming, Proms, Pageants and Parades!

Looking for the perfect king crown to celebrate your next event or competition? Look no further than TrophyCentral.com! We offer a wide variety of regal king crowns to fit any occasion or budget. Our crowns come in a range of styles and materials, from traditional metal and velvet to glittering rhinestone and crystal designs. Whether you're looking for a classic and timeless design or something more extravagant and eye-catching, TrophyCentral has the perfect king crown for you. Plus, with our easy online ordering process and fast shipping, getting the perfect crown for your next event has never been easier. Our top-rated service reps are happy to assist you with all of your pageant, school prom and homecoming needs. Our experts in New York, Michigan, and online have been providing suggestions and guidance since 1999! Click on an image above, or for personal service, call us toll-free at 1-888-809-8800.

]]>
ribbons1-tiaras banners-spirit
custom-pageribbons1-crowns1"1-3 business days" "Topeka, Indiana" "UPS (Post Office Priority Mail also available)"465711-21 260.4543.65Tower RibbonSashes / Crowns / TiarasCrowns1:22%Find homecoming crowns discounted at TrophyCentral. Perfect for pageants and parades, too! Measures 4" high.c803custom-pageribbons1-crowns1"1-3 business days" "Topeka, Indiana" "UPS (Post Office Priority Mail also available)"465711-21 260.4543.65Tower RibbonSashes / Crowns / TiarasCrowns1:22%Find king crowns discounted at TrophyCentral. Measures 6" high. Perfect for homecoming or pageants!c805custom-pagemascot-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Knight Mascot Badges Discounted At TrophyCentral.mascotbadges-knightcustom-pagemascot-plaques1plaques498552-41JDSPlaques1Find this knight plaque discounted at TrophyCentral. Our knight mascot plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Mascotcustom-pagemascottrophies1"4-6 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511016.25Classic MedallicsTrophiesAcademic1:22%,5:24%,10:28%,50:32%"Mascot Awards"Find Knight Trophies Discounted at TrophyCentral. Each Knight Mascot Trophy Includes Engraving. Fast Shipping!mt202106-20-2022Mascotcustom-pagemascotinserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsMascots1Buy these quality Knights Mascot Medal Inserts at TrophyCentral. Each Knights Insert can be used to create a unique plaque, medal or trophy.489934Mascot
custom-pagemedallion-inserts-fraternal-organizational-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "Clubs, Organizations, Charities"Buy these high-quality Knights Of Columbus 4th Degree Inserts at TrophyCentral. Each Knights Of Columbus 4th Degree Insert can be used to create a unique plaque, medal or trophy.511181
custom-pagemedallion-inserts-fraternal-organizational-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "Clubs, Organizations, Charities"Buy these quality Knights Of Columbus Inserts (Litho) at TrophyCentral. Each Knights Of Columbus Insert can be used to create a unique plaque, medal or trophy.491505
custom-pagegeneral-corporate-awards1"14 business days" "Erlanger, KY" "UPS"general410187-1010.451 2 3 4 5 6 7 8 934.45JcharlesGeneral Awards1:22%,25:24%Koncept IV Recognition Awards from TrophyCentral. Also see our great selection of engraved and personalized gifts!custom-pageletter-shaped-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find these popular L-shaped custom mascot badges at TrophyCentral. Great for fundraising! TrophyCentral is a top-rated Yahoo merchant.letterbadges-lcustom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Lacrosse Awards" "Lacrosse Medals"Buy these quality Lacrosse (Female) Inserts (Litho) at TrophyCentral. Each Lacrosse (Female) Insert can be used to create a unique plaque, medal or trophy.507591Lacrosse, Sports
custom-pagetrophies-lacrosse1trophies498551-310.452429Trophies1Find this popular Lacrosse trophy discounted at TrophyCentral. Features a real marble base, free engraving and fast shipping.lacrosse-cup-place-trophy-tccustom-pagetrophies-lacrosse1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular lacrosse figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!qtlacrosseplLacrosse, 1st / 2nd / 3rd / Etc., Sportscustom-pagetrophies-lacrosse1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%This popular Lacrosse Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!qtlacrosseyrLacrosse, Sportscustom-pagetrophies-lacrosse1trophies498852-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with lacrosse figure discounted at TrophyCentral. Includes free text engraving!cup-lacrosse-pLacrosse, Sportscustom-pagefree-sports-templates1"Download Only"free-sports49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Lacrosse template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Lacrosse-Certificatelacrosse-freeLacrosse, Sportscustom-pagetrophies-lacrosse1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these lacrosse budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtlacrossescbLacrosse, Sportscustom-pagetrophies-lacrosse1498852-30.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Find this budget lacrosse award trophy discounted at Trophy Central. Features a real marble base and plastic male or female lacrosse figure. Engraving is free. Fast 1-2 day shipping.bdg-lacrosseLacrosse, Sportscustom-pagetrophies-lacrosse1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous two-tier Lacrosse Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtlacrossettSee more championshipin other sizes.trophies-lacrosseLacrosse, Sportscustom-pagetrophies-lacrosse1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.215Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%See this championship trophy with a Lacrosse figure at TrophyCentral. Be sure to see all of our Lacrosse figure awards.qtlacrossettwLacrosse, Sportscustom-pagetrophies-lacrosse1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:28%This popular Lacrosse Figure Single Column Trophy features a choice of column size and color, a marble base and free trophy engraving!qtlacrossescReturn to thesection for other great choices.trophies-lacrosseLacrosse, Sportscustom-pagetrophies-lacrosse1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.05Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:15%These quick-ship trophies from TrophyCentral feature a Lacrosse figure, real marble base and marble trophy figure platform, choice of column size and color.qtlacrossedmLacrosse, Sportscustom-pagetrophies-lacrosse1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-30.38150030Quick TrophyDog TagsSports, Hobby, Org, Livestock1:14%,10:15%Find These Lacrosse Dog Tags Discounted At TrophyCentral. Price Includes Engraving And Choice of 6 colors!Shop for Sports Dog Tags at TrophyCentral. Each Sports Tag Can Be Engraved.qtdoglacrLacrosse, Sportscustom-pagetrophies-lacrosse1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Lacrosse figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-lacrosse-scbLacrosse, Sportscustom-pagetrophies-lacrosse1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%"Lacrosse Awards"Find these fabulous two-tier, 3-column champion Lacrosse Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtlacrosse3cLacrosse, Sports11Find a great selection of quality Lacrosse Medals at TrophyCentral. Each Lacrosse Medal includes a free neck ribbon!

Lacrosse Award Medals

If you are looking for a budget-friendly alternative to trophies, our award medals are the perfect solution. Many lacrosse medals come in gold, silver and bronze finishes and offer optional engraving to keep the price as low as possible. Some are also available in color - a favorite amongst younger kids. Be sure to check out our Economy Medals and our unique Insert Medals.

Shop with Confidence at TrophyCentral!

If you are looking to buy lacrosse medals online, look no further! TrophyCentral has a great selection that will fit any budget. Our top-rated representatives are happy to assist you with all of your lacrossse medal and award needs. Our experts in New York and Michigan have been providing suggestions and guidance since 1999! To find the perfect lacrosse medal, click on an image above, or for personal service, call us toll-free at 1-888-809-8800.

]]>
trophies-lacrosse
custom-pagetrophies-lacrosse1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:28%"Lacrosse Awards"Our popular Lacrosse participation trophies feature a real slant-front marble base and free engraving.qtlacrossencSee allin a variety of styles.trophies-lacrosseLacrosse, Sportscustom-pagetrophies-lacrosse1perpetual trophies498852-311.4Trophies1Find this Perpetual Series Lacrosse Trophy Discounted at TrophyCentral. Each Trophy has enough room for 32 names. Ships in just 1-2 days.Lacrosse, Sportscustom-pageaward-medalsqtlacrossencmalatrfelatrqtlacrossescqtlacrossedmqtlacrosseyrqtlacrosseplqtlacrossettqtlacrossettwqtlacrosse3cwbt788wbt789tr7004tr7005mqtlacrossescbcup-lacrosse-scbcup-lacrosse-pqtlacrosseperpbdg-lacrossee9080tm9984g504781507406507591cl25lacrosse-cup-place-trophylacrosse-cup-place-column-trophy1trophies1"Lacrosse Awards" "Sports Trophies"Find lacrosse trophies, medals and awards discounted at TrophyCentral. Each lacrosse trophy includes 3 lines of personalization. Medals feature a free ribbon.Custom Lacrosse Trophies and Awards - Recognize Every Goal and Championship

Lacrosse trophies celebrate the speed, skill, and teamwork that define one of the fastest-growing sports in the country. From youth recreational leagues introducing boys and girls to the game for the first time, to competitive club and high school programs chasing conference titles, quality lacrosse awards recognize players and coaches at every level. Our versatile selection includes traditional column trophies with lacrosse figurines in dynamic attacking and defending poses for both male and female athletes, detailed resin sculptures capturing the intensity of the crease, acrylic triangle awards with a clean modern look, impressive two-tier championship trophies with wood bases, and perpetual trophies passed down to each season's league champion. Every trophy includes free engraving personalized with player names, team, and season.

Frequently Asked Questions About Lacrosse Trophies

What trophy sizes work best for different lacrosse award categories?

Youth and recreational leagues benefit from 6-inch to 9-inch participation trophies that give every player meaningful recognition for completing the season and building the sport's foundation at the grassroots level. Individual award categories such as MVP, most improved, and top scorer warrant 10-inch to 14-inch single column trophies with lacrosse figurines that reflect the achievement above teammates. Team honors for division winners and playoff finishers call for 15-inch to 18-inch premium trophies with substantial presence suitable for a banquet table or trophy case display. Conference championships and league titles deserve 20-inch to 24-inch two-tier or three-column championship trophies whose scale matches the significance of the accomplishment. Perpetual trophies work especially well for competitive club programs that want a single award engraved with each year's champion rather than presenting a new trophy annually.

What details should lacrosse trophy engraving include?

Comprehensive engraving preserves season memories long after the final whistle. Essential elements include player name, award title, team name, league or organization, and season year. For team trophies, adding the finishing position or tournament name gives the award its full context - for example: Tri-County Lacrosse League, Warriors, Division 1 Champions, 2025. For individual honors such as MVP or Golden Stick, pairing the player name with a brief award description makes the trophy meaningful as a standalone keepsake. Keep text concise and readable, prioritizing the most important details when space is limited.

Should youth lacrosse programs give trophies to every player or only award winners?

Youth programs serving players under 12 benefit significantly from universal participation trophies that acknowledge every athlete who completed the season, building confidence and creating positive associations with the sport that encourage continued participation and program growth. Affordable 6-inch to 8-inch participation trophies cost little but mean a great deal to young players displaying their first lacrosse award at home. Even participation-focused programs should present larger, distinctive trophies for team MVP, most improved player, best defensive player, and coaches awards, teaching young athletes that exceptional effort earns special recognition. Middle school and high school programs appropriately shift toward merit-based awards recognizing genuine achievement in championships, all-conference selections, and team superlatives.

Do you offer bulk pricing for lacrosse league and tournament orders?

Yes - pricing drops significantly as order quantities increase, which matters most for lacrosse given the roster sizes and number of teams most leagues recognize at end-of-season banquets and tournament finals. Most league coordinators build a tiered order: a large championship trophy for the winning team, mid-size trophies for runners-up and third place, and individual medals or participation trophies for every player in the field. Orders over $99 qualify for free economy shipping, and our team can provide a custom quote for large multi-team or multi-division orders. We have supplied lacrosse trophies for recreational leagues, club programs, school athletic departments, and tournament organizers for over 25 years and can help you build a complete recognition program from participation through championship.

]]>
trophies
custom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these quality Lamp Of Learning (492951) Inserts (Litho) at TrophyCentral. Each 2 inch insert can be used to create a unique plaque, medal or trophy.492951General, Academic
custom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these quality Lamp Of Learning (497646) Inserts (Litho) at TrophyCentral. Each 2 inch insert can be used to create a unique plaque, medal or trophy.497646General, Academic
custom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these quality Lamp Of Learning (504791) Inserts (Litho) at TrophyCentral. Each Lamp Of Learning (504791) Insert can be used to create a unique plaque, medal or trophy.504791General, Academic
custom-pageeawardmedals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsAcademic1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "School Medals"These inexpensive 1 1/4 inch Academic (Lamp of Learning) Medals offer a high quality, but low price for those on a tight budget.e4791Academic
custom-pageacademic-lamp-general12-3 business days
With engraving:
4-6 business days "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
medals105503-60.5115017Classic Medallicsaward-medalsAcademic1:22%,25:24%,100,27%,500:30%"General Medals"Find these fabulous 2 1/2" Academic medals at TrophyCentral. Includes a free neck or drape ribbon and choice of gold, silver, or bronze finish.me109gAcademic
custom-pageacademic-lamp-general50"4-6 business days" "Mount Vernon, NY" "UPS"105502-50.75130033.75Classic Medallicsaward-medalsAcademic1:22%,100:33%,300:41%Find these fabulous Personalized Lamp Of Learning Front Imprint Medals at TrophyCentral. Price includes the name of your school or organization imprinted on the front of the medal!m146Academic, Custom Medalscustom-pageschool-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"Find these Lamp of Learning pins discounted at TrophyCentral. Each Lamp of Learning Lapel pin features a beautiful gold finish and clutch-back.br211904-17-2015Academiccustom-pageacademic-general-medalsacademic-mcacademic-mc-pracademic-mgtm9897tm9779tm9748tm9841m155m146me109gl324-principalacademic-jigfacademic-jisfacademic-jibftm9746tm9755tm9667scholmedcomsoonecschtm981211Celebrate the pursuit of knowledge with TrophyCentral's lamp of learning medal collection. This iconic academic symbol has represented education and enlightenment for generations, making these medals perfect for honoring students who demonstrate dedication to learning. Every lamp of learning medal includes free custom engraving with student names, achievements, and school information. Volume pricing is available for schools and educational institutions. Complete your academic recognition program with our full selection of school medals including subject-specific awards, graduation medals, and honor roll recognition.custom-pagegold-pins-lapelplasticpinboxvelapinbox151-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:36%,100:39%,500:42%,1000:48%"School Pins" "School Lapel Pins"Find this fabulous Lamp Of Learning Over Books letter pin at TrophyCentralcl113General, Academic
custom-pageschool-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"Find these Lamp of Learning pins discounted at TrophyCentral. Each Lamp of Learning lapel pin features a gold finish and clutch-back your students will love.br358Academiccustom-pageschool-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:30%,100:33%,500:47%"School Pins" "School Lapel Pins"Lamp Of Learning Letter Pins: EC Series Lamp Of Learning Lapel Pins feature a high-quality enameled finish and ship in just 1-2 business days!ec16Academiccustom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these high-quality Lamp Of Learning With Cross Inserts at TrophyCentral. Each Lamp Of Learning With Cross Insert can be used to create a unique plaque, medal or trophy.514052General, Religious, Academic
custom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these quality Lamp Of Learning With Scroll Inserts (Litho) at TrophyCentral. Each Lamp Of Learning With Scroll Insert can be used to create a unique plaque, medal or trophy.501731General, Academic
custom-pageachievement-certificates-awards1"Download Only"free-academic4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Language Arts template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Language-Arts-Certificatelanguage-arts-freeWriting, Academiccustom-pageawardcertificates11certificates290631-31 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,25:24%,100:40%,500:50%Find These Printed Language Arts Certificate certificates at TrophyCentral. Each Language Arts Certificate measures 8 1/2 x 11.932Language Artscustom-pageaward-medalsschool-pinsgold-pins-lapelsports-pinscustomlapelmascotpinsflaglapelpinsfire-department-pinscorporatepinsmusicartpins1star-pinsservicepins1volunteerpinsachievement-pins1index1 .pin-close { font-family: Arial, Helvetica, sans-serif; color: #333; } .pin-close h2 { font-size: 20px; font-weight: bold; color: #1a3666; margin: 0 0 12px; } .pin-close h3 { font-size: 16px; font-weight: bold; color: #1a3666; margin: 0 0 6px; } .pin-close p { font-size: 15px; line-height: 1.75; color: #444; margin: 0 0 14px; } .pin-close a { color: #1a3666; } .pin-close a:hover { text-decoration: underline; } .pin-close ul { margin: 0 0 14px 20px; } .pin-close ul li { font-size: 15px; line-height: 1.75; color: #444; } .pin-faq-item { border-top: 1px solid #e0e0e0; padding: 14px 0; } .pin-faq-item:last-child { border-bottom: 1px solid #e0e0e0; }

Why Choose Trophy Central for Award Pins?

Award pins go wherever the recipient goes — on a jacket, a backpack, a lanyard — making every achievement visible long after the ceremony ends. Unlike certificates that get filed away, a pin is worn with pride and seen by others every day. That ongoing recognition is what makes pins one of the most cost-effective tools available for building a culture of achievement.

Trophy Central has been a trusted leader in recognition products since 1999, serving over 100,000 customers including 370+ Fortune 500 companies and 9,600+ educational institutions. Our stock pins ship in 1–2 business days at prices starting as low as $2.45, with volume discounts available for larger programs. Our U.S.-based team works closely with schools, leagues, and businesses to make sure every recognition moment lands the way it should.

Frequently Asked Questions

What is the difference between stock award pins and custom lapel pins?

Stock award pins are pre-designed and ready to ship in 1–2 business days at a lower per-pin cost. They cover the most popular subjects — honor roll, star pins, sports, years of service, and more. Custom lapel pins are made from your own artwork in any shape, color, or finish and require a short production window, but give you complete design control.

How quickly do lapel pins ship?

Stock pins typically ship within 1–2 business days. If you’re working against a deadline, call us at 1-888-809-8800 and we’ll do everything we can to help.

Is there a minimum order quantity?

Most stock pins have 1 minimum of 5 or 10 — you can order as few as one. Custom pins typically require a minimum order of 50-100 per design, which keeps per-pin pricing competitive while maintaining quality standards. If this is a concern, our blank pins with no minimum quantity may be ideal.

Can I mix different pin styles in the same order?

Yes. You can combine different styles — for example, honor roll pins and perfect attendance pins — in a single order. Many schools and organizations order a variety of pins to recognize different achievements at the same ceremony.

What occasions are award pins used for?

Award pins are used for end-of-season sports banquets, academic honor roll and graduation ceremonies, employee of the month and years of service programs, volunteer appreciation events, student council elections, and fire department recognition, among others.

Do you offer volume pricing?

Yes. Most pin product pages show quantity-break pricing — the more you order, the lower the per-pin cost.

Can pins be personalized with a name or year?

Stock award pins are pre-designed and not individually engraved. They can be paired with blank engraveable lapel pins if you need personalized text, or you can opt for a fully custom lapel pin built from your own artwork and wording.

]]>
custom-pageplaques11105503-610.451 2 3 4 5 6 7 8 911241.251:22%"Plaques" "Trophies and Plaques"custom-pagecup-trophies-large-and-small1trophies105503-610.61417.4SpartaCraft1:22%"Military Awards"See allCupcustom-pagerosetteribbons1verprin1proof215"5-7 business days, 14 business days with custom logo" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"465715-71 263.00Tower RibbonRibbons1:22%,50:25%,100:28%,200:30%Our Large Three Streamer Rosette Ribbon Features Offer a Choice of Size, Color, Rosette Button and Logo. Add Your Own Custom Printing! Quantity Discounts Available.custom-pagegold-pins-lapelplasticpinboxvelapinbox151-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsGeneral1:30%,50:36%,100:39%,500:42%,1000:48%Find this fabulous Large Gold Service Bar letter pin at TrophyCentralcl5206-01-2011Service / Retirement Bar
custom-pagegold-pins-lapelplasticpinboxvelapinbox151-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsGeneral1:30%,50:36%,100:39%,500:42%,1000:48%Find this fabulous Large Textured Service Bar letter pin at TrophyCentralcl106Service / Retirement Bar
custom-pageflexiplates211tagsbadgesflplw desblocnampl"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)""PT6=498552-320.35100021TrophyCentral1:14%,100:33%flplwcustom-pagechampion-perpetual-trophies1perpetual trophies105503-610.6111Classic MedallicsTrophies11:22%"Perpetual Trophies" "Perpetual Trophy"Shop for Perpetual Trophies and Awards at TrophyCentral, Includes 12 Nameplates.Return to oursection for other great choices.champion-perpetual-trophies06-30-2012Cupcustom-pageperplaq1"4-6 business days "Marquette, MI" "UPS"perpetual plaques498552-410.45322.95JDS-SPlaquesPerpetual Plaques1:22%"Minuteman" "New Products"Find This Beautiful 60 Plate Step Edge Walnut Perpetual Name Plaque Discounted At TrophyCentral. Fast Shipping. Top-Rated Customer Service.wpp6008-10-2011custom-pagepersonalizedleather-leathergifts1"4 to 7 business days w/initials or name, 10 to 14 w/logo , 3 to 5 for stock items, (rush service available – please call)" "Teaneck, NJ" "UPS (FedEx available on request)"498554-710.453622.05JDS IndustriesGiftsLeather Gifts1Find this leatherette bifold wallet discounted at TrophyCentral. Each wallet is personalized with your message!Leather Wallets, Groomsmencustom-pagepersonalizedleather-leathergifts1"4 to 7 business days w/initials or name, 10 to 14 w/logo , 3 to 5 for stock items, (rush service available – please call)" "Teaneck, NJ" "UPS (FedEx available on request)"personalized gifts498554-710.451611.65JDS IndustriesGiftsLeather Gifts1"Father's Day Gifts" "Graduation Gifts" "Service Gifts" "Unique Gifts For Men" "Leather Portfolio Cases" "Portfolio Cases" "Leather Portfolio Case"Find These Custom Leatherette Luggage Tags Discounted at TrophyCentral. Each Tag is Personalized with Your Message or Logo!custom-pagepersonalized-gifts11"4 to 7 business days w/initials or name, 10 to 14 w/logo , 3 to 5 for stock items, (rush service available – please call)" "Teaneck, NJ" "UPS (FedEx available on request)"personalized gifts498554-710.451611.65JDS IndustriesGiftsLeather Gifts1"Corporate Gifts" "Custom Gifts" "Corporate Holiday Gifts" "Business Christmas Gifts" "Select Holiday Gifts"Find this personalized leatherette portfolio discounted at TrophyCentral. Features choice of color and your custom message!custom-page1"3-5 business days" "Marquette, MI" "UPS"personalized gifts498553-510.45167.81JDS-SGiftsBridesmaids / Groomsmen1:22%The perfect gift for that Happy Couple or your Wedding Party. Matte finish metal frames with FREE laser engraving. Choice of 3 sizes and 3 finishes.Bridesmaids / Groomsmencustom-pagecrystalcups1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"general410187-1010.45428.45JcharlesCrystal Awards1:22%,25:24%"crystal awards" "Tennis Awards"Laurel Cup from TrophyCentral. Discounted Trophies, Awards and Promotional Products.Leadership, Golf, Tennis, Sportscustom-pageribbons1-tiaras1"1-3 business days" "Topeka, Indiana" "UPS (FedEx available on request)"465711-21 260.8244.4Tower RibbonSashes / Crowns / TiarasTiaras1:22%Find these 3 1/4" lavish Queen Tiaras discounted at TrophyCentral! Ships in just 1-2 business days and many times the same day!1-20-2022custom-pageaward-medalsmqt-leadership-p-ncmqt-leadership-p-scmqt-leadership-p-dmmqt-leadership-p-plmirage5x7acrylicbentglasszephyrcompass505celestialambientft4860x-bmft4900stdiinblstepstosuccessperceptions191aftr020vftm070endeavorchaliceawardglobacaw614ft7305konceptivexcelsioreclipsefs-166xfs-171x030xcastawardvftm012cpta039xbalancesoloft7301brboawpainsuarabesquebstcoawcirclescapeteamwork-award-plaquespirit-awardexpeditionrecord-breakerscimitarbdg-leader1trophies1

Corporate Awards and Trophies - Recognize Excellence in Every Role

Corporate awards and trophies do more than mark a single achievement, they signal to an entire organization that performance is seen, valued, and worth celebrating. A well-chosen corporate award presented at the right moment reinforces the behaviors and results that drive business success, from sales performance and customer service excellence to leadership development, innovation, and years of dedicated service. TrophyCentral's corporate award collection spans the full range of recognition needs, from affordable achievement trophies appropriate for team-level recognition programs to premium crystal and glass awards worthy of executive presentations and annual gala ceremonies. Every corporate trophy includes free engraving personalized with the recipient's name, award title, department, company name, and year, ensuring each award documents the specific achievement rather than serving as a generic piece of hardware. Volume pricing makes it practical to build a complete recognition program covering multiple award categories and employee levels without requiring a large per-unit budget.

Frequently Asked Questions About Corporate Awards and Trophies

What types of corporate awards work best for different recognition categories?

Sales achievement awards and revenue milestone recognition benefit from substantial trophies with visual presence that reflects the significance of hitting a quota or exceeding a target, making column trophies and cup trophies in the 12-inch to 18-inch range the standard choice. Employee of the month and team recognition programs work well with mid-size achievement trophies that are meaningful without being so large they become impractical to display on a desk. Leadership and executive awards call for premium materials including crystal, glass, and high-polish resin that convey the weight of the accomplishment and hold up in a professional office or boardroom display environment. Years of service milestones benefit from a layered approach where the award size and material quality increases with each increment, so a 5-year recipient receives a meaningful but modest award while a 25-year recipient receives something that clearly communicates the exceptional nature of that level of loyalty. Innovation awards, customer service excellence honors, and peer recognition programs each carry their own visual language, with the award style communicating as much as the engraving about what is being celebrated.

What engraving details should corporate awards include?

Corporate award engraving should document the achievement specifically enough that the award is meaningful years later when the recipient looks at it on a shelf or office wall. Essential elements include recipient name, award title, company or organization name, and year. For performance awards, adding the specific achievement metric makes a significant difference: Sales Leader, $2.4M Revenue, Q4 2025 tells a far more compelling story than Sales Award 2025. Employee of the month awards benefit from the month and year. Leadership awards gain gravitas from titles that reflect scope, such as Regional Vice President, Eastern Division or Director of Operations, three-year term. Years of service awards should always include the milestone number prominently, such as 20 Years of Dedicated Service, since the number itself is the heart of the recognition. Innovation and special achievement awards can include a brief descriptor of the accomplishment when the engraving plate is large enough to accommodate additional lines, capturing a specific project name or initiative that defined the recipient's contribution during that period.

Should corporate awards be trophies, plaques, or crystal awards?

The right format depends on the award's intended display location, the organizational culture, and the level of formality the recognition calls for. Trophies are freestanding awards that sit on desks, shelves, and credenzas, making them well suited for individual recipient awards that will be displayed in a personal workspace. They communicate achievement in a way that is immediately recognizable to anyone who enters the room, and they scale easily from modest participation-level designs to impressive multi-column championship pieces. Plaques mount on walls and are the preferred format when the award will be displayed in a shared space such as a hallway, reception area, or conference room, or when the recipient prefers a wall-mounted recognition piece over a shelf item. Plaques also lend themselves well to perpetual recognition formats where individual name plates are added year over year. Crystal and glass awards occupy a premium tier appropriate for executive recognition, annual gala presentations, and distinguished achievement honors where the material itself communicates the caliber of the accomplishment. Many corporate recognition programs use all three formats at different levels, reserving crystal for the highest individual honors, plaques for team and departmental recognition, and trophies for individual performance categories throughout the year. See our full range of award plaques and crystal awards for additional corporate recognition options.

If you need more information before deciding, see our expert resource section:
]]>
custom-pagecorporatepinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsBusiness1:30%,50:32%,100:35%,500:39%Find these Leadership - A Rare Quality Pins discounted at TrophyCentral. Each lapel pin features a high-quality finish and clutch back.br52306-25-2014Business, Leadershipcustom-pagetrophies-baseball11coachawards corporateawards engravedgifts 49-8111"4-7 business days w/engraving, 1-2 without" "Marquette, MI" "UPS (FedEx available on request)"498554-710.451213.65TCGiftsEngraved Gifts1:14%,2:23%Find this gold whistle discounted at TrophyCentral. Gold gifts whistles make a great coaches gift! Optional engraving.05-15-2013Coach, Leadership, Sportscustom-pageeawardmedals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsGeneral1:22%,100:28%,500:34%,1000:45%These inexpensive 1 1/4 inch Leadership Medals offer a high quality, but low price for those on a tight budget.e920805-05-2013General, Business, Academic, Leadership
custom-pagegeneral-corporate-awards1498552-311622.85TrophiesCorporate1Find this popular leadership figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at trophyCentral. Ships in a fast 1-2 days!mqt-leadership-p-plCoach, Leadership, Sportscustom-pagecorporatepinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsBusiness1:30%,50:32%,100:35%,500:39%"Leadership Recognition" "Employee Lapel Pins" "Corporate Lapel Pins"Find this Leadership Award Pin at TrophyCentral. Leadership Award and other pins ship in just 1-2 business days!br37906-22-2021Business, General, Leadershipcustom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsGeneral1:22%Buy these quality Mylar Leadership Award Decal Inserts at TrophyCentral. Each Leadership Award Decal can be used to create a unique plaque, medal or trophy.489767Leadership
custom-pagegeneral-corporate-awards1trophies498551-310.453633.4trophies1Find this budget leadership award trophy discounted at TrophyCentral. Features a real marble base and plastic whistle figure. Engraving is free. Fast 1-2 day shipping.Leadershipcustom-pagegeneral-corporate-awards1498552-311623.65TrophiesCorporate1These quick-ship trophies from TrophyCentral feature a gold whistle figure, real marble base and marble platform, choice of column size and color. Fast 1-2 day shipping.mqt-leadership-p-dmCoach, Leadership, Sportscustom-pageglass-crystal-awardsvolapinspawlapinbr278br398br311br309br379br310br345br368br369br370br312ceteabbelapincotoexseisourpabr525br524br523br520br535br519br529br342br356br343br555br563servicepins1flaglapelpinsfire-department-pinsvolunteerpins1lapel-award-pins1"Corporate Award" "Business Award" "Lapel Pins" "Employee Awards" "Employee Award Page" "Sales Awards" "Sales Award Page" "Corporate Awards" "Corporate Award Page" "Employee Recognition Awards" "Corporate Recognition Awards" "Employee Service Awards" "Recognition Awards" "Recognition Award Page"Business pins and corporate pins are a great way to look professional and to share your brand in an engaging way at events and conventions.eagle-plaques-awards servicepins1custom-pagegeneral-corporate-awards1leadership498552-313633.4TrophiesCorporate1Our leadership whistle trophies feature a real slant-front white marble base and free personalization. Significant quantity discounts available. Fast 1-2 shipping.mqt-leadership-p-ncCoach, Leadership, Sportscustom-pageunused-products1"4-7 w/initials or name, 10-14 w/logo , 3-5 business days for stock items, (rush service available for additional charge - please call)" "Secaucus, NJ" "UPS (FedEx available on request)""PT3=70944-710.451610.85Royce LeatherGiftsLeather Gifts1"Jewelry Displays" "Jewelry Boxes" "Jewelry Display Cases" "Jewelry Cases" "Jewelry Display Boxes" "Jewelry Case" "Valentines Gifts" "Valentine's Gifts" "Valentine's Day Gifts" "Valentines Gift" "Valentine's Gift"Find Ladies Leather Pocketbook Jewelry Cases at TrophyCentral.Leather Giftscustom-pageunused-products1"4-7 w/initials or name, 10-14 w/logo , 3-5 business days for stock items, (rush service available for additional charge - please call)" "Secaucus, NJ" "UPS (FedEx available on request)""PT3=70944-710.45819.65Royce LeatherGiftsLeather Gifts1"Leather Gifts" "Executive Gifts"Leather Ladies Travel Kit With Shaver from TrophyCentral.Leather Giftsunused-products1"4 to 7 business days w/personalization, 3 to 5 for stock items, (rush service available – please call)" "Teaneck, NJ" "UPS (FedEx available on request)""PT3=70944-710.45369.81Royce LeatherGiftsLeather Gifts1"PT=Find These Blue Leather Passport Jackets Discounted At TrophyCentral. Add Your Initials Or Monogram For A Special Touch! Fast Shipping!200-11bePassport Holdersunused-products1"4 to 7 business days w/personalization, 3 to 5 for stock items, (rush service available – please call)" "Teaneck, NJ" "UPS (FedEx available on request)""PT3=70944-710.45369.81Royce LeatherGiftsLeather Gifts1"PT=Top Quality Leather Plain Passport Jacket - Red. TrophyCentral is a Top-Rated Yahoo Merchant.200-11Passport Holderscustom-pageunused-products1"4-7 w/initials or name, 10-14 w/logo , 3-5 business days for stock items, (rush service available for additional charge - please call)" "Secaucus, NJ" "UPS (FedEx available on request)""PC30=Gifts" "PT3=70944-710.45189.45Royce LeatherGiftsLeather Gifts1Leather Traditional Note Jotter from TrophyCentral.custom-pageunused-products1"4-7 w/initials or name, 10-14 w/logo , 3-5 business days for stock items, (rush service available for additional charge - please call)" "Secaucus, NJ" "UPS (FedEx available on request)""PT3=70944-710.45168.45Royce LeatherGiftsLeather Gifts1"Leather Gifts"Leather Travel Valet Tray from TrophyCentral. See our great selection of engraved and personalized gifts!Leather Giftscustom-page11custom-pagepersonalizedleather-leathergifts1"4 to 7 business days w/initials or name, 10 to 14 w/logo , 3 to 5 for stock items, (rush service available – please call)" "Teaneck, NJ" "UPS (FedEx available on request)"498554-710.451611.65JDS IndustriesGiftsLeather Gifts1"Executive Gifts"Find this personalized gift clock discounted at TrophyCentral. Features choice of color and free custom engraving for a special touch!custom-pagequickshiptrophies-graduate11certificate-diploma-coversdiploma covers498553-611The leatherette diploma covers are perfect when you only need a small quantity. Includes text imprint. Optional logo available.custom-pagepersonalized-gifts1"4-7 w/initials or name, 10-14 w/logo , 3-5 business days for stock items, (rush service available for additional charge - please call)" "Secaucus, NJ" "UPS (FedEx available on request)"personalized gifts498554-710.45510.45JDS IndustriesGiftsLeather Gifts1Find this Flask Gift Set discounted at TrophyCentral. Features 1 flask, 2 shot glasses and 1 funnel.Groomsmencustom-pagepersonalizedleather-leathergifts1"4-7 w/initials or name, 10-14 w/logo , 3-5 business days for stock items, (rush service available for additional charge - please call)" "Secaucus, NJ" "UPS (FedEx available on request)"498554-710.453610.53JDS IndustriesGiftsLeather Gifts1"Leather Gifts" "Executive Gifts"Find this flexible leatherette business card holder discounted at TrophyCentral. Features choice of color and free custom engraving!custom-pagepersonalizedleather-leathergifts1"4-7 w/initials or name, 10-14 w/logo , 3-5 business days for stock items, (rush service available for additional charge - please call)" "Secaucus, NJ" "UPS (FedEx available on request)"498554-710.453610.53JDS IndustriesGiftsLeather Gifts1Find this Personalized Business Card Case discounted at TrophyCentral. Features choice of color and free custom engraving for a special touch!custom-pagepersonalizedleather-leathergifts1"4-7 w/initials or name, 10-14 w/logo , 3-5 business days for stock items, (rush service available for additional charge - please call)" "Secaucus, NJ" "UPS (FedEx available on request)"498554-710.453623.85JDS IndustriesGiftsLeather Gifts1"Leather Gifts"Find this personalized money clip discounted at TrophyCentral. Features choice of color and free personalization!Leather Walletscustom-pagepersonalizedleather-leathergifts1"4-7 w/initials or name, 10-14 w/logo , 3-5 business days for stock items, (rush service available for additional charge - please call)" "Secaucus, NJ" "UPS (FedEx available on request)"personalized gifts498554-710.451611.65JDS IndustriesGiftsLeather Gifts1"Leather Gifts" "Executive Gifts"Find these zippered portfolios discounted at TrophyCentral. Each portfolio features choice of color and can be laser engraved for a personal touch!custom-pagepersonalizedleather-leathergifts1"4-7 w/initials or name, 10-14 w/logo , 3-5 business days for stock items, (rush service available for additional charge - please call)" "Secaucus, NJ" "UPS (FedEx available on request)"498554-710.451611.65JDS IndustriesGiftsLeather Gifts1"Leather Gifts" "Executive Gifts" "Leather Portfolio Cases" "Portfolio Cases" "Leather Portfolio Case"Leatherette Round Coaster Set with Metallic Edgingcustom-pagepersonalizedleather-leathergifts1"4-7 w/initials or name, 10-14 w/logo , 3-5 business days for stock items, (rush service available for additional charge - please call)" "Secaucus, NJ" "UPS (FedEx available on request)"498554-710.451611.65JDS IndustriesGiftsLeather Gifts1"Leather Gifts" "Leather Portfolio Cases" "Portfolio Cases" "Leather Portfolio Case"Leatherette Square Coaster Set with Metallic Edge .custom-pagewall-mounted-legacy145123128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell legacy bulletin board wall case w/ cork back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 36"H x 48"W x 4"D.1Wall-Mountedcustom-pagewall-mounted-legacy145123128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell legacy bulletin board wall case w/ cork back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 36"H x 60"W x 4"D.1Wall-Mountedcustom-pagewall-mounted-legacy145123128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell legacy bulletin board wall case w/ cork back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 36"H x 72"W x 4"D.1Wall-Mountedcustom-pagewall-mounted-legacy145123128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell legacy bulletin board wall case w/ cork back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 48"H x 48"W x 4"D.1Wall-Mountedcustom-pagewall-mounted-legacy145123128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell legacy bulletin board wall case w/ cork back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 48"H x 60"W x 4"D.1Wall-Mountedcustom-pagewall-mounted-legacy145123128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell legacy bulletin board wall case w/ cork back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 48"H x 72"W x 4"D.1Wall-Mountedcustom-pagewall-mounted-legacy145123128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell legacy bulletin board wall case w/ lighted header discounted at TrophyCentral. This high quality display is made in the US. Measures: 42"H x 50"W x 4"D . Model: 885-hb-ck.1Wall-Mountedcustom-pagewall-mounted-legacy145123128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell legacy bulletin board wall case w/ lighted header discounted at TrophyCentral. This high quality display is made in the US. Measures: 42"H x 50"W x 4"D . Model: 885-hb-pb.1Wall-Mountedcustom-pagewall-mounted-legacy145123128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell legacy bulletin board wall case w/ plaque fabric back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 36"H x 48"W x 4"D.1Wall-Mountedcustom-pagewall-mounted-legacy145123128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell legacy bulletin board wall case w/ plaque fabric back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 36"H x 60"W x 4"D.1Wall-Mountedcustom-pagewall-mounted-legacy145123128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell legacy bulletin board wall case w/ plaque fabric back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 36"H x 72"W x 4"D.1Wall-Mountedcustom-pagewall-mounted-legacy145123128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell legacy bulletin board wall case w/ plaque fabric back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 48"H x 48"W x 4"D.1Wall-Mountedcustom-pagewall-mounted-legacy145123128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell legacy bulletin board wall case w/ plaque fabric back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 48"H x 60"W x 4"D.1Wall-Mountedcustom-pagewall-mounted-legacy145123128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell legacy bulletin board wall case w/ plaque fabric back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 48"H x 72"W x 4"D.1Wall-Mountedcustom-pagewalmouncas885-hb-ck88-3648ck-gd88-3660ck-gd88-3672ck-gd88-4848ck-gd88-4860ck-gd88-4872ck-gd885-hb-pb88-3648pb-gd88-3660pb-gd88-3672pb-gd88-4848pb-gd88-4860pb-gd88-4872pb-gd11floor-standing-keepsake wall-mounted-championcustom-pageenclosed-bulletin-boards1Bulletin Boards4512310-171 3 5 6 7 8 9 10 22 2311Bulletin Boards11Find the Ghent Letter Board Letters and Numbers, Gothic Font, 3/4", White discounted at TrophyCentral.custom-pagesoftball-pins1"1-2 business days" "Topeka, IN"lapel pins465711-21 260.48036.4Tower Ribbonlapel-award-pinsAcademic1:22%,40:58%Find a great selection of letter pins at TrophyCentral. Each letter pin features a gold finish and clutch back to be worn on a jacket.custom-pageribbons1letterbadges-aletterbadges-bletterbadges-cletterbadges-dletterbadges-eletterbadges-fletterbadges-gletterbadges-hletterbadges-iletterbadges-jletterbadges-kletterbadges-lletterbadges-mletterbadges-nletterbadges-oletterbadges-pletterbadges-rletterbadges-sletterbadges-tletterbadges-uletterbadges-vletterbadges-wletterbadges-xletterbadges-yletterbadges-z11trophies-mascot mascot-medals mascot-badgescustom-pageenclosed-bulletin-boards1Bulletin Boards4512310-171 3 5 6 7 8 9 10 22 2311Bulletin Boards11Find the Ghent Letter Board Letter Storage Box discounted at TrophyCentral.custom-pageeagle-trophies1"10 business days" "Aliquippa, PA" "UPS"trophies1500110-1410.45824.45Glass AmericaCrystal Awards1:22%,10:25%Liberty Eagle from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.custom-pageenclosed-bulletin-boardscpa13624kcpa23648kcpa23660kcpa33672kcpa34896k111custom-pagebadgeribbonsholders1"7-10 business days from receipt of camera-ready artwork" "City of Industry, CA" "UPS (FedEx available on request)"917457-10146022BNRibbonsBadge Holders1nw-3613lmgrcustom-pagemascotpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:36%,100:46%,500:52%"Mascot Awards"Find These Lion Lapel Pins with Antique Finish Discounted at TrophyCentral! Also See Our Other Fabulous School Mascot Pins. Fast 1-2 Day Shipping!pm1905-15-2013Mascotcustom-pagemascot-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Lion Mascot Discounted At TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.mascotbadges-lioncustom-pagemascot-plaques1plaques498552-41JDSPlaques1Find this lion plaque discounted at TrophyCentral. Our lion mascot plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Mascotcustom-pagemascottrophies1"4-6 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511016.25Classic MedallicsTrophiesAcademic1:22%,5:24%,10:28%,50:32%"Mascot Awards"Find Lion Trophies Discounted at TrophyCentral. Each Lion Mascot Trophy Includes Engraving. Fast Shipping!mt20014-15-18Mascotcustom-pagemascotinserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsMascots1Buy these quality Lions Mascot Medal Inserts at TrophyCentral. Each Lions Insert can be used to create a unique plaque, medal or trophy.489925Mascot
custom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these quality Literature Inserts (Litho) at TrophyCentral. Each Literature Insert can be used to create a unique plaque, medal or trophy.504421Reading
custom-pagetrophies-baseball12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-31130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Baseball (Male) Litho Medal Insert. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.507192Baseball / T-Ball, Sports
custom-pagetrophies-baseball12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-31130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Baseball Batter (502811) Litho Medal Insert. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.502811Baseball / T-Ball, Sports
custom-pagetrophies-baseball12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-31130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Baseball Batter (507584) Litho Medal Insert. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.507523Baseball / T-Ball, Sports
custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these high-quality Little League Inserts at TrophyCentral. Each Little League Insert can be used to create a unique plaque, medal or trophy.50153Baseball / T-Ball, Sports
custom-pageaward-medalsquickshiptrophies-bullquickshiptrophies-chickenquickshiptrophies-cowquickshiptrophies-goatquickshiptrophies-pigquickshiptrophies-rabbitquickshiptrophies-sheepquickshiptrophies-steer1trophies1Find livestock trophies and animal trophies discounted at TrophyCentral. Each farm animal and livestock trophy includes free engraving. Custom Farm & Livestock Trophies TrophyCentral has a great selection of livestock awards and animal trophies to meet all of your needs. Also be sure to see our Farm Tractor Trophies featuring a choice of column color and size, and our Sheep Trophies - perfect for your next county fair or event. We have a large number of farm animal and livestock figures, including cows, steers, chickens and many more. Each livestock award includes up to three lines of FREE ENGRAVING (larger awards include additional lines).]]>quickshiptrophies-tractor county-fair-awardscustom-pagedo-not-erase112906314-2111 2 3 4 5 6 7 8 9Certificate SourceDiploma Covers1:0%Personalized with Gold Stamp: Logo Proof from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.1custom-pageribbons11muimse1100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Texas" "UPS (FedEx available on request)"7745310-1410.45214.85PepcoPromotional ProductsSpirit1Buy these Custom Logo Megaphones and other Cheerleader Spirit Awards at TrophyCentral.Spiritcustom-pagedo-not-erase112906314-2111 2 3 4 5 6 7 8 9Certificate Source1:0%1custom-pageflower-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"Find red rose pins discounted at TrophyCentral. Each red rose lapel pin features a clutch-pin back. Fast 1-2 day shipping on all flower pins.br277Generalcustom-pageflower-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"br388Generalcustom-pagemascotinserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsMascots1Buy these quality Longhorns Mascot Medal Inserts at TrophyCentral. Each Longhorns Insert can be used to create a unique plaque, medal or trophy.489941Mascot
custom-pagetrophies-basketball1trophies-funny-horses-rearplaques498552-41JDSPlaques1Find this loser plaque discounted at TrophyCentral. Our loser plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Losercustom-pagecrystalcups1"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"4582215138.6Vision AwardsTrophies11:22%,26:32%"New Products"Lunar Tides Vase from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.custom-pageletter-shaped-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find these popular M-shaped custom mascot badges at TrophyCentral. Great for fundraising! TrophyCentral is a top-rated Yahoo merchant.letterbadges-mcustom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality M.P. Regimental Crest Inserts at TrophyCentral. Each M.P. Regimental Crest Insert can be used to create a unique plaque, medal or trophy.517293Military, Hero
custom-pagecrystalcups1"12-15 business days w/engraving" "Celina,OH" "UPS (FedEx available on request)"458227-1010.45624.45VisionsTrophies1 "General Recognition Awards"Find This Spectacular Magma Bowl Award Discounted At TrophyCentral! Price Includes Etched Logo!custom-pageperplaq1"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"perpetual plaques458221510.45214.15Vision AwardsPlaquesPerpetual Plaques1:22%, 26:33%Find the Perpetual Fascination Plaque discounted at TrophyCentral. Never settle for boring again! Etched metal plates can be added as needed (magnetically attached).See other greatin a variety of styles.perplaqcustom-pageofficesigns11"2-3 business days" "Roanoke, Virginia" "UPS (FedEx available on request)"240162-310.45617.25RoanokeOffice Signs1Magnetic Signs from TrophyCentral. Also see our great selection of engraved and personalized gifts!custom-pagegifts-desk-general11"7-10 business days w/engraving" "Chicago, Illinois" "UPS (FedEx available on request)"personalized gifts606307-101 3 230.453632.85RS OwensGiftsDesk Sets1:22%,5:24%"Corporate Gifts" "Custom Gifts" "Unique Holiday Gifts" "Unique Personalized Gifts" "Unique Custom Gifts"Mahogany Finished Note / Pen Set from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.12-20-2020Engraved Giftscustom-page11Help TrophyCentral understand your email preferences. Use this form to let use know what email segment you prefer.1custom-pagetop-awards-by-category11Explore major sports championships around the world, including trophies, awards, and top athletes with the most championships.custom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock Bottles1:22%,100:28%,500:34%,1000:45%"Track Medals"These inexpensive 1 1/4 inch Dash (Male) Medals offer a high quality, but low price for those on a tight budget.e904207-12-2015
custom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock Bottles1:22%,100:28%,500:34%,1000:45%"Track Medals"These inexpensive 1 1/4 inch High Jump (Male) Medals offer a high quality, but low price for those on a tight budget.e9240
custom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock Bottles1:22%,100:28%,500:34%,1000:45%"Track Medals"These inexpensive 1 1/4 inch Hurdles (Male) Medals offer a high quality, but low price for those on a tight budget.e9076
custom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock Bottles1:22%,100:28%,500:34%,1000:45%"Track Medals"These inexpensive 1 1/4 inch Male Discus Medals offer a high quality, but low price for those on a tight budget.e265112-20-2020
custom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock Bottles1:22%,100:28%,500:34%,1000:45%"Track Medals"These inexpensive 1 1/4 inch Distance (Male) Medals offer a high quality, but low price for those on a tight budget.e910511-15-2011
custom-pagetrophies-gymnastics12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Gymnastics Awards" "Gymnastics Medals"Your athletes will love these colorful Mylar Men's Gymnastics Medals from TrophyCentral. Each Men's Gymnastics medal includes a neck ribbon!tm9981gGymnastics, Sports
custom-pagesports-inserts1105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Volleyball Male Inserts (Litho) at TrophyCentral. Each Volleyball Male Insert can be used to create a unique plaque, medal or trophy.503211Volleyball, Sportscustom-pagesports-inserts1105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Male Soccer Litho Medal Insert - Style 1. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.502031Soccer, Sportscustom-pagesports-inserts1105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Male Soccer Litho Medal Insert - Style 2. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.507174Soccer, Sports1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)""PT1=Trophies" "PC12=105503-610.451 2 3 4 5 6 7 8 911224.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,6:24%,12:26%,24:29%,48:31%"Soccer Awards"Male Soccer Resin Trophy - Style 2. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.tr6098Soccer, Sportscustom-pagemedals-j-series12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
"PT1=Medals" "PC12=105503-60.515014Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,50:28%,100:34%,500:41%"Swimming Awards" "Award Medals - All Subjects" "Sports Medals" "Swimming Medals" "Swimming Ribbons"Find our Male Swimmers 2" Olympic-Style J-Series Medals at a super price point at TrophyCentral. Large quantity discounts available!j903612-20-2040
custom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these high-quality Male Track Inserts (505751) at TrophyCentral. Each Male Track Inserts (505751) can be used to create a unique plaque, medal or trophy.505751
custom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these high-quality Male Track Inserts (506201) at TrophyCentral. Each Male Track Inserts (506201) can be used to create a unique plaque, medal or trophy.506201
custom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,10:27%,100:36%"Track Medals" "Track Awards"These 1 1/2 Inch Track Runners w/Scroll, Male medals come in gold, silver and bronze finishes and are perfect for recognizing different place winners.ir37
custom-pagemedals-diamond-cut-edge12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,25:29%,100:38%"Wrestling Awards" "Wresling Medals"See Our Wrestling Medals With A Diamond-Cut Edge. Also See Our Other High-Quality Wrestling Awards At TrophyCentral!z9049Wrestling, Sports
custom-pagequickshiptrophies-fireman1"4-6 business days " "Mount Vernon, NY" "UPS"plaques105503-610.4511656.45Classic MedallicsPlaquesBlank Plaques1:22%"Hero Awards" "Fire Awards" "Fire Trophies" "Fire Department Awards" "Fire Department Trophies"Find the Maltese Cross Fireman Plaque at TrophyCentral. Fireman Plaque Measures 12" X 12".03-15-2011Firefighter11Teachers are responsible for creating a conducive learning environment for students. Effective classroom management is integral to achieving that goal.classroom-managementcustom-pageacademic-resource-hub11Effective classroom management is integral to achieving positive student behaviors. Teachers who learn classroom management strategies see positive results.custom-pagepersonalizedleather-leathergifts1"4 to 7 business days w/initials or name, 10 to 14 w/logo , 3 to 5 for stock items, (rush service available – please call)" "Teaneck, NJ" "UPS (FedEx available on request)"498554-710.45819.65JDS IndustriesGiftsLeather Gifts1"Executive Gifts" "Graduation Gifts" "Business Promotional Gifts" "Corporate Promotional Gifts" "Executive Business Gifts" "Business Holiday Gifts" "Leather Portfolio Cases" "Portfolio Cases" "Leather Portfolio Case" "New Products" "Graduation Gift"Find this custom manicure set discounted at TrophyCentral. Each manicure set is personalized with your message. No minimum quantities!custom-pagegifts-desk-general1"1-2 business days" "Marquette, MI" "UPS"personalized gifts498852-310.4510016.45Quick TrophyGiftsCustom Pens1:14%"New Products"Find these fabulous Maple Pen Cases discounted at TrophyCentral. TrophyCentral is known for its top-rated customer serviceCustom Penscustom-pagerunning-trophies1medals498552-40.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful Marathon 2" Epoxy-covered insert decal discounted at TrophyCentral. Fast 1-2 day shipping.custom-pagefree-sports-templates1"Download Only"free-academic4985501Trophy CentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Marathon template is free and designed exclusively for Trophy Central. Marathon certificate templates measure 11" x 8 1/2" and can be easily downloaded and printed.marathon-certificatemarathon-m-frMarathoncustom-pagerunning-trophies1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Marathon Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.custom-pagetrophies-track-field1trophies498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Marathon insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-Marathon-Insertcustom-pagerunning-trophies1498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Marathon single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - Marathoncustom-pagetrophies-track-field1trophies498551-310.71217.38trophies1custom-pagerunning-trophies1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Marathon Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.custom-pagerunning-trophies1medals498552-30.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this colorful Marathon insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.custom-pagerunning-trophies1medals498552-30.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Marathon insert medal with a personalized front rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.custom-pagecherry-insert-plaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these marathon insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.custom-pagerunning-trophies12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Marathon Inserts (Litho) at TrophyCentral. Each Marathon Insert can be used to create a unique plaque, medal or trophy.507037
1sports-medals1Shop premium marathon medals in various sizes and styles. Choose from insert medals, framed designs, and custom options. Perfect for race organizers and marathon events.Recognize marathon runners' dedication and perseverance with our specialized collection of marathon medals. Whether you're organizing a local 5K, half marathon, or full 26.2-mile race, our medals provide the perfect way to honor participants' accomplishments. Our marathon medal selection includes versatile insert medals, elegant framed designs in gold, silver, and bronze finishes, and personalized options with custom rim engraving. Available in multiple sizes and featuring detailed marathon-themed designs, these medals are suitable for both male and unisex categories. TrophyCentral makes it easy to reward every runner who crosses your finish line with a lasting memento of their achievement. Browse our complete selection of marathon medals and find the perfect recognition for your next race event.custom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock Bottles1:22%,100:28%,500:34%,1000:45%"Track Medals"These inexpensive 1 1/4 inch Marathon (Male) Medals offer a high quality, but low price for those on a tight budget.e908311-20-2012
custom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock Bottles1:22%,100:28%,500:34%,1000:45%"Track Medals"These inexpensive 1 1/4 inch Marathon, Unisex Medals offer a high quality, but low price for those on a tight budget.e703708-05-2011
custom-pagerunning-trophies11Real marathon bonking stories with lessons learned. Discover what causes the wall, common pacing mistakes, and smart racing strategies to avoid implosions at mile 20.custom-pagerunning-trophies1498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our marathon insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - Marathoncustom-pagerunning-trophies1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Marathon Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.custom-pagetrophies-military-hero1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511230.45Classic MedallicsTrophiesHero1:22%,6:23%,12:24%,24:26%"Hero Awards"Shop for Cast Stone Marine Corps Emblem Awards at TrophyCentral. We have a great selection of Marine Corps Emblem and other recognition trophies at discounted prices.tr9928Military, Marines, Herocustom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality Marine Corps Semper Fidelis Inserts at TrophyCentral. Each Marine Corps Semper Fidelis Insert can be used to create a unique plaque, medal or trophy.518211Military, Hero, Marines
custom-pageaward-medalsrifle-plaque-ipistols-plaque-irifle-eipistols-ei5048915012615016915049211trophies1Find hunting and rifle trophies discounted at TrophyCentral. Each hunting trophy includes three lines of engraving. Medals feature a free ribbon. Custom Marksman & Hunting Trophies TrophyCentral has a great online selection of discounted marksman trophies. Our single column trophy with a marksman shooting figure is a customer favorite. Be sure to see our perpetual rifle and shooting trophies for your next championship. All of our trophies include up to three lines of free personalization (larger awards include additional lines).

Shooting Sports Trophies for Gun Clubs and Hunting Organizations

Recognition drives excellence in shooting sports organizations and hunting clubs. Whether you manage a local gun club, coordinate trap shooting leagues and skeet competitions, or organize competitive rifle marksmanship events, unique quality trophies and plaques strengthen your program by honoring marksmanship skill development, celebrating shooting achievements, and reinforcing the firearm safety and sportsmanship values central to shooting sports traditions. From trap and skeet competitions to rifle shooting tournaments and sporting clays events, the right trophy awards create memorable moments that keep gun club members engaged season after season.

Our unique shooting sports trophies and plaques collection features designs specifically crafted for hunting clubs, gun clubs, and marksmanship organizations. Each trophy and plaque includes free personalized engraving to recognize individual shooting achievements, competition results, or club milestones. With quality construction, fast shipping, and budget-friendly options for ordering multiple awards, you can build a complete recognition program that celebrates everyone from first-time trap shooters to expert marksmen. Also see our view our comprehensive shooting sports awards guide for detailed recommendations on the best unique trophies and awards for your hunting club or gun club organization.

]]>
trophies
custom-pagetrophies-marksman-shooting-rifle1trophies498551-310.452429Trophies1Find this popular Marksman trophy discounted at TrophyCentral. Features a real marble base, free engraving and fast shipping.marksman-cup-place-trophy-tccustom-pagetrophies-marksman-shooting-rifle1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular marksman figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!qtmarksmanplcustom-pagetrophies-marksman-shooting-rifle1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%This popular Marksman Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!qtmarksmanyrcustom-pagetrophies-marksman-shooting-rifle1trophies498852-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with marksman figure discounted at TrophyCentral. Includes free text engraving!cup-marksman-pcustom-pagefree-sports-templates1"Download Only"free-sports49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Marksman template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Marksman-Certificatemarksman-freeMarksmancustom-pagetrophies-marksman-shooting-rifle1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these marksman budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtmarksmanscbcustom-pagetrophies-marksman-shooting-rifle1498852-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Find this budget marksman award trophy discounted at Trophy Central. Features a real marble base and plastic marksman / Shooter figure. Engraving is free. Fast 1-2 day shipping.bdg-marksmancustom-pagetrophies-marksman-shooting-rifle1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous two-tier Marksman Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtmarksmanttcustom-pagetrophies-marksman-shooting-rifle1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:28%Find this awesome Marksman two tier championship trophy discounted at TrophyCentral. Add up to 3 lines of Free Personalization!qtmarksmanttwcustom-pagetrophies-marksman-shooting-rifle1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%This popular Marksman Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtmarksmansccustom-pagetrophies-marksman-shooting-rifle1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.05Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%Find This Popular Marksman Deluxe Platform Series Trophies Discounted at TrophyCentral. Real Marble Base; Free Personalization!qtmarksmandmcustom-pagetrophies-marksman-shooting-rifle1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Marksman figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-marksman-scbcustom-pagetrophies-marksman-shooting-rifle1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.4226Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous Marksman Three-Column Trophies discounted at TrophyCentral. Fast 1-2 day shipping!qtmarksman3ccustom-pagetrophies-marksman-shooting-rifle1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:38%Our popular Marksman participation trophies feature a real slant-front marble base and free engraving.qtmarksmannccustom-pagetrophies-marlin-fishing1trophies498551-310.452429Trophies1Find this popular Marlin Fish trophy discounted at TrophyCentral. Features a real marble base, free engraving and fast shipping.marlin-fish-cup-place-trophy-tccustom-pagequickshiptrophies-marlin1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular marlin figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at trophyCentral. Ships in a fast 1-2 days!qtmarlinplFishing, 1st / 2nd / 3rd / Etc., Sportscustom-pagequickshiptrophies-marlin1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular Marlin Fish trophy with year trim discounted at trophyCentral. Available in multiple sizes and includes free engraving.qtmarlinyrFishing, Sportscustom-pagetrophies-marlin-fishing1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with marlin fish figure discounted at TrophyCentral. Includes free text engraving!cup-marlin-pFishing, Sportscustom-pagetrophies-marlin-fishing1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these marlin fish budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtmarlinscbFishing, Sportscustom-pagequickshiptrophies-marlin1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous two-tier Marlin Fish Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtmarlinttFishing, Sportscustom-pagequickshiptrophies-marlin1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:28%See this championship trophy with a Marlin Fish figure at TrophyCentral. Be sure to see all of our Marlin Fish figure awards.qtmarlinttwFishing, Sportscustom-pagequickshiptrophies-marlin1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%Find these popular Marlin Fish Single Column Elite Series trophies discounted and with free personalization at TrophyCentral.qtmarlinscFishing, Sportscustom-pagequickshiptrophies-marlin1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.05Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%Find These Popular Marlin Fish Deluxe Platform Trophies Discounted at TrophyCentral. Real Marble; Free Engraving!qtmarlindmFishing, Sportscustom-pagetrophies-marlin-fishing1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Marlin Fish figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-marlin-scbFishing, Sportscustom-pagequickshiptrophies-marlin1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.4226Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous Marlin Fish Champions Line 3-Column Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qtmarlin3cFishing, Sportscustom-pagequickshiptrophies-marlin1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:38%Our popular Marlin Fish participation trophies feature a real slant-front marble base and free engraving.qtmarlinncFishing, Sportscustom-pagefreeawardcertificates1"Download Only"certificates4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Marriage Award template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Marriage-Award-Certificatemarriage-award-freeMarriagecustom-pagefree-sports-templates1"Download Only"sports4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Martial Arts template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Martial-Arts-Certificatemartial-arts-freeMartial Artscustom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Martial Arts Inserts (Litho) at TrophyCentral. Each Martial Arts Insert can be used to create a unique plaque, medal or trophy.507501Karate / Martial Arts, Sports
custom-pageribbons1mascotbadges-pawmascotbadges-paw2mascotbadges-arrowheadmascotbadges-bearmascotbadges-bulldogmascotbadges-bulldog2mascotbadges-cardinalmascotbadges-eaglemascotbadges-hornetmascotbadges-mustangmascotbadges-indianmascotbadges-indian2mascotbadges-knightmascotbadges-lionmascotbadges-panthermascotbadges-piratemascotbadges-rammascotbadges-tigermascotbadges-spartanmascotbadges-vikingmascotbadges-wildcat11Shop for Mascot Badges at TrophyCentral. Each Mascot Badge Can be Customized with Your School Name!mascotpins mascot-medals trophies-mascotcustom-pageinserts148991948992948993948995148992248992148995248994448994748995048992448994648993548994348993848993448992548994148994548994848992748992648994948992848992348992048993048994248994048993611Browse our selection of mascot inserts to enhance school spirit. Each 2" inserts fits in a medal frame, trophy or plaque.1mascot-medalscustom-pageacademic-general-medalstm9919gtm9929gtm9939gtm9951gtm9922gtm9952gtm9944gtm9947gtm9950gtm9924gtm9935gtm9943gtm9938gtm9934gtm9925gtm9945gtm9948gtm9927gtm9926gtm9949gtm9921gtm9946gtm9941gtm9928gtm9923gtm9735gtm9730gtm9742gtm9940gtm9936gpaw-qcmmascotinserts1award-medals1"Soccer Medals and Trophies" "Soccer Trophies and Medals" "Baseball Trophies and Medals" "Baseball Medals and Trophies"We have a great selection of mascot medals, including Bull Dogs, Panthers and much more! Find your school mascot medals today!School & Sports Mascot Medals TrophyCentral has a fabulous selection of colorful mascot medals and mascot trophies to meet your needs. Choose from popular mascots, such as bulldogs, bears, gators, panthers and many more. Each mascot medal measures 2 1/4" in diameter and includes a neck ribbon. Ribbons are even available in a large number of color combinations to match your team or school colors! We offer FREE SHIPPING on mascot medal orders over $99 shipping to the contiguous U.S.]]>mascotpins trophies-mascotcustom-pagesports-pinsem08em17em05em14em15em12em02em01em09em06em16pm11pm26pm14pm25pm28pm20pm22pm23pm15pm27pm19pm24pm13pm12pm10pm18pm17mp1xxbr639xx11"Hockey Awards" "Gymnastics Awards" "School Awards" "Lapel Pins" "Custom Lapel Pins" "Trading Pins" "Custom Trading Pins" "Lapel Trading Pins" "Cheerleading Pins" "Dance Pins" "Cheerleader Pins"Mascot lapel pins for schools, teams, and booster clubs. Eagles, Tigers, Bulldogs, Panthers and more in brass and color enamel. Bulk pricing available. Ships in 1–2 days.

School & Team Mascot Lapel Pins — Show Your Spirit All Year Long

Mascot lapel pins are one of the most versatile and affordable ways to build school pride and recognize students, athletes, and supporters throughout the year. Elementary and middle school teachers use them as classroom rewards for effort, good citizenship, and academic improvement — small enough to hand out daily, meaningful enough to wear proudly on a backpack or jacket. High school athletic programs distribute mascot pins at the start of a season to build team identity, hand them out at pep rallies to fire up student sections, and include them in end-of-season recognition packages alongside trophies and medals. Booster clubs and PTOs order them in bulk for spirit nights, fundraiser events, and welcome back distributions at the start of the school year. Our mascot pin collection covers the most popular school mascots in the country — Eagles, Tigers, Lions, Bulldogs, Panthers, Bears, Falcons, Cobras, Bobcats, Blue Jays, Knights, and more — in antique brass and vibrant color enamel finishes, each with a secure clutch back for easy wear. School lapel pins and mascot trophies round out a complete spirit recognition program for any school or athletic department.

Frequently Asked Questions About Mascot Pins

What occasions are mascot pins typically used for?

Mascot pins serve a wide range of school and team recognition programs throughout the year. Teachers hand them out as classroom rewards for effort, good behavior, and academic milestones. Athletic directors include them in end-of-season award packages alongside trophies and medals. Booster clubs and PTOs distribute them at spirit events, fundraisers, and back-to-school nights. Student councils use them for school pride campaigns and leadership recognition. They are also popular as trading pins at tournaments and invitationals, where students and coaches exchange pins with competing schools as a tradition of sportsmanship.

What types of mascot pins are available?

Our mascot pins come in antique brass and color enamel finishes, plus chenille designs for a classic letter-jacket style look. Antique brass pins offer a traditional, detailed appearance at a budget-friendly price point. Color enamel pins feature vibrant full-color mascot artwork ideal for spirit events and high-visibility recognition. All styles include a secure clutch back for easy attachment to clothing, bags, and lanyards.

Can I order mascot pins in bulk for a school or team event?

Yes. Mascot pins are priced to support bulk ordering, with per-unit cost dropping significantly as quantities increase — making them practical for full classroom sets, entire athletic rosters, or school-wide spirit distributions. Most orders ship in 1 to 2 business days, so even last-minute event orders can arrive on time. Orders over $99 qualify for free economy shipping.

If you need more information before deciding, see our expert resource section:
]]>
custom-pageplaquesbear-plaque-slblue-jay-plaque-slbulldog-plaque-slcardinal-plaque-slcobra-plaque-slcougar-plaque-slcowboy-plaque-sleagle-plaque-slfalcon-plaque-slhawk-plaque-slindian-plaque-sljaguar-plaque-slknight-plaque-sllion-plaque-slmustang-plaque-slowl-plaque-slpirate-plaque-slram-plaque-slrattlesnake-plaque-slraven-plaque-sltiger-plaque-sltrojan-plaque-slviking-plaque-slwolf-plaque-slmascot-award-plaque1plaques1Find mascot plaques discounted at TrophyCentral. Each plaque features a mascot image and free engraving. Chose from bear, bull bog, rattlesnake and other popular mascots.

Shop with Ease at TrophyCentral!

If you are looking to buy mascot plaques or trophies online, look no further! TrophyCentral has an industry-leading selection that will fit any budget, all at discounted prices. Our experts in New York and Michigan have been providing help and suggestions since 1999! For more information, please call us at 1-888-809-8800.

]]>
mascotpins mascot-medals
custom-pageaward-medalsmt2011mt2002mt2001mt2009mt2012mt2015mt2014mt2021mt2016mt2020mt2008mt2035mt2034mt2030mt2026mt2027mt2028ts1023mascot-award-plaquemasc2001trophies1Shop for mascot trophies at TrophyCentral. Each mascot trophy and award features free personalization. See our large selection of school mascots!mascot trophies, mascot trophy, mascot awards, mascot trophies and awards

Mascot Recognition Trophies

TrophyCentral has an industry-leading selection of school mascot trophies. Popular mascots include: Bull Dogs, Trojans, Tigers, Cougars, Bob Cats, Panthers and many more. All of our mascot awards are made of hand-painted resin and include up to three lines of FREE ENGRAVING.

Mascot Medals

If you are looking for a budget-friendly alternative to trophies, our medals are the perfect solution. Each mascot medal includes a neck ribbon and optional engraving to keep the price as low as possible. School mascot medals are available in color with gold trim. Be sure to check out our Colorful Mascot Medals! Without engraving, your order will typically ship in just 1-2 business days, so no need to worry if you have waited for the last minute.
]]>
mascot-plaques mascot-medals
mascot-plaquesmt2011mt2002mt2001mt2009mt2006mt2012mt2015mt2014mt2021mt2016mt2020mt2008mt2035mt2034mt2030mt2026mt2027mt2028ts102311Shop for mascot trophies at TrophyCentral. Each mascot trophy and award features free personalization. See our large selection of school mascots!mascot trophies, mascot trophy, mascot awards, mascot trophies and awardsMascot Recognition Trophies TrophyCentral has an industry-leading selection of school mascot trophies. Popular mascots include: Bull Dogs, Trojans, Tigers, Cougars, Bob Cats, Panthers and many more. All of our mascot awards are made of hand-painted resin and include up to three lines of FREE ENGRAVING. We also offer FREE SHIPPING on award orders over $100 shipping to the continental U.S.

Mascot Medals

If you are looking for a budget-friendly alternative to trophies, our medals are the perfect solution. Each mascot medal includes a neck ribbon and optional engraving to keep the price as low as possible. School mascot medals are available in color with gold trim. Be sure to check out our Colorful Mascot Medals! Without engraving, your order will typically ship in just 1-2 business days, so no need to worry if you have waited for the last minute. ]]>
custom-pagemedallion-inserts-fraternal-organizational-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "Clubs, Organizations, Charities"Buy these quality Masonic Inserts (Litho) at TrophyCentral. Each Masonic Insert can be used to create a unique plaque, medal or trophy.491506
custom-pageacademic-general-medalsmath-plaque-imath-ei5181984897909057027math-excellence1trophies-academic1Find a great selection of math trophies discounted at TrophyCentral. Each math trophy includes free engraving. Math medals include a ribbon.math trophies, math trophy, math awards, math trophies and awards

Custom Math Trophies & Awards — Recognize Every Problem Solver

Math trophies recognize the analytical thinking, persistence, and academic dedication that set strong students apart at every grade level. From elementary classroom recognition programs celebrating multiplication milestones and perfect scores, to middle school math league competitions where students race against the clock, from high school math olympiad qualifiers testing advanced problem-solving under pressure, to district and regional competitions where top students represent their schools, quality math awards honor the intellectual effort that rigorous mathematics demands. Our versatile selection includes column trophies and insert designs featuring mathematics motifs, championship cups and champion's trophies ideal for competition winners, insert plaques customizable for any school or program name, medals in gold, silver, and bronze perfect for recognizing entire classrooms or large competition fields, and lapel pins providing affordable everyday recognition for math achievement, honor roll, and classroom excellence programs.

Frequently Asked Questions About Math Trophies

What math competitions and programs are these trophies suitable for?

Our math trophies and awards are suitable for a wide range of programs including classroom achievement recognition, math olympiad competitions, math leagues, school math fairs, and district and regional math competitions at the elementary, middle school, and high school levels. Medals and lapel pins work especially well for classroom-wide recognition programs where every student's achievement deserves acknowledgment, while larger trophies and plaques suit competition winners and top finishers.

What details should math trophy engraving include?

Essential elements include student name, award title, school or organization name, and year. For competitions, adding the event name and place finish creates a more meaningful keepsake. Classroom awards gain impact from specific titles like Math Excellence Award or Top Problem Solver. Keep text concise and readable, prioritizing the most meaningful details when space on smaller trophies requires choices.

Do you offer bulk discounts for math programs and competitions?

Yes, Trophy Central offers significant bulk discounts on math trophies and medals that scale with order quantity, keeping award budgets manageable for programs of any size. Teachers ordering medals or pins for an entire classroom, coordinators recognizing all participants in a school math fair, and districts purchasing awards across multiple schools all benefit from bulk pricing.

If you need more information before deciding, see our expert resource section:
]]>
trophies
custom-pagetrophies-math1trophies498551-310.452429Trophies1Find this popular Math trophy discounted at TrophyCentral. Features a real marble base, free engraving and fast shipping.math-cup-place-trophy-icustom-pagetrophies-math1medals498551-20.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful Math 2" Epoxy-covered insert sticker discounted at TrophyCentral. Fast shipping, free over $99.custom-pagemath-lapel-pinsplastic-pinbox-t5498551-20.550040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find our 3D Series gold mathematics pin discounted at TrophyCentral. Fast 1-2 day shipping.05282024Mathcustom-pagetrophies-math1trophies498551-211821.06TrophyCentraltrophies1Mathcustom-pagetrophies-math11Discover creative math award ideas with clever engraving examples for competitions and classroom recognition. From Mathlete to Number Ninja, find unique ways to celebrate mathematical achievement with free engraving.custom-pageachievement-certificates-awards17027 905"Download Only"free-academic49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"See this Math Certificate designed exclusively for TrophyCentral! Math Certificates can be downloaded for free!mathfrMath, Academiccustom-pagetrophies-math1medals498551-2120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Math Excellence Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Shipping is free over $99.Mathcustom-pageawardcertificates115905 noname6 mathfr br382"1-3 business days" "Columbia, South Carolina; Marquette, Michigan" "UPS (FedEx available on request)"certificates290631-21 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,50:38%,100:42%"Math Awards" "Mathematics Awards" "Math Award"Find these Math certificates discounted at TrophyCentral. Each Math certificate measures 8 1/2 x 11 inches and typically ships in 1-2 days.7027Mathcustom-pageawardcertificates11mathfr 7027certificates290631-31 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,25:24%,100:40%,500:50%"Math Awards" "Mathematics Awards" "Math Award"Find this math certificate and other awards discounted at TrophyCentral. Math certificates are beautifully printed; template measures 11 x 8 1/2 inches.905Mathcustom-pagetrophies-math1trophies498551-211.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Math insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-Math-InsertMathcustom-pagetrophies-math1trophies498551-210.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Math single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - MathMathcustom-pageachievement-certificates-awards1"Download Only"free-academic49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Math Excellence template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Math-Excellence-Certificatemath-excellenceMath, Academiccustom-pagetrophies-math1trophies498551-210.71217.38trophies1Mathcustom-pagetrophies-math1medals498551-2120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Math Excellence Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Shipping is free over $99.Mathcustom-pagetrophies-math1medals498551-20.525035.5TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find this colorful Math insert medal discounted at TrophyCentral. Fast shipping, free over $99.Mathcustom-pagetrophies-math1medals498551-20.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Math Excellence insert medal With A Personalized Front Rim discounted at TrophyCentral. Fast shipping, free over $99.Mathcustom-pagetrophies-math1trophies498551-21.1plaques1Find these math insert plaques discounted at TrophyCentral. Price includes free engraving. Shipping is free over $99.Math1academic-general-medals1Find math medals discounted at TrophyCentral. Each math medal features a free ribbon. Fast 1-2 day shipping.Shop with Ease at TrophyCentral TrophyCentral has a large selection of math medals, low prices and great customer service. Remember, each math medal features a free neck ribbon. Be sure to see our star and personalized rim frames with a math subject insert. Their unique designs make them popular choices with our customers. ]]>trophies-mathcustom-pagetrophies-math1trophies498551-210.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our math insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - MathMathcustom-pageschool-pinshp16br3823d-math1school-pins1Find Math Pins at TrophyCentral. Each Math Pin has a clutch back for easy and safe attachment to clothing. See all of our Math Awards.Lapel Pins: Math If you are looking for an inexpensive, yet quality way to recognize the achievements of your top math students, you have come to the right place! Whether you are looking to award students at the end of the year ceremony or motivate them throughout the year, we have a math pin for you. Math lapel pins for math typically ship in a quick 1-2 business days.]]>math-medalscustom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceCertificates / CoversEmbosser Seals1:22%,3:28%,5:31%Find these Math Certificate Seals discounted at TrophyCentral.803mathMathcustom-pagetrophies-math1medals498551-2120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Math Excellence Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Shipping is free over $99.Mathcustom-pagetrophies-math1trophies498551-210.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy math excellence insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Mathcustom-pagemath-lapel-pinsplasticpinboxvelapinbox10hp16"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"Math Awards" "Mathematics Awards" "Math Award" "Music Pins" "School Pins"Find these Math Whiz Pins discounted at TrophyCentral. Math pins feature a quality clutch back and ship in 1-2 days.br38206-15-2013Mathcustom-pagemath-lapel-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:30%,100:35%,500:48%"Math Awards" "Mathematics Awards" "Math Award" "Music Pins" "School Pins"hp1606-15-2013Mathcustom-pagetrophies-math12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105502-41130025Classic MedallicsInsertsAcademic1:22%"Math Awards" "Mathematics Awards" "Math Award" "Award Medals" "School Medals" "Award Medals - All Subjects"Buy these high-quality Mathematics Inserts at TrophyCentral. Each Mathematics Insert can be used to create a unique plaque, medal or trophy.518198Math
custom-pagetrophies-math12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these quality Mylar Mathematics Decal Inserts at TrophyCentral. Each decal can be used to create a unique plaque, medal or trophy.489790Math
custom-pagenoindexed-items11This page includes sample pictures of boxes to display award medals. TrophyCentral carries a variety of different medal display box styles and sizes.1custom-page11Click here to see sample images of our Medal Display Boxes. Add a special touch to your award ceremony that your recipient is sure to love!custom-pagedisplaycases211"7-10 business days" "Connelly Springs, North Carolina" "UPS (FedEx available on request)"display case286127-1010.45660.45SpartaCraftDisplay CasesSpecialty Cases1:14%Medal Display Cases from TrophyCentral. Discounted Trophies, Awards and Promotional Products.Ribbons / Medals Displayscustom-page11Find medal insert frames discounts at TrophyCentral. Choose from gold, silver and bronze finishes. Each frame is sized to fit a 2" medal insert.1custom-pageeawardmedals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsGeneral1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "School Medals" "General Award Medals"These inexpensive 1 1/4 inch Medal of Excellence Medals offer a high quality, but low price for those on a tight budget.e998805-22-2019Academic
custom-pageeawardmedals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsGeneral1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "School Medals" "General Award Medals"These inexpensive 1 1/4 inch Medal of Merit Medals offer a high quality, but low price for those on a tight budget.e9993General, Academic
custom-pagemedallion-inserts-general-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Mylar Medal Of Special Achievement Decal Inserts at TrophyCentral. Each Medal Of Special Achievement Decal can be used to create a unique plaque, medal or trophy.489902Achievement
custom-page11Click here to see sample colors for your medal's ribbons. We have a huge selection to match your school's colors or company's branding.1custom-pagedisplaycases21111rowchcora secodira secodi6ti mihodica chcoshdica"5-10 business days" "Connelly Springs, North Carolina" "UPS (FedEx available on request)"display case286125-1010.45690.45SpartaCraftDisplay CasesSpecialty Cases1:14%"Military Awards"Challenge Coin / Shadowboxes Display Cases from TrophyCentral.Challenge Coin Displayscustom-pagename-badges-tagswoyoulipr100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Megaphone Badges Discounted At TrophyCentral.namebadges-megaphonecustom-page11Enjoy fabulous membership discounts for your organization. Great for schools, not-for-profits and more. Also see our fundraising program. Click to learn more!custom-pagesports-inserts1105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Swimming Awards"Buy these quality Swimming (Men's Freestyle) Inserts (Litho) at TrophyCentral. Each Swimming (Men's Freestyle) Insert can be used to create a unique plaque, medal or trophy.504281Swimming / Diving, Sportscustom-pagefloor-standing-merchandiser145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Merchandiser light oak display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 48"W x 20"D. Model: 2010-4-gd-lv.2010-4-bz-lvTabletop, Floor-Standingcustom-pagefloor-standing-merchandiser145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Merchandiser light oak display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 60"W x 20"D. Model: 2010-5-gd-lv.2010-5-bz-lvTabletop, Floor-Standingcustom-pagefloor-standing-merchandiser1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Merchandiser light oak display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 72"W x 20"D. Model: 2010-6-gd-lv.2010-6-gd-lvTabletop, Floor-Standingcustom-pagefloor-standing-merchandiser1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Merchandiser light oak display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 48"W x 20"D. Model: 2010-4-bz-lv.2010-4-bz-lvTabletop, Floor-Standingcustom-pagefloor-standing-merchandiser1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Merchandiser light oak display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 60"W x 20"D. Model: 2010-5-bz-lv.2010-5-bz-lvTabletop, Floor-Standingcustom-pagefloor-standing-merchandiser145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Merchandiser light oak display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 72"W x 20"D. Model: 2010-6-bz-lv.2010-6-gd-lvTabletop, Floor-Standingcustom-pagefloor-standing-merchandiser145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Merchandiser light oak display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 48"W x 20"D. Model: 2010-4-sn-lv.2010-4-bz-lvTabletop, Floor-Standingcustom-pagefloor-standing-merchandiser145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Merchandiser light oak display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 60"W x 20"D. Model: 2010-5-sn-lv.2010-5-bz-lvTabletop, Floor-Standingcustom-pagefloor-standing-merchandiser145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Merchandiser light oak display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 72"W x 20"D. Model: 2010-6-sn-lv.2010-6-gd-lvTabletop, Floor-Standingcustom-pagedisplaycases12010-4-gd-lv2010-4-gd-wv2010-5-gd-lv2010-5-gd-wv2010-6-gd-lv2010-6-gd-wv2010-4-bz-lv2010-4-bz-wv2010-5-bz-lv2010-5-bz-wv2010-6-bz-lv2010-6-bz-wv2010-4-sn-lv2010-4-sn-wv2010-5-sn-lv2010-5-sn-wv2010-6-sn-lv2010-6-sn-wv11Find Merchandiser Series display cases discounted at TrophyCentral. Made in the US by Waddell, these quality displays are ideal for schools, libraries, retail locations and offices.displaycases1floor-standing-reliant floor-standing-edgecustom-pagefloor-standing-merchandiser145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Merchandiser walnut vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 48"W x 20"D. Model: 2010-4-gd-wv.2010-4-bz-lvTabletop, Floor-Standingcustom-pagefloor-standing-merchandiser145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Merchandiser walnut vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 60"W x 20"D. Model: 2010-5-gd-wv.2010-5-bz-lvTabletop, Floor-Standingcustom-pagefloor-standing-merchandiser1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Merchandiser walnut vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 72"W x 20"D. Model: 2010-6-gd-wv.2010-6-gd-wvTabletop, Floor-Standingcustom-pagefloor-standing-merchandiser145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Merchandiser walnut vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 48"W x 20"D. Model: 2010-4-bz-wv.2010-4-bz-lvTabletop, Floor-Standingcustom-pagefloor-standing-merchandiser145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Merchandiser walnut vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 60"W x 20"D. Model: 2010-5-bz-wv.2010-5-bz-lvTabletop, Floor-Standingcustom-pagefloor-standing-merchandiser145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Merchandiser walnut vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 72"W x 20"D. Model: 2010-6-bz-wv.2010-6-gd-wvTabletop, Floor-Standingcustom-pagefloor-standing-merchandiser145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Merchandiser walnut vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 48"W x 20"D. Model: 2010-4-sn-wv.2010-4-bz-lvTabletop, Floor-Standingcustom-pagefloor-standing-merchandiser145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Merchandiser walnut vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 60"W x 20"D. Model: 2010-5-sn-wv.2010-5-bz-lvTabletop, Floor-Standingcustom-pagefloor-standing-merchandiser145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Merchandiser walnut vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 72"W x 20"D. Model: 2010-6-sn-wv.2010-6-gd-wvTabletop, Floor-Standingcustom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceCertificates / CoversEmbosser Seals1:22%,3:28%,5:31%Find these Merit Embossed Certificate Seals discounted at TrophyCentral. Seals are easy to apply with a pressure-sensitive backing.803mGeneralcustom-pageschool-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:28%,100:32%,500:42%"School Pins" "School Lapel Pins"Find these popular Merit AP Series Lapel Pins discounted at TrophyCentral. Fast 1-2 day shipping!ap09General, Academiccustom-pagetrophies-basketball1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.45110.85Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%"Basketball Awards"Metal Basketball Award w/Trim. Ideal for leagues, schools, and tournaments. Fast shipping.metbasktrophytrimBasketball, Sportscustom-pagegifts-desk-general115-7 business days" "Marquette, Michigan" "UPS498554-7.45016TrophyCentral11:22%Metal Bottle Opener Key Chain. Bottle Opener with optional engraving.custom-pagegifts-desk-general11"3-4 business days" "Marquette, Michigan" "UPS"498552-4.414014TrophyCentral11:22%2 1/2 x 3 3/4 Business Card Holder. Made of Stainless Steel and hold approximately 10 business cards.custom-pagetrophies-football1trophies105503-610.45110.85Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:30%"Football Awards"Metal Football Award. Ideal for leagues, schools, and tournaments. Fast shipping.Football, Sportscustom-pagetrophies-soccer1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.45110.85Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%"Soccer Awards"Fabulous metal soccer trophy. Ideal for leagues, schools, and tournaments. Free Engraving. Fast shipping.Soccer, Sportscustom-pagecup-trophies-large-and-small1"3-4 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)""PT1=Trophies" "PC12=498552-311.2857.2TrophyCentralTrophies1:14%"Special Picks" "General Recognition Awards" "Golf Awards" "Popular Trophies" "Buy Trophies" "Discount Trophies" "Trophies : Fast" "New Products"Find these Metal Trophy Cups discounted at TrophyCentral. Choose from 3 popular sizes, each with a marble base and free personalization.cup-trophies-large-and-smallCupsilver-cup-trophiescustom-pageclocks11"6-10 business days w/engraving, 1-3 without" "Chicago, Illinois" "UPS (FedEx available on request)"personalized gifts6063010-141 3 231.2426RS OwensGiftsClocks1:22%Find the Michelangelo Desk Clock at TrophyCentral; Includes Engraving!Engraved Clockscustom-pagemusicartpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsMusic, Drama, Art, Dance1:22%,50:30%,100:33%,500:45%"Music Lapel Pins" "Band Lapel Pins" "Music Pins"Find These Microphone Pins Discounted at TrophyCentral. Each Microphone Lapel Pin Features a Clutch-Pin Back and Fast 1-2 Day Shipping!mp15Music / Band / Choruscustom-pageachievement-certificates-awards1"Download Only"free-academic4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Middle School Diploma template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Middle-School-Diploma-Certificatemiddle-school-diploma-freeDiploma, Academic, Graduationcustom-pageemployee-resource-hub11Complete military and veterans recognition guide with proper protocol, flag ceremony procedures, retirement awards, and meaningful ways to honor military service and sacrifice.11Find a great selection of discounted Military and Hero Awards and at TrophyCentral. Each Military Trophy and Award includes free engraving!trophies-military-hero

Firefighter Trophies

TrophyCentral has a fabulous selection of trophies for firemen, firewomen and for police offices. Our popular Firefighter Trophies section includes a variety of awards that will be displayed proudly in any firehouse. And don’t miss our Cup Trophies, very popular with police and fire stations. All of our hero awards include FREE ENGRAVING. We also offer FREE SHIPPING on award orders over $100 shipping to the continental U.S.

Military Trophies and Awards

No one deserves more recognition than our military heroes; they serve our country so that we can all enjoy freedom. We have trophies to recognize Army, Air Force, Navy, Marines and Coast Guard achievements. We also carry a huge selection of 2” inserts that can be used to create unique trophies, plaques and medals. We have Inserts for fireman, police offices, EMT workers and all branches of the military!

Shop with Confidence at TrophyCentral!

If you are looking to buy military trophies online, look no further! TrophyCentral has an industry-leading selection that will fit any budget, all at discounted prices. Our top-rated representatives are happy to assist you with all of your military trophy and award needs. Our experts in New York and Michigan have been providing suggestions and guidance since 1999! To find the perfect military trophy, click on an image above, or for personal service, call us toll-free at 1-888-809-8800.
]]>
custom-pagetrophies-military-hero515159515148515409517511518136518193518141515303514069518140514068515410517545516025515207515049517523515038512761515643513771515412517023495891519215129415128215181355153125158995159575159685176035150965150635150855152835172935182115154085137815071385140325127215175815151125127715175725175705182104933715050215184664933415049014933815050114933615050015140705119411inserts11"Military Award" "Military Awards" "Military Trophies" "Military Medals"Find military inserts discounted at TrophyCentral. Each 2" inserts fits in a medal frame, plaque or trophy to create a unique recognition item.custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality Military Intelligence Inserts at TrophyCentral. Each Military Intelligence Insert can be used to create a unique plaque, medal or trophy.515408Military, Hero
custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality Military Police Inserts at TrophyCentral. Each Military Police Insert can be used to create a unique plaque, medal or trophy.513781Military, Hero
custom-pageaward-medalsherepltr5643tr9931tr9929tr9928681111x14framwdo1trophies1Find military trophies discounted at TrophyCentral. Each military trophy includes free engraving! Custom Military Trophies and Awards No one deserves more recognition than our military heroes; they serve our country so that we can all enjoy freedom. We have trophies to recognize Army, Air Force, Navy, Marines and Coast Guard achievements. We also carry a huge selection of 2" inserts that can be used to create unique trophies, plaques and medals. We have Inserts for fireman, police offices, EMT workers and all branches of the military!

Shop with Confidence at TrophyCentral!

If you are looking to buy military trophies online, look no further! TrophyCentral has an industry-leading selection that will fit any budget, all at discounted prices. Our top-rated representatives are happy to assist you with all of your military trophy and award needs. Our experts in New York and Michigan have been providing suggestions and guidance since 1999! To find the perfect military trophy, click on an image above, or for personal service, call us toll-free at 1-888-809-8800. ]]>
trophies-victory simenplaq
custom-pageribbons-neck-drapejumpringshofordrri25"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"105502-30.3612006.36Classic Medallicsribbons1:22%,100:30%,500:37%Find a large selection of Military Drape Ribbons at TrophyCentraldrape ribbons, ribbon drape, award ribbons, drape award ribbonsReturn to thesection for more great choices.Red White Blue, Patrioticcustom-pagefreeawardcertificates1"Download Only"certificates4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our mindfulness template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-mindfulness-Certificatemindfulness-freeMindfulnesscustom-pagerosetteribbons1"1-2 business days" "Topeka, Indiana" "UPS (Post Office Priority Mail may also be available)"465711-21 260.3630021.36Tower RibbonRibbonsStock Ribbons1:22%,50:25%,100:31%"Rosette Ribbons"Find this mini patriot printed rosette ribbon discounted at TrophyCentral. Fast shipping!Academic, Patriotic, 1st / 2nd / 3rd / Etc.noindexed-items11Minuteman Awards from TrophyCentral. Discounted Trophies, Awards and Promotional Products.1custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these quality Minuteman Inserts (Litho) at TrophyCentral. Each Minuteman Insert can be used to create a unique plaque, medal or trophy.507138Military, Hero
noindexed-items11Minuteman Press - Norwich: Visit our TrophyCEntral partner1noindexed-items11Minuteman Press - St. Louis: Visit TrophyCentral to see this and similar Trophies and Awards1custom-pageacrylicawards11"1-2 business days" "Marquette, MI" "UPS"general498552-310.452425.6Quick TrophyCrystal Awards1:14%"New Products" "Special Picks"The Mirage Award is 1" thick with reflective gold base. Price includes engraving. This award is a quick-ship item and leaves the factory in just 1-2 business days.mirage5x7acrylicReturn to oursection for more great choices.general-corporate-awardsLeadership923-10200-11bevickersawardbapatr1ajax-test560-6924-10200-11705-5quick-holographic-plaques1]]>1custom-pageghent-new-mobile-boards1Bulletin Boards4512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Nexus Easel+, Mobile 2-Sided Porcelain Magnetic Whiteboard with Tablet Storage, 4 Tablets, 39"H x 26"W discounted at TrophyCentral.nex204ep4-frMobile, Easelcustom-pageghent-new-mobile-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Nexus Easel+, Mobile 2-Sided Porcelain Magnetic Whiteboard with Tablet Storage, 8 Tablets , 39"H x 26"W discounted at TrophyCentral.nex204ep4-frMobile, Easelcustom-pageenclosed-bulletin-boardsnex203me-frnex206mw-frnex204ep4-frnex204ep8-frnex204ep-frgarm1m134-ms1garm1m134-ms2garm1m146-ms1garm1m146-ms2arm4m434arm4m446arm4m448c4rkk34arkk43arkk34armk34armk43rmk34rkk46arm1m143arkk46arm1m134armm43armm34rmm34armk46rmk46rmm46arm1m146armm46arm1m148rm36sawhn1school1Shop for Mobile Bulletin Boards with Ease at TrophyCentral. We have great customer service, low prices and bulk discounts. Need help finding mobile or cork boards? We sell online, but we have real people who would love to assist you!1Shop for Mobile Bulletin Boards with Ease at TrophyCentral We have great customer service, discounted prices and bulk discounts. Do you need help with a product or ordering? Yes, we sell online, but we have real people who would love to assist you! Feel free to call our customer service experts in Michigan, New York and online. TrophyCentral - delivering smiles since 1999!]]>enclosed-whiteboardscustom-pageghent-new-mobile-boards1Bulletin Boards45123110-171 3 4 5 6 7 8 9 10 22 2341Bulletin Boards11Find the Ghent Reversible Cork Bulletin Board with Aluminum Frame, 3'H x 4'W discounted at TrophyCentral.arkk34Not Enclosed, Reversiblecustom-pageghent-new-mobile-boards145123110-171 3 4 5 6 7 8 9 10 22 2341Bulletin Boards11Find the Ghent Reversible Cork Bulletin Board with Aluminum Frame, 4'H x 3'W discounted at TrophyCentral.arkk34Not Enclosedcustom-pagestar-pinsplasticpinboxvelapinbox1"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsGeneral1:30%,50:34%,100:38%"Star Pins" "Star Lapel Pins" "Star Award Pins"Find these Modern Star with Sparkle Finish Pins discounted at TrophyCentral. Each pin features a beautiful copper finish and clutch-back.br592bStar, Generalcustom-pagestar-pinsplasticpinboxvelapinbox1"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsGeneral1:30%,50:34%,100:38%"Star Pins" "Star Lapel Pins" "Star Award Pins"Find this Modern Silver Sparkle Star Award Pin at TrophyCentral. Modern Silver Sparkle Star Award and other pins ship in just 1-2 business days!br592sStar, Generalcustom-pagestar-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsGeneral1:30%,50:34%,100:38%"Star Pins" "Star Lapel Pins" "Star Award Pins"Find this Modern Star Pin with Sparkle Finish Discounted at TrophyCentral. Fast 1-2 Day Shipping.br592gStar, Generalcustom-pagestar-pinsplasticpinboxvelapinbox1"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsGeneral1:30%,50:34%,100:38%"Star Pins" "Star Lapel Pins" "Star Award Pins"Find this 1-inch Molded Star pin discounted at TrophyCentral. Molded Star pins feature a quality clutch-back.br29211-25-2010Star, Generalcustom-pagegavelplaques11"7-10 business days w/engraving" "Chicago, Illinois" "UPS (FedEx available on request)"plaques606307-101 3 230.451616.45RS OwensPlaquesGeneral1:22%,2:26%Money Bags Plaques from TrophyCentral. Discounted Trophies, Awards and Promotional Products.12-20-2020plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"105502-30.31150030.3Classic Medallicslapel-award-pins1:22%,50:30%,100:38%,500:58%"Math Awards" "Mathematics Awards" "Math Award" "School Awards" "Spelling Bee Award" "Spelling Bee Awards" "Awards, Spelling Bee" "Spelling Bee Trophies" "Spelling Bee Trophy" "Spelling Awards" "Spelling Award" "Spelling Trophies" "Spelling Bee Medals" "Spelling Medals"Art, Business, Citizenship, Computer, Creative Writing, Debate, Drama, Effort, English, Honor Roll, Effort, Improvement, Journalism, Language Arts, Leadership, Library, Math, Merit, Perfect Attendance, Physical Education, Reading, Safety Patrol, Salutatorian, Science, Scholarship, Scholastic, Service, Social Studies, Spanish, Speech, Spelling, Student Council, Valedictorian, Yearbookcustom-pagemedals-general20medals498551-30.5100021TrophyCentralInsertsSports, Hobby, Org, Livestock1Find this colorful Most Improved 2" Epoxy-covered insert discounted at TrophyCentral. Fast 1-2 day shipping.Most Improvedcustom-pagefree-sports-templates1"Download Only"free-sports4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Most Improved Athlete template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Most-Improved-Athlete-Certificatemost-improved-athleteMost Improvedcustom-pagemedals-general1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Most Improved Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Most Improvedcustom-pagetrophies-general1trophies498551-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Most Improved insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Most Improvedcustom-pagetrophies-general1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Most Improved single column insert trophy features a choice of column color, a marble base and free trophy engraving.Most Improvedcustom-pagetrophies-general1trophies498551-311821.06TrophyCentraltrophies1custom-pagemedals-general1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Most Improved Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Most Improvedcustom-pagemedals-general1medals498551-30.525035.5TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find this colorful Most Improved insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Most Improvedcustom-pagemedals-general1medals498551-30.525035.5TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find this Most Improved insert medal with a personalized front rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Most Improvedcustom-pagetrophies-general1plaques498551-311.11623.5TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these Most Improved insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Most Improvedcustom-pageschool-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"Baseball Pins" "Soccer Pins" "Basketball Pins" "Football Pins" "Volleyball Pins" "Swimming Pins" "Track Pins" "Wrestling Pins"Find these Most Improved pins discounted at TrophyCentral. Each Most Improved lapel pin features a clutch back. Perfect for athletes and students.br37707-15-2012General, Academic (General)custom-pagemedals-general12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Sports Medals"Your athletes will love these colorful Mylar Most Improved Medals from TrophyCentral. Each Most Improved medal includes a neck ribbon!tm9964gSports
custom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these high-quality Most Improved Inserts at TrophyCentral. Each Most Improved Insert can be used to create a unique plaque, medal or trophy.518180General
custom-pagemedals-general102-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.5115014Classic Medallicsaward-medalsAcademic1:22%,25:24%,50:30%,100:36%,500:42%"School Medals" "School Award Medals" "Scholastic Medals" "Scholastic Award Medals" "Academic Medals" "Academic Award Medals" "Medals, School"Your students will love these colorful Mylar Most Improved Medals from TrophyCentral. Each Most Improved medal includes a neck ribbon!tm9886Academic
custom-pageeawardmedals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsGeneral1:22%,100:28%,500:34%,1000:45%"Band Awards" "Award Medals - All Subjects" "School Medals" "General Award Medals" "Sports Awards" "Sports Medals"These inexpensive 1 1/4 inch Most Improved Medals offer a high quality, but low price for those on a tight budget.e993212-20-2020Academic (General)
custom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these quality Mylar Most Improved Decal Inserts at TrophyCentral. Each decal can be used to create a unique plaque, medal or trophy.489886Achievement
custom-pagetrophies-general1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our most improved insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Most Improvedcustom-pagestar-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:34%,100:39%,500:43%"School Pins" "School Lapel Pins"Find this Most Improved with Stars Pin at TrophyCentral. Most Improved with Stars and other pins ship in just 1-2 business days!br583Sports, Academiccustom-pagemedals-general1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Most Improved Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Most Improvedcustom-pageachievement-certificates-awards1"Download Only"free-sports49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Most Improved Student template is free and designed exclusively for TrophyCentral. Award certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Most-Improved-Certificatemost-improved-freeMost Improved, Academiccustom-pageachievement-certificates-awards1"Download Only"free-academic49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Most Improved Student template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Most-Improved-Student-Certificatemost-improved-student-freeMost Improved, Academiccustom-pagefree-sports-templates1"Download Only"free-sports49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Most Valuable Player Award template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Most-Valuable-Player-Award-Certificatemost-valuable-freeMost Improved1"2-3 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)""PT1=Trophies" "PC12=465713-410.45613.1Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,100:29%"Golf Trophies"Motion Xtreme (700 Series) Trophies - Woman's Golf. Ideal for leagues, schools, and tournaments. Fast shipping.mx70412-20-2040Golf, Sportsbobatr11"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.451810.3Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,25:35%"Basketball Awards" "Basketball Trophies"Motion Xtreme 5" (500 Series) Trophies - Female Girl's Basketball. Ideal for leagues, schools, and tournaments. Fast shipping.gibatrBasketball, Sportscustom-pagedramatrophies21"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)""PT1=Trophies" "PC12=465713-410.45810.3Tower RibbonTrophiesMusic, Drama, Art, Dance1:22%,25:35%"Drama Trophies" "Drama Awards"Find These Motion Xtreme 500 Theater Trophies Discounted at TrophyCentral. Price Includes Free Engraving. Large Quantity Discounts Available.drmatrSee more greatin a variety of styles.trophies-drama12-20-2040Dramacustom-pagetrophies-football11"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.451810.46Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,25:35%"Football Awards"Motion Xtreme 5" (500 Series) Trophies - Football. Ideal for leagues, schools, and tournaments. Fast shipping.moxtfotr06-14-2026Football, Sportscustom-page11"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.451810.3Tower RibbonTrophiesMusic, Drama, Art, Dance1:22%,10:28%,25:34%"Band Awards"Find This Popular Motion Xtreme 500 Music Trophy At TrophyCentral. The Price Of Each Motion Xtreme 500 Trophy Includes Engraving.moxtmutr12-31-25Music / Band / Choruscustom-page11custom-page11"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.451810.3Tower RibbonTrophiesReligious1:22%,25:26%Find This Popular Motion Xtreme 500 Religious School Cross Trophy At TrophyCentral. The Price Of Each Motion Xtreme 500 Religious School Cross Trophy Includes Engraving.recrsctr09-25-2012Religious11Shop for Motion 500 Series Trophies at TrophyCentral. Each trophy measures 5" tall and includes personalization. Fast 2-3 day shipping!111Shop for Motional Xtreme 700 Series trophies at TrophyCentral. Each trophy includes free personalization. Fast 2-3 day shipping!1custom-pagefield-day-templatesgreat-job-mcgreat-job-mc-prexcellence-mcexcellence-mc-prexcellence-jigfgreat-job-jigfexcellence-jibfgreat-job-jibfexcellence-jisfgreat-job-jisftm9964gmost-improved-jigfmost-improved-jisfmost-improved-jibfmost-improved-mcmost-improved-mc-prtm9789tm9886tm9711tm97001achievement-medals1Find motivational medals discounted at TrophyCentral. Choose from subjects such as Great Job, Most Improved and many more. Each medal features a free neck ribbon.medals-general

Motivational Medals - Encourage Effort, Improvement, and Positive Achievement

Motivational medals serve a recognition purpose that competitive placement medals and academic subject medals cannot fill on their own: they celebrate the effort, attitude, and personal growth that often matter more than finishing first or earning the highest grade. A Most Improved medal presented to the athlete who worked hardest all season, a Good Sportsmanship medal given to the player who competed with integrity and grace, or a Great Job medal handed to a student who pushed through a difficult challenge communicates something deeply personal that a generic participation award never could. Our motivational medal collection features a wide range of subject designs covering the most commonly recognized positive behaviors and personal achievements, including Great Job, Most Improved, Good Sportsmanship, Star Student, Hard Worker, Team Player, Best Attitude, and many more, making it easy for coaches, teachers, and program directors to present a medal that speaks directly to the specific quality being honored in each individual recipient. Every motivational medal includes a free neck ribbon for immediate wearable presentation at ceremonies, classroom events, and team gatherings, and volume pricing makes it practical to present a motivational medal to every deserving student or athlete without straining a program budget.

Frequently Asked Questions About Motivational Medals

What occasions and programs are motivational medals most commonly used for?

Motivational medals are most commonly used in youth sports programs, elementary and middle school classrooms, and any recognition context where encouraging positive behaviors and personal growth matters as much as rewarding competitive achievement. Youth sports leagues use motivational medals as end of season awards for categories like Most Improved Player, Best Sportsmanship, Most Coachable, Best Team Player, and Hardest Worker, giving coaches a meaningful way to recognize the personal qualities that make a program successful beyond wins and losses. Elementary and middle school classroom recognition programs use Great Job, Star Student, Hard Worker, and Most Improved medals to acknowledge students who demonstrated exceptional effort, attitude improvement, or personal growth during a grading period or school year. Summer camps, after-school programs, and enrichment activities use motivational medals at closing ceremonies to recognize participants for the character and effort they demonstrated throughout the program. Community organization programs recognizing youth volunteers, junior leaders, and program participants also use motivational medal subjects to acknowledge the specific qualities each participant brought to the group. The common thread across all these contexts is that the award recognizes who the recipient is and how they showed up rather than simply what competitive result they achieved, making motivational medals a powerful complement to placement and academic awards within any complete recognition program.

How do motivational medals differ from participation medals and achievement medals?

Motivational medals, participation medals, and achievement medals each serve a distinct recognition purpose and work best when used together within a layered program rather than as substitutes for one another. Participation medals acknowledge that a student or athlete completed the program or season, recognizing their presence and commitment without distinguishing any particular quality or accomplishment beyond showing up and finishing. Achievement medals recognize specific competitive or academic results such as first place finishes, honor roll standing, or competition placement, communicating a measurable outcome relative to other participants. Motivational medals occupy a unique middle ground, recognizing specific positive qualities, behaviors, and personal growth in a named individual without requiring competitive placement or completion of a formal program, making them the most personal and individualized of the three formats. A youth sports program might present participation medals to every player who completed the season, placement medals to tournament finishers, and motivational medals to specific individuals recognized for Most Improved, Best Sportsmanship, and Hardest Worker, using each format where it serves the recognition goal most effectively. The motivational medal is always the most personal award in this structure because it requires the coach or teacher to observe the individual specifically and select a subject that reflects what they saw in that particular person throughout the program.

What motivational medal subjects work best for different programs and age groups?

The most effective motivational medal subjects are those that resonate with the specific culture and goals of the program presenting them, with different subject choices working better for different age groups and recognition contexts. For elementary school programs, Great Job, Star Student, and Hard Worker medals are the most universally appropriate subjects because they communicate positive reinforcement in simple, direct language that young children immediately understand and respond to. Most Improved medals work powerfully at every age level because they specifically reward growth over time rather than natural ability, making them particularly meaningful for athletes and students who started the season or year behind their peers but demonstrated genuine development. Good Sportsmanship medals resonate strongly in youth sports contexts where coaches and parents are actively building character alongside athletic skills, and presenting this medal publicly signals to the entire team that how you compete matters as much as whether you win. Best Attitude and Most Coachable medals suit slightly older athlete groups in middle school and competitive youth programs where the qualities of receptiveness, positivity, and work ethic are recognized as genuine competitive advantages worth celebrating. Team Player medals work well in both sports and classroom settings where collaboration and supporting others is a core program value. Best Effort and Never Give Up subjects suit programs specifically focused on perseverance and resilience as primary values. See our complete collection of award medals and achievement medals for all available styles that complement motivational medals in a complete recognition program.

If you need more information before deciding, see our expert resource section:
]]>
custom-pagecertificatesbstick8bstick9bstick10bstick2bstick5bstick4bstick7bstick3bstick1bstick611Find Motivational Stickers discounted at TrophyCentral. Each sticker features a unique colorful design and is available in rolls of 500.medals-general1"1 - 2 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"290631-2816.4511school-stickers-allcustom-pageaward-medalsmost-improved-part-imost-improved-single-imost-improved-champ-imost-improved-plaque-imost-improved-e-single-imost-improved-e-part-igreat-job-plaque-igreat-job-part-igreat-job-single-iblank-part-iblank-single-iblank-champ-igreat-job-champ-igreat-job-e-part-igreat-job-e-single-iexcellence-e-part-iexcellence-single-iexcellence-e-single-iexcellence-part-icup-great-job-scb-icup-excellence-incup-great-job-incup-most-improved-inexcellence-champ-i1achievement-trophies-awards1Find motivational trophies discounted at TrophyCentral. Here you will find subjects such as most improved, excellence and great job. Each motivational trophy includes personalization.star-trophies first-place-ribbonscustom-pageaward-medalsqtmotorncqtmotorscqtmotordmqtmotoryrqtmotorplqtmotorttqtmotorttwqtmotor3cqtmotoperpmqtmotorscbcup-motor-scbcup-motor-p1trophies1Find motocross trophies discounted at TrophyCentral. Each motocross trophy includes free engraving. Fast 1-2 day shipping.Custom Motocross Trophies and Awards

TrophyCentral has been supplying motocross tracks, clubs, and events with quality trophies since 1999. All motocross trophies include up to three lines of free engraving. Need awards in a hurry? Orders without engraving typically ship in 1-2 business days and sometimes the same day, depending on time of year and when the order is placed. Browse our complete trophies collection for additional styles and designs.

]]>
custom-pagenew-trophies-21trophies498551-310.452429Trophies1Find this popular Motocross trophy discounted at TrophyCentral. Features a real marble base, free engraving and fast shipping.motocross-cup-place-trophy-tccustom-pagetrophies-motocross1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular motocross figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!qtmotorplMotocross, 1st / 2nd / 3rd / Etc., Sportscustom-pagetrophies-motocross1trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find these popular Motocross year trim trophies discounted at TrophyCentral. Available in multiple sizes and includes free personalization.qtmotoryrMotocross, Sportscustom-pagetrophies-motocross1trophies498852-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with motocross bike figure discounted at TrophyCentral. Includes free text engraving!cup-motor-pMotocross, Sportscustom-pagetrophies-motocross1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these motocross bike budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtmotorscbMotocross, Sportscustom-pagetrophies-motocross1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous two-tier Motocross Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtmotorttMotocross, Sportscustom-pagetrophies-motocross1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-411.215Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%See this championship trophy with a Motocross figure at TrophyCentral. Be sure to see all of our Motocross figure awards.qtmotorttwMotocross, Sportscustom-pagetrophies-motocross1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%Find these popular Motocross Bike Elite Series trophies discounted and with free personalization at TrophyCentral.qtmotorscMotocross, Sportscustom-pagetrophies-motocross1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.451623.65Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%Find Our Motocross Deluxe Platform Series Trophies Discounted at TrophyCentral. Real Marble Base; Free Personalization!qtmotordmMotocross, Sportscustom-pagetrophies-motocross1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Motocross Bike figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-motor-scbMotocross, Sportscustom-pagetrophies-motocross1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-411.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous Champions Line 3-Column Motocross Trophies discounted at TrophyCentral. Free personalization and fast 1-2 day shipping!qtmotor3cMotocross, Sportscustom-pageholographic-insert-plaques1"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498852-310.45811.6Quick TrophyPlaquesInsert1:14%,3:14%See this stunning Motocross plaque and other Holographic Plaques at TrophyCentral.qsinplaqmotocrossMotocross, Sportscustom-pagetrophies-motocross1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%,25:23%,50:29%,100:34%Our popular Motocross participation trophies feature a real slant-front marble base and free engraving.qtmotorncMotocross, Sportscustom-pagetrophies-motocross1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498852-311.4234Quick TrophyTrophies1:14%,3:15%,10:16%Find this Perpetual Series Trophy - MotocrossDiscounted at TrophyCentral. Each Trophy has enough room for 32 names. Ships in just 1-2 days.qtmotoperpReturn to thesection for other great choices.trophies-motocrossMotocross, Sportscustom-pagebottles-st80"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14144023.2Glass AmericaPromotional ProductsSports / Water Bottles1:14%,640:38%Mountaineer Collection - Green from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.71079Sports / Water Bottlescustom-pagebottles-st80"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14144018Glass AmericaPromotional ProductsSports / Water Bottles1:14%,640:38%"Basketball Water Bottles" "Logo Sports Bottles" "Sports Bottles" "Promotional Sports Bottles" "Aluminum Sports Bottles" "Stainless Water Bottles" "Aluminum Water Bottles" "Bike Water Bottles" "Bicycle Water Bottles" "Baseball Water Bottles" "Football Water Bottles" "Promotional Water Bottles" "Soccer Water Bottles"Mountaineer Collection - Red from TrophyCentral.71076Sports / Water Bottlescustom-pagebottles-st80"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14144018Glass AmericaPromotional ProductsSports / Water Bottles1:14%,640:38%"Basketball Water Bottles" "Logo Sports Bottles" "Sports Bottles" "Promotional Sports Bottles" "Aluminum Sports Bottles" "Stainless Water Bottles" "Aluminum Water Bottles" "Bike Water Bottles" "Bicycle Water Bottles" "Baseball Water Bottles" "Football Water Bottles" "Promotional Water Bottles" "Soccer Water Bottles"Mountaineer Collection - Silver from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.71070Sports / Water Bottlescustom-pagebottles-st80"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14144023.2Glass AmericaPromotional ProductsSports / Water Bottles1:14%,640:38%Find these Blue Mountaineer Collection Custom Water Bottles discounted at TrophyCentral. Price includes a 1-color, 1-side imprint.71084Sports / Water Bottlescustom-pageawri11"5-7 business days" "Topeka, Indiana" "UPS (Priority Mail also available)"medals465715-71 260.4620016.46Tower RibbonRibbonsAwareness Ribbons1:22%,50:36%"Customized Ribbons" "Black Ribbons"Find mourning ribbons discounted at TrophyCentral. Each black mourning ribbon features choice of backing and optional imprint.blmoriMourningcustom-page11Multi Add Test at TrophyCentral.1custom-pagecustompennants1110-1411 2 3 4 5 6 7 8 9PepcoCustom Pennants1Use this link if your pennant flag artwork has more than one color. Artwork and logos can include up to 4 colors. TrophyCentral is a Top-Rated Yahoo Merchant.1custom-pagecrystalcups1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"general410187-1010.45448.45JcharlesCrystal Awards1:22%,25:24%"Team Award" "Team Awards" "Team Trophy" "Team Trophies" "Team Trophies and Awards"Generalcustom-pagemusic-certificate-templatesscoolribbonsfunribbonsqtdogmuscband-eimusic-eimusic-lyre-ei4976645031315066055031214897685044615129815073945044715049515049411trophies1"Music Awards" "Trophies"Shop for Custom Music Trophies and Awards with Ease at Trophy Central

Trophy Central has a great selection, low prices, and top-rated customer service. Our experts in New York and Michigan have provided help and guidance since 1999! They are would be happy to help you, too.

If you need help before deciding, see our expert resource section:

Also see:

FAQ's

What types of music awards do you offer?

We offer music medals, trophies, plaques, and certificates for all instruments and performers’ achievements, including piano, choir, band, and general musician recognition. Many trophies feature a music note to highlight musical excellence, and they’re perfect for recital moments and year-end ceremonies.

What metal finishes are available for these medals?

Most music plaques and medals come in gold, silver, and bronze finishes to denote 1st to 3rd places. Some medals come in antique gold and black nickel for a vintage look.

Do you offer bulk discounts for large music programs?

Absolutely. We offer bulk discounts for schools, studios, and organizations ordering multiple awards for bands, choirs, or music competitions.

How quickly can my music awards be shipped?

Most trophies ship within 1-2 business days from our U.S. facilities, with expedited options available for urgent ceremony deadlines.

]]>
music-award-certificates star-trophies trophies
custom-pagetrophies-music12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105502-41130025Classic MedallicsInsertsMusic, Drama, Art, Dance1:22%"Award Medals" "Art / Dance / Drama Medals" "Award Medals - All Subjects" "Music Awards" "Music Medals"Buy these quality Music (497664) Inserts (Litho) at TrophyCentral. Each 2" insert can be used to create a unique plaque, medal or trophy.497664Music / Band / Chorus
custom-pagetrophies-music12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105502-41130025Classic MedallicsInsertsMusic, Drama, Art, Dance1:22%"Award Medals" "Art / Dance / Drama Medals" "Award Medals - All Subjects" "Music Awards" "Music Medals"Buy these quality Music (506605) Inserts (Litho) at TrophyCentral. Each Music (506605) Insert can be used to create a unique plaque, medal or trophy.506605Music / Band / Chorus
custom-pagemusicartpins1plasticpinboxvelapinbox10cl27 11diecut cl28 br572"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsMusic, Drama, Art, Dance1:22%,50:28%,100:32%,500:42%"Music Lapel Pins" "Band Lapel Pins" "Band Awards" "School Pins"Find Lyre Music pins at TrophyCentral. Each AP Series Music pin features a Lyre design and includes a clutch back.ap28Music / Band / Choruscustom-pagetrophies-music1trophies498551-310.452429Trophies1Find this popular Music trophy discounted at TrophyCentral. Features a real marble base, free engraving and fast shipping.music-cup-place-trophy-tccustom-pagetrophies-music1498551-324751Music Place Trim trophy (1st, 2nd, 3rd). Ideal for school events and competitions. Fast shipping.custom-pagetrophies-music20medals498552-40.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful Music 2" Epoxy-covered insert decal discounted at TrophyCentral. Fast 1-2 day shipping.Music / Band / Choruscustom-pagetrophies-music1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesMusic, Drama, Art, Dance1:14%,10:18%,50:22%,100:25%"Music Trophies" "Music Trophy"This popular Music trophy features a real marble base, column, figure and trim indicating year of award. Includes up to three lines of free engraving!qtmusicyrMusic / Band / Choruscustom-pagemusicartpins1plastic-pinbox-t5498551-20.550040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find our 3D Series gold music pin discounted at TrophyCentral. Each outstanding volunteer pin features a clutch back so it can be easily and safely attached to clothing. Fast 1-2 day shipping.Music / Band / Choruscustom-pagetrophies-music1"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"medals498552-30.3716021.6Trophy Centralaward-medalsMusic, Drama, Art, Dance1:14%,10:19%,50:28%,100:34%,500:42%"Music Medals"Find These Music 3D Relief Medals At A Great Low Price And With Fast Shipping At TrophyCentral. Large Quantity Discounts Available.qush3dmusicmeMusic / Band / Choruscustom-pagetrophies-music1trophies498552-311821.06TrophiesMusic, Drama, Art, Dance1Find this achievement cup trophy with music figure discounted at TrophyCentral. Includes free text engraving!cup-music-pMusic / Band / Choruscustom-pagetrophies-music1medals498552-30.525033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Music Notes 2 1/4" Antique Gold Medal Discounted at TrophyCentral. Each medal features a free ribbon. Fast shipping!Music / Band / Choruscustom-pagemusic-certificate-templates1"Download Only"free-music4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our music certificate of award template is free and designed exclusively for TrophyCentral. Measures 11 x 8 1/2 inches and can be easily downloaded and printed.music-award-templatemusic-award-521Musiccustom-pagetrophies-music12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsMusic, Drama, Art, Dance1:22%,100:28%,500:34%,1000:45%"Music Awards" "Award Medals - All Subjects" "School Medals" "Music Medals"These inexpensive 1 1/4 inch Music Medals offer a high quality, but low price for those on a tight budget.e900707-30-2021Music / Band / Chorus
custom-pagemusic-certificate-templates1"Download Only"free-music4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our music achievement certificate is a great way to recognize a talented musician or student! It's free and designed exclusively for TrophyCentral. Music achievement templates measure 11 x 8 1/2".music-templatemusic-521Achievement, Musiccustom-pagemusicartpins1plasticpinboxvelapinbox1"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsMusic, Drama, Art, Dance1:30%,50:34%,100:38%"Music Lapel Pins" "Band Lapel Pins" "Band Awards" "School Pins"Find Music Award pins discounted at TrophyCentral. Each lapel pin features a quality finish and clutch back. Be sure to browse all of our music pins and awards.br473Music / Band / Chorus11Who is the youngest Grammy winner? Not sure? Check out this fun music infographic for the answer to this and other music trivia questions.custom-pagetrophies-music12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105502-41130025Classic MedallicsInsertsMusic, Drama, Art, Dance1:22%"Band Awards" "Award Medals" "Art / Dance / Drama Medals" "Award Medals - All Subjects" "Music Awards"Buy these quality Music Band Inserts (Litho) at TrophyCentral. Each Music Band Insert can be used to create a unique plaque, medal or trophy.503131Music / Band / Chorus
custom-pagetrophies-music1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Music Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Music / Band / Choruscustom-pagetrophies-music1trophies498552-312421.33TrophiesMusic, Drama, Art, Dance1Find these music budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtmusicscbMusic / Band / Choruscustom-pagetrophies-music1498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Find this budget musical note award trophy discounted at Trophy Central. Features a real marble base and plastic musical note figure. Engraving is free. Fast 1-2 day shipping.bdg-musicMusic / Band / Choruscustom-pagetrophies-music1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511230.45Classic MedallicsTrophiesAcademic1:22%,6:23%,12:24%,24:26%"Music Awards"Shop for Cast Stone Music Awards at TrophyCentral. We have a great selection of Music and other recognition trophies at discounted prices.tr9913Return to oursection of more choices in a variety of styles.trophies-musicMusic / Band / Choruscustom-pagemusicartpins191070341awardcertificates11Find music certificates at TrophyCentral. Each music certificate measures 8 1/2" x 11" and is beautifully printed. Also find band, choir and other popular certificate awards.trophies-music musicartpins1custom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceCertificates / CoversEmbosser Seals1:22%,3:28%,5:31%Find these Music Certificate Seals discounted at TrophyCentral. Seals are easy to apply with a pressure-sensitive backing.803musicMusic / Band / Choruscustom-pagetrophies-music1trophies498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Music insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-Music-InsertMusic / Band / Choruscustom-pagetrophies-music1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75219Quick TrophyTrophiesMusic, Drama, Art, Dance1:14%,3:19%,10:27%"Music Trophies"Find these fabulous two-tier Music Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtmusicttBe sure to see our full selection ofin a large variety of sizes and styles.trophies-musicMusic / Band / Choruscustom-pagetrophies-music1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.215Quick TrophyTrophiesMusic, Drama, Art, Dance1:14%,3:19%,10:28%See this championship trophy with a Music figure at TrophyCentral. Be sure to see all of our Music figure awards.qtmusicttwMusic / Band / Choruscustom-pagetrophies-music12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105502-41130025Classic MedallicsInsertsMusic, Drama, Art, Dance1:22%"Award Medals" "Art / Dance / Drama Medals" "Award Medals - All Subjects" "Music Awards" "Music Medals"Buy these quality Music Choir Inserts (Litho) at TrophyCentral. Each Music Choir Insert can be used to create a unique plaque, medal or trophy.503121Music / Band / Chorus
custom-pagetrophies-music1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Music single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - MusicMusic / Band / Chorus11Find Music Column Trophies Discounted at TrophyCentral. Each Music Column Trophy Offers a Choice of Size and Color, and Also Features Free Personalization!custom-pagetrophies-music1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesMusic, Drama, Art, Dance1:14%,10:18%,50:24%,100:28%"Music Trophies" "Music Trophy" "Band Awards"This popular Music Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtmusicscMusic / Band / Choruscustom-pagetrophies-music1trophies498551-311821.06TrophyCentraltrophies1Music / Band / Choruscustom-pagecustommedals50"Standard Service: 8 Business Days from Receipt of Artwork, Rush Service (Extra Charge): 3 Business Days from Receipt of Artwork" "Oxnard, CA" "UPS (FedEx available on request)"medals930335-1010.630033.6Simba Calaward-medalsMusic, Drama, Art, Dance1:22%,300:40%,500:51%,1000:54%"Music Medals" "Music Awards" "Band Awards"These 2 1/2 inch custom Music Medals come with an outer-ring which allows you to add your school or league name, date and location.qcm-20Music / Band / Choruscustom-pagetrophies-music1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451623.65Quick TrophyTrophiesMusic, Drama, Art, Dance1:14%,10:18%,50:24%,100:28% "Music Trophy"These quick-ship trophies from TrophyCentral feature a Music figure, real marble base and marble trophy figure platform, choice of column size and color.qtmusicdmMusic / Band / Choruscustom-pagemusicartpins1plasticpinboxvelapinbox1"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsMusic, Drama, Art, Dance1:30%,50:34%,100:38%"Music Lapel Pins" "Band Lapel Pins" "Band Awards" "School Pins"Find this Music Excellence pin discounted at TrophyCentral. Music Excellence and other lapel pins ship in just 1-2 business days!br572Music / Band / Choruscustom-pagekeychains21105502-40.39125035.39Classic MedallicsGiftsKeychains1:22%,10:25%,25:32%,50:39%,100:47%Find these popular Pewter Music G-Clef Key Chains at TrophyCentral; discounted prices!pk99-cmKeychainscustom-pagetrophies-music12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105502-41130025Classic MedallicsInsertsMusic, Drama, Art, Dance1:22%"Award Medals" "Art / Dance / Drama Medals" "Award Medals - All Subjects" "Music Awards"Buy these quality Music GENERAL Inserts (Litho) at TrophyCentral. Each Music GENERAL Insert can be used to create a unique plaque, medal or trophy.507394Music / Band / Chorus
custom-pagetrophies-music1trophies498552-311218.84TrophiesMusic, Drama, Art, Dance1Find this unique cup trophy with Music figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-music-scbMusic / Band / Choruscustom-pagetrophies-music1trophies498551-310.71217.38trophies1Music / Band / Choruscustom-pagemusicartpins1plastic-pinbox-t1498551-30.5200040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find this Music Gold Enamel lapel pin discounted at TrophyCentral. Features a clutch-pin back for easy attachment to clothing.. Fast 1-2 day shipping.music-u-pbMusic / Band / Choruscustom-pagetrophies-music1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Music Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Music / Band / Choruscustom-pagetrophies-music1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.418Quick TrophyTrophiesMusic, Drama, Art, Dance1:14%,3:19%,10:24%"Music Trophies" "Music Trophy"Find these fabulous two-tier, 3-column champion Music Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtmusic3cMusic / Band / Choruscustom-pagetrophies-music1medals498552-30.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Colorful Music insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Music / Band / Choruscustom-pagetrophies-music1medals498552-40.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Music insert medal With A Personalized Front Rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Music / Band / Choruscustom-pagecherry-insert-plaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these music insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Music / Band / Choruscustom-pagetrophies-music12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105502-41130025Classic MedallicsInsertsMusic, Drama, Art, Dance1:22%"Award Medals" "Art / Dance / Drama Medals" "Award Medals - All Subjects" "Music Awards"Buy these quality Music Jazz Inserts (Litho) at TrophyCentral. Each Music Jazz Insert can be used to create a unique plaque, medal or trophy.50447105-27-2011Music / Band / Chorus
custom-pagetrophies-music20medals498551-30.5100021TrophyCentralInsertsSports, Hobby, Org, Livestock1Find this colorful Music Lyre 2" Epoxy-covered insert discounted at TrophyCentral. Fast 1-2 day shipping.Music / Band / Choruscustom-pagetrophies-music1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Music Lyre Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Music / Band / Choruscustom-pagetrophies-music1trophies498551-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Music Lyre insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Music / Band / Choruscustom-pagetrophies-music1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Music Lyre single column insert trophy features a choice of column color, a marble base and free trophy engraving.Music / Band / Choruscustom-pagetrophies-music50"4-6 business days" "Mount Vernon, NY" "UPS"medals105502-50.75130033.75Classic Medallicsaward-medalsMusic, Drama, Art, Dance1:22%,100:33%,300:41%"Music Medals"Find these fabulous Personalized Music Lyre Front Imprint Medals at TrophyCentral. Price includes the name of your school or organization imprinted on the front of the medal!m161Music / Band / Choruscustom-pagetrophies-music1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Music Lyre Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Music / Band / Choruscustom-pagetrophies-music1medals498551-30.525035.5TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find this colorful Music Lyre insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Music / Band / Choruscustom-pagetrophies-music1medals498551-30.525035.5TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find this Music Lyre insert medal with a personalized front rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Music / Band / Choruscustom-pagetrophies-music1plaques498551-311.11623.5TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these music lyre insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Music / Band / Choruscustom-pagemusicartpins1plasticpinboxvelapinbox151-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsMusic, Drama, Art, Dance1:30%,50:36%,100:39%,500:42%,1000:48%"Music Lapel Pins" "Band Lapel Pins" "Band Awards" "School Pins"Find this fabulous Music Lyre Lapel letter pin at TrophyCentralcl2806-22-2012Music / Band / Chorus
custom-pagetrophies-music12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105502-41130025Classic MedallicsInsertsMusic, Drama, Art, Dance1:22%"Award Medals" "Art / Dance / Drama Medals" "Award Medals - All Subjects" "Music Awards"Buy these quality Music Lyre Inserts (Litho) at TrophyCentral. Each Music Lyre Insert can be used to create a unique plaque, medal or trophy.50495106-25-2012Music / Band / Chorus
custom-pagetrophies-music12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105502-40.3713003.37Classic MedallicsInsertsMusic, Drama, Art, Dance1:22%"Award Medals" "Art / Dance / Drama Medals" "Award Medals - All Subjects" "Music Awards" "Music Medals"Buy these quality Mylar Music Lyre Decal Inserts at TrophyCentral. Each Music Lyre Decal can be used to create a unique plaque, medal or trophy.489768Music / Band / Chorus
custom-pagetrophies-music1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our music lyre insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Music / Band / Choruscustom-pagetrophies-music1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Music Lyre Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Music / Band / Chorusacademic-general-medals1award-medals1Music medals in a variety of designs including musical notes and instruments. Each music medal includes a free ribbon and is a great way to recognize music students and musicians of all kinds.trophies-musicShop for Music Award Medals with Ease at TrophyCentral!

Celebrate musical excellence with our high-quality music medals and awards. Whether you are recognizing top performers in a school band, choir competition, or music festival, we have the perfect medal for every occasion.

Why Choose Our Music Medals?

  • 🏆 High-Quality, Exclusive Designs:
  • 🎼 Custom Engraving: Personalize your medal for a special touch
  • 🚚 Fast Shipping: Quick processing times to ensure you receive your awards on time.
If you need more information before deciding, see our expert resource section: Also see: ]]>
music-award-certificates
custom-pagetrophies-music1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Music insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - MusicMusic / Band / Choruscustom-pagetrophies-music1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453633.4Quick TrophyTrophiesMusic, Drama, Art, Dance1:14%,10:17%,25:23%,50:29%,100:34%"Music Trophies" "Music Trophy" "Band Awards"Our popular music participation trophies feature a real slant-front marble base and free engraving. Fast 1-2 day shipping.qtmusicncReturn to oursection for our complete selection of awards.trophies-musicMusic / Band / Choruscustom-pagetrophies-music1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.4234Quick TrophyTrophies1:14%,3:15%,10:16%"Music Awards" "Music Trophies" "Band Awards"Find this Perpetual Music Trophy Discounted at TrophyCentral. Each Trophy has enough room for 32 names. Ships in just 1-2 days.qtmusicperpMusic / Band / Choruscustom-pagetrophies-music12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105502-41130025Classic MedallicsInsertsMusic, Drama, Art, Dance1:22%"Award Medals" "Art / Dance / Drama Medals" "Award Medals - All Subjects" "Music Awards"Buy these quality Music Piano Inserts (Litho) at TrophyCentral. Each Music Piano Insert can be used to create a unique plaque, medal or trophy.504941Music / Band / Chorus
custom-pagetrophies-musicmp2mp3mp4mp6mp7mp8mp10mp5mp9mp11mp22mp13mp12mp14mp151lapel-award-pins1"Music Awards" "Art Awards" "School Awards" "Lapel Pins" "High School Awards" "Awards For School" "Elementary School Awards" "Middle School Awards" "School Academic Awards" "Awards For Elementary School" "Awards for Middle School" "Awards for High School" "End of School Year Awards" "High School Academic Awards" "High School Awards Ceremony"Find a great selection of discounted music pins at Trophy Central. Each music pin features a clutch-back for safe attachment to clothing.

Music Pins - Band Pins, Choir Pins, and Instrument Awards for Student Recognition

Music pins are among the most practical and consistently appreciated forms of student recognition in school music programs because they are small enough to be affordable for large ensembles, personal enough that students wear them with pride on concert attire and instrument cases, and specific enough that a clef pin, lyre pin, or instrument-specific design immediately communicates the musical context of the achievement being honored. Our music pin collection covers the full range of school music recognition needs, from general excellence and achievement pins suited for any music program to clef and lyre designs that carry the traditional visual language of choral and orchestral recognition, to instrument-specific pins that honor students in the exact musical voice they have developed. Each pin features a secure clutch back that attaches safely to blazers, choir robes, band uniforms, lanyards, and instrument cases without damaging fabric, and volume pricing makes it practical for music directors and booster organizations to present a pin to every student in the ensemble at end of year concerts, regional festivals, and awards ceremonies.

Frequently Asked Questions About Music Pins

What music pin styles work best for different school music programs?

General music and excellence pins work well for programs that want a single consistent design presented to all students regardless of their specific instrument or ensemble, making them the practical choice for mixed awards ceremonies where band, orchestra, and choir students are all recognized together. Clef pins are the traditional recognition choice for choral programs, with the treble clef and bass clef designs immediately communicating the vocal music context in a way that general achievement pins cannot. Lyre pins carry strong associations with marching band and concert band traditions, making them the standard recognition pin in many band programs that have presented lyre pins to students for generations. Instrument-specific pins honor the student's particular musical voice directly, with designs available for brass, woodwind, string, and percussion instruments that celebrate the individual instrument as much as the overall musical achievement. Programs looking to build a recognition hierarchy often use general excellence pins for broad participation recognition and instrument-specific or clef pins for students earning individual honors, creating a visual distinction that motivates students to pursue the more distinctive award. Music booster organizations frequently purchase pins in volume for end of year concerts, all-state selection recognition, solo and ensemble contest awards, and senior recognition nights where the pin serves as a lasting wearable keepsake from a meaningful musical milestone.

What occasions are music pins most commonly presented?

End of year concerts and awards ceremonies are the most common occasion for music pin presentation, where directors recognize students who completed the full year of ensemble participation or achieved specific musical milestones during the program. All-state and all-district ensemble selection is one of the most meaningful occasions for a music pin gift, as making an all-state band, orchestra, or choir represents a significant competitive achievement that a wearable pin commemorates in a way the student can display on their instrument case for years. Solo and ensemble contest recognition uses pins to honor students who earned superior or excellent ratings, with the pin serving as a tangible reward for the weeks of individual preparation that contest performance requires. Senior recognition programs present music pins as part of a broader acknowledgment of four years of ensemble participation, often alongside a certificate or letter that documents the student's complete music program history. First chair and section leader recognition, marching band leadership awards, pit orchestra honors, and jazz ensemble recognition are additional occasions where a specific pin design communicates the particular achievement more effectively than a generic award. Middle school programs transitioning students from beginner to intermediate level use music pins as milestone markers that build enthusiasm for continued participation in high school music programs.

How do music pins compare to music trophies and medals for student recognition?

Music pins, trophies, and medals each serve different purposes within a school music recognition program, and the most effective programs use all three formats at different levels and occasions rather than treating them as interchangeable alternatives. Pins are the right choice when the goal is affordable, wearable recognition that students carry with them daily and display on concert attire, instrument cases, and lanyards where the pin remains visible throughout the school year. They are particularly well suited for broad ensemble recognition where every student in a large band or choir receives an award, since the per-unit cost makes it practical to honor every participant meaningfully. Music medals with neck ribbons suit competitive contexts such as solo and ensemble festivals, regional competitions, and adjudicated events where an immediately wearable award presented at the conclusion of the performance has ceremonial impact that matches the competitive setting. Music trophies are the strongest choice for top individual honors, music program awards, director recognition, and end of year banquet recognition where a standing award displayed at home or in a music classroom carries more weight than a pin or medal. Many programs layer all three formats within a single recognition year, presenting pins to all ensemble participants, medals to competition achievers, and trophies to outstanding soloists, section leaders, and music program award recipients, creating a complete recognition system that motivates students at every level. See our complete collection of music trophies and awards for all available recognition options that pair well with music pins.

If you need more information before deciding, see our expert resource section:
]]>
star-pins trophies-music
custom-pagewalnut-insert-plaques1"3-6 business days with engraving, Without engraving: 1-3 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"plaques105503-610.4511222.05Classic MedallicsPlaquesInsert1:22%,3:23%,5:24%Genuine Walnut Music Plaque with 2 Inch Insert and Free Engraving.49-7664Music / Band / Choruscustom-pagetrophies-music1plaques498552-41JDSPlaques1Find this music plaque discounted at TrophyCentral. Our music plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Music / Band / Choruscustom-pagemusicartpins1plastic-pinbox-t5lapel pins498551-20.550040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find this Music Gold Enamel lapel pin discounted at TrophyCentral. Features a clutch-pin back for easy attachment to clothing.. Fast 1-2 day shipping.music-u-pbMusic / Band / Choruscustom-pagetrophies-music1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Music Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Music / Band / Choruscustom-pagetrophies-music1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-30.38150030Quick TrophyDog TagsMusic, Drama, Art, Dance1:14%,10:15%Find these music dog tags discounted at TrophyCentral. The price of each music dog tag includes custom engraving and chain!qtdogmuscMusic / Band / Choruscustom-pagetrophies-music11Creative music award ideas with engraving examples for bands, choirs, and music programs. From Maestro in Training to Practice Room Champion, discover 15+ unique ways to recognize musicians with actual trophy wording templates.custom-pagemascotpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:30%,100:33%,500:47%"Mascot Awards" "Mascot Pins"Find these Mustang Lapel Pins and other colorful mascot pins at TrophyCentral. Fast 1-2 day shipping!em0811-20-2013Mascotcustom-pagemascotpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:36%,100:46%,500:52%"Mascot Awards"Find These Mustang Lapel Pins with Antique Finish Discounted at TrophyCentral! Also See Our Other Fabulous School Mascot Pins. Fast 1-2 Day Shipping!pm24Mascotcustom-pagemascot-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Mustang Mascot Badges Discounted At TrophyCentral.mascotbadges-mustangcustom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceCertificates / CoversEmbosser Seals1:22%,3:28%,5:31%Find these Mustang Certificate Seals discounted at TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.803mstgMascotcustom-pagemascot-plaques1plaques498552-41JDSPlaques1Find this mustang plaque discounted at TrophyCentral. Our mustang mascot plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Mascotcustom-pagemascottrophies1"4-6 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511016.25Classic MedallicsTrophiesAcademic1:22%,5:24%,10:28%,50:32%"Mascot Awards"Buy this Mustang mascot trophy and other mascot awards at TrophyCentral.mt201204-01-2018Mascotcustom-pagemascotinserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsMascots1Buy these quality Mustangs Mascot Medal Inserts at TrophyCentral. Each Mustangs Insert can be used to create a unique plaque, medal or trophy.489945Mascot
custom-pagemvp-medals1trophies498551-30.5100021TrophyCentralInsertsSports, Hobby, Org, Livestock1Find this colorful MVP 2" Epoxy-covered insert sticker discounted at TrophyCentral. Fast 1-2 day shipping.MVP, Sportscustom-pagemvp-medals1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these MVP Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.MVP, Sportscustom-pagemvp-trophies1trophies498551-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a MVP insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.MVP, Sportscustom-pagemvp-trophies1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our MVP single column insert trophy features a choice of column color, a marble base and free trophy engraving.MVP, Sportscustom-pagemvp-trophies1trophies498551-311821.06TrophyCentraltrophies1MVP, Sportscustom-pagemvp-trophies1trophies498551-310.71217.38trophies1MVP, Sportscustom-pagemvp-medals1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these MVP Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.MVP, Sportscustom-pagemvp-medals1medals498551-30.525035.5TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find this colorful MVP insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Most Improvedcustom-pagemvp-medals1medals498551-30.525035.5TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find this MVP insert medal with a personalized front rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Most Improvedcustom-pagemvp-trophies1plaques498551-311.1Plaques1Find this MVP insert plaque discounted at trophyCentral. Price includes free engraving. Fast 1-2 day shipping.MVP, Sportscustom-pagemvp-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Sports Medals"Your athletes will love these colorful Mylar MVP Medals from TrophyCentral. Each MVP medal includes a neck ribbon!tm9965gSports
custom-pagemvp-trophiesmvp-jigfmvp-jisfmvp-jibfmvp-mcmvp-mc-prtm9965g11Find MVP medals discounted at TrophyCentral. Each medal features a free neck ribbon. Browse our most valuable player medals now!mvp-trophies all-star-trophiescustom-pagemvp-trophies1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our MVP insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.MVP, Sportscustom-pagemvp-medals1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these MVP Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.MVP, Sportscustom-pageaward-medalsmvp-part-imvp-single-imvp-champ-imvp-e-part-imvp-e-single-imvp-plaque-icup-mvp-scb-icup-mvp-in1achievement-trophies-awards1Find MVP trophies discounted at TrophyCentral. Each MVP trophy features 3 lines of personalization. Fast 1-2 day shipping.

MVP Trophies - Most Valuable Player Awards for Every Sport and Season

MVP trophies recognize the single most impactful player on a team across an entire season, making the Most Valuable Player award one of the most coveted individual honors in any sport at any level. Where participation trophies acknowledge effort and position awards recognize specific roles, the MVP trophy declares that one player elevated their team's performance above what any other individual contributed, earning recognition from coaches and teammates alike. Our MVP trophy collection features sport-specific figurine designs for football, soccer, basketball, baseball, softball, volleyball, and more alongside general MVP designs suited for any sport or team competition, in a range of sizes from affordable youth league MVP trophies to impressive premium pieces appropriate for the most competitive programs. Every MVP trophy includes free engraving personalized with player name, MVP title, team name, sport or league, and season year so the award documents the specific achievement with the detail it deserves.

Frequently Asked Questions About MVP Trophies

What size MVP trophy is appropriate for different programs and age groups?

MVP trophy size should reflect both the age of the recipient and the significance of the award within the program's overall recognition structure. Youth recreational league MVP trophies for players under 10 years old are well served by 12-inch to 15-inch single column trophies that stand noticeably larger than the participation trophies distributed to other players, communicating that the MVP is a special individual honor without requiring a large per-trophy budget. Travel team and competitive youth league MVP awards for players aged 10 to 14 warrant 15-inch to 18-inch premium trophies that carry genuine visual weight and serve as a true season highlight award the recipient will display with pride for years. High school and adult league MVP trophies deserve 18-inch to 24-inch pieces that match the prestige of the title within a fully competitive program where every player on the roster understood what the MVP award represented throughout the season. The most important principle is that the MVP trophy should be visibly and meaningfully larger than any other individual award distributed at the same ceremony, since the visual distinction between the MVP trophy and other awards communicates to every player in the room that the MVP honor is the highest individual recognition the program offers.

What should MVP trophy engraving include?

MVP trophy engraving should capture the full context of the award so the trophy remains a meaningful keepsake as the player moves through their athletic career. Essential elements include player name, award title, team name, sport or league, and season year. For example: Marcus Johnson, Most Valuable Player, River City Rockets, Metro Youth Basketball League, 2025, or Sofia Martinez, Team MVP, Westside FC, Girls U14 Travel Soccer, Fall 2025. Statistical highlights add powerful context when space allows, such as 24 Goals, 12 Assists or .412 Batting Average, anchoring the MVP recognition to a specific performance record rather than a generic title. Coach or program acknowledgment adds a personal element that MVP recipients appreciate years later, noting the head coach name alongside the award communicates that the recognition came from a specific person who observed the player throughout the season. For programs that present both an offensive MVP and a defensive MVP, noting the specific distinction in the award title ensures each trophy documents the correct achievement.

How should the MVP trophy fit into a complete team award program?

The MVP trophy works most effectively as the top individual honor within a layered award structure that recognizes multiple players for different contributions rather than presenting only a single award at the end of season banquet. A complete team award program typically presents the MVP trophy as the clear centerpiece individual award, supported by category awards for most improved player, best defensive player, best sportsmanship, and coaches award that allow the program to recognize several players beyond the single MVP selection. This structure ensures that every player who made a meaningful contribution to the team's season has an opportunity to be recognized, while preserving the MVP as the most prestigious individual honor in the program. Programs concerned about the social dynamics of selecting a single MVP in youth recreational settings can present offensive and defensive MVP awards separately, or frame the award as a coaches award selected at the coach's discretion, which distributes the recognition more broadly without diminishing the significance of the title for the players who receive it. See our complete collections of trophies and awards and achievement trophies for all individual award styles that complement the MVP trophy in a complete end of season program.

If you need more information before deciding, see our expert resource section:
]]>
mvp-medals all-star-medals
custom-pagetrophies-bowling12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Mylar Bowling Inserts Medal Decal Inserts at TrophyCentral. Each Mylar Bowling Inserts Medal Decal can be used to create a unique plaque, medal or trophy.48969003-21-2014Bowling
custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Mylar Softball Decal Inserts at TrophyCentral. Each decal can be used to create a unique plaque, medal or trophy.489634Softball, Sports
custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Swimming Awards"Buy these quality Mylar Swimming Medal Decal Inserts at TrophyCentral. Each decal can be used to create a unique plaque, medal or trophy.489645Swimming / Diving, Sports
custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Mylar Wrestling Decal Inserts at TrophyCentral. Each wrestling decal can be used to create a unique plaque, medal or trophy.489623Wrestling, Sports
custom-pagetrophies-music102-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.5115014Classic Medallicsaward-medalsAcademic1:22%,25:24%,50:30%,100:36%,500:42%"School Medals" "School Award Medals" "Scholastic Medals" "Scholastic Award Medals" "Academic Medals" "Academic Award Medals" "Medals, School"Your students will love these colorful Mylar Music Medals from TrophyCentral. Each Mylar Music medal includes a neck ribbon!tm9768Music / Band / Chorus
custom-pageglass-crystal-awards1"14 business days" "Erlanger, KY" "UPS"general410187-1010.451 2 3 4 5 6 7 8 9438.45JcharlesGeneral Awards1:22%,25:24%Find these Mythic Recognition Awards at TrophyCentral. See all of TrophyCentral's Awards and Personalized Gifts.custom-pageletter-shaped-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find these popular N-shaped custom mascot badges at TrophyCentral. Great for fundraising! TrophyCentral is a top-rated Yahoo merchant.letterbadges-ncustom-pageindexplasennambadnamebadges1etsatbrasnametluggolbagt1index1"Engraving"Shop custom name badges and name tags for employees, schools, and events. Engraved and printed options with fast turnaround and professional quality.

Custom Name Badges and Tags - Professional Identity for Every Setting

Custom name badges create a professional, approachable environment wherever people need to be identified quickly and clearly. From retail and hospitality businesses where staff badges reinforce brand identity and make every customer interaction more personal, to schools and universities where faculty, staff, and student organization members need clear identification, from conferences and trade shows where attendee badges facilitate networking and professional connection, to nonprofit organizations, volunteer programs, and community events where a well-made badge signals credibility and belonging, quality name badges make an immediate impression that a handwritten tag or blank lanyard never can. Our selection includes plastic name badges in gold and silver finishes for everyday professional wear, full-color printed badges for organizations that want photo-quality branding and logos, brass name tags with a premium engraved finish suited to executive and upscale retail settings, personalized luggage and golf bag tags for a practical branded keepsake, and custom-shaped badges for organizations that want a distinctive silhouette. We engrave in-house on FlexiBrass, aluminum, and acrylic laminates using the same equipment and expertise behind our trophy and plaque production since 1999.

Frequently Asked Questions About Name Badges

What materials are available for name badges and tags?

Our name badges are available in plastic laminate, full-color printed stock, brass, and aluminum. Plastic badges in gold and silver finishes are the most popular choice for everyday staff and organizational use, offering durability at an affordable price. Full-color printed badges allow photo-quality logos, photos, and branding. Brass name tags provide a premium engraved appearance well suited to executive, legal, medical, and upscale retail environments. The most common engraving material is FlexiBrass, similar to mylar but more durable, which produces crisp, permanent engraved text ideal for names and titles.

What details should a name badge include?

Most name badges include first name or full name, job title or role, and organization or company name. For events and conferences, adding a department, session track, or attendee category helps people connect more meaningfully. Badges for schools and universities often include the academic department or student organization. Keep text concise so names remain readable at a glance, and prioritize the most important identifier when badge size limits your options. For inspiration on wording, see our personalization guide.

Can I add a logo to a name badge?

Yes. Full-color printed badges support high-resolution logos, photos, and brand colors, making them ideal for businesses and organizations that want consistent visual branding across their entire staff. Engraved badges can also incorporate logos when provided in a compatible vector format. Contact us before ordering if logo placement is important and we can confirm which badge styles support your artwork. For more on personalization options, see our Engraving FAQs.

If you need more information before deciding, see our expert resource section:
]]>
name-desk-signs1tagsbadges1Find name badges discounted at TrophyCentral. Each name badge features beautiful custom engraving.

Uniform & Name Tags Your Employees Will Love!

Each badge & tag above features free text engraving. You can even add a logo to improve your brand image! Many also offer a choice of size, color and lettering. Choose from a pin or magnet back.

Shop Online with Ease at TrophyCentral

If you need help with a design, our experts in Michigan and New York would be thrilled to assist you. They have been serving happy customers since 1999!


]]>
name-desk-signs
custom-pageribbons-neck-drapejumpringshofordrri10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"ribbons105502-30.3612006.36Classic Medallicsribbons1:22%,100:29%,500:36%See all of ourin a variety of styles.Red White Blue, Patrioticcustom-pageracingdisplays1"7-10 business days w/Logo, 4-6 without" "Apopka, FL 32712" "UPS (FedEx available on request)"327765-101 3 22 23118Perfect CaseDisplay Cases11:14%,5:20%Nascar 1/24th Glass Display Cases from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality National Guard Inserts at TrophyCentral. Each National Guard Insert can be used to create a unique plaque, medal or trophy.514032Military, Hero, National Guard
11custom-pagemascot-plaques1plaques498552-41JDSPlaques1Find this Native American plaque discounted at TrophyCentral. Our mascot plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Mascotcustom-pageeagle-trophies1"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"trophies458221510.45639.45Vision AwardsTrophies1:22%,26:33%Find The Natural Leadership Eagle Award Discounted At TrophyCentral. Available In 3 Sizes; Price Includes Engraving!1001custom-pagetrophies-military-hero1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511230.45Classic MedallicsTrophiesHero1:22%,6:23%,12:24%,24:26%"Hero Awards"Shop for Cast Stone Navy Emblem Awards at TrophyCentral. We have a great selection of Navy Emblem and other recognition trophies at discounted prices.tr9931Military, Navy, Herocustom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality Navy Recruiting Command Inserts at TrophyCentral. Each Navy Recruiting Command Insert can be used to create a unique plaque, medal or trophy.512721Military, Hero, Navy
custom-pageaward-ribbons-rosettesnecrib30x78necrib30x138draprib138x1jumpringshofordrri11Find neck ribbons and drape ribbons for award medals discounted at TrophyCentral. Choose from many colors and sizes. Fast 1-2 day shipping.custom-pagebadgeribbonsholders1"7-10 business days from receipt of camera-ready artwork" "City of Industry, CA" "UPS (FedEx available on request)"917457-10146022.6BNRibbonsBadge Holders1nw-3633nblcustom-pagebadgeribbonsholders1"7-10 business days from receipt of camera-ready artwork" "City of Industry, CA" "UPS (FedEx available on request)"ribbons917457-10146022.6BNRibbonsBadge Holders1custom-page11custom-pagecrystalgifts1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"general410187-1010.45436.45JcharlesCrystal AwardsClocks1:22%,25:24%"crystal awards" "sales awards" "service awards" "corporate sales awards" "corporate service awards" "sales award" "service award" "corporate sales award" "corporate service award" "Desk Clocks" "Retirement Awards" "Retirement Plaques, Awards and Gifts"Neo-Metro Clock from TrophyCentral. See our great selection of engraved and personalized gifts!60611custom-pagemedallion-inserts-government-agencies-and-logos12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%"Award Medals" "Award Medals - All Subjects" "Medals - All Others"Buy these high-quality New York City Seal Inserts at TrophyCentral. Each New York City Seal Insert can be used to create a unique plaque, medal or trophy.517635General
custom-pageindexmotocross-cup-place-trophyskeet-shooting-cup-place-trophycamaro-cup-place-trophychevy-cup-place-trophypick-up-truck-cup-place-trophysheep-cup-place-trophystreet-rod-cup-place-trophytractor-cup-place-trophyweightlifting-cup-place-trophymotocross-cup-place-column-trophyskeet-shooting-cup-place-column-trophycamaro-cup-place-column-trophychevy-cup-place-column-trophypick-up-truck-cup-place-column-trophystreet-rod-cup-place-column-trophytractor-cup-place-column-trophyweightlifting-cup-place-column-trophy111custom-pageghent-new-mobile-boards1Bulletin Boards4512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Nexus Easel+, Mobile 2-Sided Porcelain Magnetic Whiteboard with Tablet Storage, 39"H x 26"W discounted at TrophyCentral.Mobile, Easelcustom-pageghent-new-mobile-boards1Bulletin Boards4512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Nexus Easel, Mobile 2-Sided Porcelain Magnetic Whiteboard, 46"H x 34"W discounted at TrophyCentral.Mobile, Easelcustom-pageghent-new-mobile-boards1Bulletin Boards4512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Nexus IdeaWall, Mobile 2-Sided Porcelain Magnetic Whiteboard, 46"H x 70"W discounted at TrophyCentral.Mobile, Easelcustom-pagegifts-desk-general11personalized gifts105502-410.5217210.6Classic MedallicsGiftsGeneral Gifts1:22%,10:20%Shop for Nickel Plated Money Clip from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.Walletscustom-pagecrystalgifts1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"personalized gifts410187-1010.45525.45JcharlesGiftsCrystal Gifts1:22%,100:23%"personalized gifts"Find these fabulous Custom Clocks discounted at TrophyCentral. TrophyCentral is known for its top-rated customer serviceCrystal Gifts1]]>1custom-pageteacher-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"Find these No Child Left Behind pins discounted at TrophyCentral. Lapel pins feature a high quality finish and clutch back, Fast 1-2 day shipping.br531General, Academic, Academiccustom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-411130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these high-quality No Child Left Behind Inserts at TrophyCentral. Each No Child Left Behind Insert can be used to create a unique plaque, medal or trophy.518482General, Academic, Academic
custom-pagerlogonov-13podium-artworkartworkstocksportgraphicsmonarch-basesmmp-norwichsponsoredbytctrophyfigure2trophycentral-reviews-allsatisfactionembosser-logostrophyfigures1podium-shippingartworkhelpleatherhelpdisplaycase-shippingaugustacolorsgildan2000colorsbadge-holder-popupengravinghtrophycentral-reviewsplaque-proofminutemanmmp-sl-forestindlogopressclicherforlo9test1clicherforlo8art-workcltoenstlopicorporate-awards-artprintexamplesclicherforpi10boxsampleseconribbonnotchcornerstm-series-medalsmedals-tm-seriestm-sports-medalstestimonialsshipping-estimateenbabate-medals-allplasticpinbox1notchcorners1clicherforlo11clicherforlo11templateship-countdownconfidenceunique-copyquickshiptrophies-boccesplitrinkeycvelboxclicon1cliconpictoe61]]>11custom-pagescholarship-resource-hub11Nomination letter templates for teachers recognizing students for scholarships and awards. Includes ready-to-use formats for academic achievement, leadership and more!noindexed-items12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
498555-8.521
noindexed-items12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
498555-8.521
custom-pagefloating-plaques1"14 business days" "Erlanger, KY" "UPS"plaques410187-1010.451 2 3 4 5 6 7 8 9416.45JcharlesGeneral Awards1:22%,25:25%Find the Nova Plaque at TrophyCentral. Nova Plaques include free engraving.custom-pagequickshiptrophies-fireman1plaques498552-41JDSPlaques1Find this nurse plaque discounted at TrophyCentral. Our nurse plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Military / Herocustom-pagemedallion-inserts-occupational-subjects12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-410.311500240.3Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these high-quality Nurses Caduceus Inserts at TrophyCentral. Each Nurses Caduceus Insert can be used to create a unique plaque, medal or trophy.515873
custom-pagebr6421personalized gifts105502-40.39125035.39Classic MedallicsGiftsKeychains1:22%,10:25%,25:32%,50:39%,100:47%Find these popular Pewter Nurses Care Key Chains at TrophyCentral; discounted prices!pk89-cmKeychainscustom-pagegold-pins-lapelplasticpinboxvelapinbox10105502-30.31150030.3Classic Medallicslapel-award-pins11:22%,50:30%,100:33%,500:47%Find These Nurses Care Pins Discounted at TrophyCentral. Each Nurses Care Pin Features a Clutch-Back. Fast 1-2 Day Shipping!Nurse-CareOccupations, Nursingcustom-pagegold-pins-lapelplasticpinboxvelapinbox10br645 pk89-cm105502-30.31150030.3Classic Medallicslapel-award-pins11:22%,50:30%,100:33%,500:47%Find Nursing Pins discounted at TrophyCentral. Each Nursing Lapel Pin features a qualify gold finish and clutch-back. Fast 1-2 day shipping!RN-Nurses-PinOccupations, Nursingcustom-pagefreeawardcertificates1"Download Only"certificates49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Nursing Award template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Nursing-Award-Certificatenursing-freeNursing, Herocustom-pageletter-shaped-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find these popular O-shaped custom mascot badges at TrophyCentral. Great for fundraising! TrophyCentral is a top-rated Yahoo merchant.letterbadges-ocustom-pageperplaq1"4-6 business days "Marquette, MI" "UPS"perpetual plaques498553-610.45315.15JDS-TCPlaquesPerpetual Plaques1:22%"New Products"This perpetual name plaque boosts an Oak finish and 12 nameplates and is perfect for employee, athlete or student recognition. The price of the perpetual plaque includes engraving for the top plate and one nameplate.opp1209-06-2014Perpetual, Name Platecustom-pageperplaq1"4-6 business days "Marquette, MI" "UPS"perpetual plaques498553-610.45318.45JDS-SPlaquesPerpetual Plaques1:22%"New Products"Find this Oak Perpetual Nameplate Plaque (18 Plates)Discounted at TrophyCentral. Each Trophy has enough room for 32 names. Ships in just 1-2 days.opp1809-06-2014Perpetual, Name Platecustom-pageperplaq1"4-6 business days "Marquette, MI" "UPS"perpetual plaques498553-610.45321.45JDS-SPlaquesPerpetual Plaques1:22%"New Products"This perpetual name plaque boosts an Oak finish and 24 nameplates and is perfect for employee, athlete or student recognition. The price of the perpetual plaque includes engraving for the top plate and one nameplate.opp2409-06-2014Perpetual, Name Platecustom-pageacrylicawards11"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"general105503-610.451515.45Classic MedallicsCrystal Awards1:30%Shop for Obelisk Acrylic Awards at TrophyCentral; Available in multiple styles.ac26706-15-2012custom-pagecrystalgifts6"7-10 business days" "Kentucky" "UPS (FedEx available on request)"personalized gifts410187-1010.451616.45JcharlesGiftsCrystal Gifts1:22%,100:0%"personalized gifts"Oblique Crystal Card Holders from TrophyCentral. See our great selection of engraved and personalized gifts!64Crystal Giftscustom-pagemusicartpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsMusic, Drama, Art, Dance1:22%,50:30%,100:33%,500:45%"Music Lapel Pins" "Band Lapel Pins" "Music Pins"Find These Oboe Lapel Pins Discounted at TrophyCentral. Features a Clutch-Pin Back and Fast 1-2 Day Shipping!mp3Music / Band / Choruscustom-pageinserts1culinary-ei504301517852507249518634501654518545499195011714984035185625187785014915178355158734898624934015181975066914915095140934957595185615135515170841inserts11Browse our selection of occupation subject inserts. Each 2" insert fits in a medal frame, trophy or plaque.occupation trophies, occupation trophy, occupation awards, occupation trophies and awards1inserts1custom-pagebaseballdisplay11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.5119.5Perfect CaseDisplay Cases11:14%,5:19%Octagon Batting Helmet Glass Display Cases from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.Baseball / T-Ball, Sportscustom-pagefootballdisplay11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.5116.5Perfect CaseDisplay Cases11:14%,5:19%Octagon Glass Football Display Case. Ideal for leagues, schools, and tournaments. Fast shipping.10-16-2017Football, Sportscustom-pagefootballdisplay11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.5119.5Perfect CaseDisplay Cases11:14%,5:19%Octagon Glass Football Helmet Display Case. Ideal for leagues, schools, and tournaments. Fast shipping.Football, Sportscustom-pagebaseballdisplay11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.5116.5Perfect CaseDisplay Cases11:14%,5:19%Octagon Glove Glass Display Cases from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.Baseball / T-Ball, Sportscustom-pageofficesigns1"9-12 business days" "Roanoke, Virginia" "UPS (FedEx available on request)"240169-1210.465025.46RoanokeOffice Signs1Find Custom Wall Signs Discounted at TrophyCentral. Wall Signs and Door Signs Include Engraving and Ship In Just a Few Days.custom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceCertificates / CoversEmbosser Seals1:22%,3:28%,5:31%Find these "Official Seal" Certificate Seals discounted at TrophyCentral. Available in rolls of 100. Fast 1-2 day shipping.803osMascotcustom-pagetrophies-cheerleading-spirit12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,50:28%,100:34%,500:41%"Award Medals - All Subjects" "Sports Medals" "Cheer Awards" "Cheerleading Awards" "Cheerleader Awards" "Cheerlading Medals"j9643See more greatin a large variety of styles and finishes.cheerleadingmedalsCheerleading, Sports
custom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.5115014Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,50:28%,100:34%,500:41%"Award Medals - All Subjects" "Sports Medals" "Track Medals"Find our Female Track Events 2" Olympic-Style J-Series Medals at a super price point at TrophyCentral. Large quantity discounts available!j9683
custom-pagetrophies-track-field1j96652-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.5115014Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,50:28%,100:34%,500:41%"Award Medals - All Subjects" "Sports Medals" "Track Medals"Find our Male Track Events 2" Olympic-Style J-Series Medals at a super price point at TrophyCentral. Large quantity discounts available!j967206-26-2009
11Check out this great Olympics infographic. Add some fun to your next awards ceremony by sharing these fun facts about the Olympics.custom-pageglobal-crystal-awards1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"general410187-1010.454100.45JcharlesCrystal Awards1:22%,25:24%"crystal awards" "sales awards" "service awards" "corporate sales awards" "corporate service awards" "sales award" "service award" "corporate sales award" "corporate service award"Find the Omni Globe and other Awards at TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.400Leadershipcustom-page1105091-311 2 3 4 5 6 7 8 91:0%One-Time Setup Charge: Visit TrophyCentral to see this and similar Trophies and Awards1111custom-pageglass-crystal-awards1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"general410187-1010.45422.45JcharlesCrystal Awards1:22%,25:24%"crystal awards" "sales awards" "service awards" "corporate sales awards" "corporate service awards" "sales award" "service award" "corporate sales award" "corporate service award"Optic Mountains from TrophyCentral. See our great selection of engraved and personalized gifts!5-20-2018Leadershipcustom-pagehigh-end-awards11"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"458221510.45434.45Vision AwardsTrophies1:22%,26:31%Find Optica Alergria Crystal Trophies from TrophyCentral; Price Includes Engraving!custom-page1"10 business days" "Aliquippa, PA" "UPS""PT1=Crystal" "PT1=Trophies" "G=Unisex" "SC2=Tennis"1500110-1410.45424.45Glass AmericaCrystal Awards1:22%,10:25%"Tennis Awards"Find These Crystal Tennis Balls Discounted At TrophyCentral. Each Optical Crystal Tennis Ball Includes Free Engraving and Gift Box!898912-20-2040Tennis, Sportscustom-pageglobal-crystal-awards11"5-10 business days w/engraving" "Mt. Vernon, NY" "UPS (FedEx available on request)"general105505-101211264.4Classic MedallicsCrystal Awards1:30%,10:40%The Optical Crystal Globe Award measures 4" high and sits on a 2" etched base. This is a perfect trophy for global organizations. The price includes 5 lines of text engraving.custom-pageglobal-crystal-awards1"5-10 business days" "Mount Vernon, NY" "UPS"general105503-610.4511213.65Classic MedallicsCrystal Awards1:22%"Crystal Awards"Shop for Optical Crystal Relief Globe from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.See more:glass-crystal-awardsLeadershipcustom-pageglass-crystal-awards11"5-10 business days w/engraving" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"general105505-1010.451521.45Classic MedallicsCrystal Awards1:22%,3:21%Shop for Optical Cut Awards and Trophies from TrophyCentral. Free Engraving and Gift Box.08-15-2014custom-pageglass-crystal-awards1"5-10 business days" "Mount Vernon, NY" "UPS"general105503-610.4511213.65Classic MedallicsCrystal Awards1:30%"Crystal Awards"Find this Optical Cut Shooting Star Award at TrophyCentral. The Shooting Star Award Includes engraving and gift box.Star, Leadership11"5-10 business days w/engraving" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)""PT1=Crystal" "PT1=Trophies" "G=Unisex"105505-1010.45618.45Classic MedallicsCrystal Awards1:30%,5:31%"Special Picks" "General Recognition Awards" "Crystal Globe Awards" "Engraved Crystal Awards" "Crystal Star Awards" "Optical Crystal Awards" "Etched Crystal Awards" "Crystal Awards" "Corporate Crystal" "Crystal Trophies" "Crystal Award Section" "Crystal Trophy Section" "Crystal Corporate Gifts" "Crystal Corporate Awards" "Crystal Corporate Award Section" "Corporate Crystal Awards" "Crystal Trophy"Shop for Optical Cut Star from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.12-20-2040custom-page11105502-410.451824.45Classic Medallics1:22%Find this bag of 100 1/4" screws for attaching perpetual plates to plaques discounted at TrophyCentral. Fast 1-2 day shipping.custom-pagethjaglqucl114-611 2 3 4 5 6 7 8 9Classic MedallicsGiftsSetup1:0%Use this option to indicate your that you would like to incorporate a logo a artwork on your TrophyCentral award item. Adding a logo improves branding and adds a special touch.1100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)""PT2=7745310-14125016.5PepcoPromotional ProductsSports / Water Bottles1:14%,250:21%,500:31%,1000:45%,2500:49%Orange Custom Sports Bottles from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.sportsbottles-orangeSports / Water Bottlescustom-pagemusic-certificate-templates1"Download Only"free-music4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our orchestra award certificate is free and designed exclusively for TrophyCentral. Orchestra certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.orchestra-template-design-aorchestra-a-521Music / Band / Chorus, Musiccustom-pagemusic-certificate-templates1"Download Only"free-music4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our orchestra template is free and designed exclusively for TrophyCentral. Templates measure 11 x 8 1/2 inches and can be easily downloaded and printed.orchestra-template-design-borchestra-b-521Music / Band / Chorus, Musiccustom-pagetrophies-music1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511230.45Classic MedallicsTrophiesAcademic1:22%,6:23%,12:24%,24:26%"Music Awards"Shop for Cast Stone Orchestra Awards at TrophyCentral. We have a great selection of Orchestra and other recognition trophies at discounted prices.tr9914Music / Band / Choruscustom-pageawri11"5-7 business days" "Topeka, Indiana" "UPS (Priority Mail also available)"ribbons465715-71 260.4620016.46Tower RibbonRibbonsAwareness Ribbons1:22%,50:36%Find organ donor ribbons discounted at TrophyCentral. Each green organ donor awareness ribbon features choice of backing and optional imprint.ordoawriShop for Organ Donor Ribbons with Ease at TrophyCentral TrophyCentral has a wonderful selection, discounted and bulk pricing and great customer service. Each green organ donor awareness ribbon comes with a tape or pin back and is available with optional imprinting.]]>Organ Donorcustom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these high-quality Outstanding Associate Inserts at TrophyCentral. Each Outstanding Associate Insert can be used to create a unique plaque, medal or trophy.518483Occupations
custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these high-quality Outstanding Athlete Inserts at TrophyCentral. Each Outstanding Athlete Insert can be used to create a unique plaque, medal or trophy.518189General, Outstanding Athlete
custom-pagemotivational-stickers1"1 - 2 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-21 2 3 230.451224.45Certificate SourceCertificates / CoversStickers1:22%,3:24%Find these colorful Outstanding Attendance Motivational Stickers discounted online at TrophyCentral. Fast 1-2 day shipping!bstick4Generalcustom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these quality Mylar Outstanding Attendance Decal Inserts at TrophyCentral. Each decal can be used to create a unique plaque, medal or trophy.489700Academic
custom-pageperfect-attendance-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"Find these Outstanding Attendance pins discounted at TrophyCentral. Each Outstanding Attendance pin features a quality clutch-back.br32506-15-2012Academiccustom-pageperfect-attendance-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:30%,100:33%,500:47%"School Pins" "School Lapel Pins"Outstanding Attendance Letter Pins: EC Series Outstanding Attendance Lapel Pins feature a high-quality enameled finish and ship in just 1-2 business days!ec818-21-09Academiccustom-pagemedals-general102-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.5115014Classic Medallicsaward-medalsAcademic1:22%,25:24%,50:30%,100:36%,500:42%"School Medals" "School Award Medals" "Scholastic Medals" "Scholastic Award Medals" "Academic Medals" "Academic Award Medals" "Medals, School"Your students will love these colorful Mylar Outstanding Attendance Medals from TrophyCentral. Each Outstanding Attendance medal includes a neck ribbon!tm9700General, Academic
custom-pagecitizenship-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsGeneral1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "School Medals"These inexpensive 1 1/4 inch Outstanding Citizen Medal offers a high quality, but low price for those on a tight budget.e925503-16-2009Citizenship
custom-pageschool-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:34%,100:39%,500:43%"School Pins" "School Lapel Pins"Find this Outstanding Community Service Pin at TrophyCentral. Outstanding Community Service and other pins ship in just 1-2 business days!br56707-10-2012General, Thank You, Volunteercustom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsGeneral1:22%Buy these quality Mylar Outstanding Community Service Decal Inserts at TrophyCentral. Each Outstanding Community Service Decal can be used to create a unique plaque, medal or trophy.489841Community Service
custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these high-quality Outstanding Contributor Award Inserts at TrophyCentral. Each Outstanding Contributor Award Insert can be used to create a unique plaque, medal or trophy.518693Volunteer
custom-pageawardcertificates11certificates290631-31 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,25:24%,100:40%,500:50%Find this outstanding effort certificate and other awards discounted at TrophyCentral. Outstanding effort certificates are beautifully printed; template measures 11 x 8 1/2 inches.941Academiccustom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these high-quality Outstanding Employee Inserts at TrophyCentral. Each Outstanding Employee Insert can be used to create a unique plaque, medal or trophy.518171Occupations
custom-pagecorporatepinsplasticpinboxvelapinbox5"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsBusiness1:30%,50:32%,100:35%,500:39%"Meeting or Exceeding Goals" "Employee Lapel Pins" "Corporate Lapel Pins"Find these these outstanding employee pins discounted at TrophyCentral. Each outstanding employee pin features a beautiful finish and clutch-back.br310Businesscustom-pagetrophies-volunteer1"3-6 business days with engraving, Without engraving: 1-3 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"plaques105503-610.4511219.65Classic MedallicsPlaquesInsert1:22%,3:24%,5:27%Genuine Walnut Outstanding Fundraiser Plaque with 2 Inch Insert and Free Engraving.51-fundVolunteercustom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these high-quality Outstanding Manager Inserts at TrophyCentral. Each Outstanding Manager Insert can be used to create a unique plaque, medal or trophy.518682General, Business
custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these high-quality Outstanding Member Inserts (Etched, 518159) at TrophyCentral. Each Outstanding Member Inserts (Etched, 518159) can be used to create a unique plaque, medal or trophy.518159Volunteer, Outstanding Member, Committee
custom-pagemusicartpins1plasticpinboxvelapinbox1"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsMusic, Drama, Art, Dance1:30%,50:34%,100:38%"Music Lapel Pins" "Band Lapel Pins" "Band Awards" "School Pins"Find this Outstanding Music Achievement Pin at TrophyCentral. Outstanding Music Achievement Lapel Pins feature a clutch back for easy attachment to clothing.br577Music / Band / Choruscustom-pagemusicartpins1plasticpinboxvelapinbox1"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsMusic, Drama, Art, Dance1:30%,50:34%,100:38%"Music Lapel Pins" "Band Lapel Pins" "Band Awards" "School Pins"Find this Outstanding Musician Pin at discounted at TrophyCentral. Outstanding Musician Lapel Pins feature a clutch back for easy attachment to clothing.br576Music / Band / Choruscustom-pagedramatrophies2plasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.371150030.37Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"Drama Lapel Pins" "Drama Pins" "Drama Awards"Find these Outstanding Performance pins discounted at TrophyCentral. Each of our drama pins feature a high quality finish and clutch-pin back.br587Dramacustom-pagecorporatepinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsBusiness1:30%,50:32%,100:35%,500:39%Find this Outstanding Performance Pin at TrophyCentral. Outstanding Performance and other pins ship in just 1-2 business days!br311General, Dramacustom-pageeawardmedals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsGeneral1:22%,100:28%,500:34%,1000:45%"General Award Medals" "Award Medals - All Subjects" "School Medals" "Music Awards" "General Recognition Awards" "Drama Awards"These inexpensive 1 1/4 inch Outstanding Performance Medals offer a high quality, but low price for those on a tight budget.e929207-05-2014General, Business, Academic
custom-pagemedallion-inserts-general-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals" "Art / Dance / Drama Medals" "Drama Awards" "Music Awards"Buy these quality Mylar Outstanding Performance Decal Inserts at TrophyCentral. Each Outstanding Performance Decal can be used to create a unique plaque, medal or trophy.489792Star
custom-pagemedallion-inserts-occupational-subjects12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Mylar Outstanding Poker Player Decal Inserts at TrophyCentral. Each decal can be used to create a unique plaque, medal or trophy.489862
custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these high-quality Outstanding Safety Record Inserts at TrophyCentral. Each Outstanding Safety Record Insert can be used to create a unique plaque, medal or trophy.517784General
custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these high-quality Outstanding Sales Person Inserts at TrophyCentral. Each Outstanding Sales Person Insert can be used to create a unique plaque, medal or trophy.518656Occupations, Business
custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these high-quality Outstanding Service Inserts at TrophyCentral. Each Outstanding Service Insert can be used to create a unique plaque, medal or trophy.51821412-25-2040General, Service / Retirement
custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these high-quality Outstanding Sponsor Inserts at TrophyCentral. Each Outstanding Sponsor Insert can be used to create a unique plaque, medal or trophy.518179General, Thank You, Volunteer
custom-pageachievement-certificates-awards1"Download Only"free-academic49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Outstanding Student template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Outstanding-Student-Certificateoutstanding-student-freeAcademic, Most Improvedcustom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these high-quality Outstanding Student Inserts at TrophyCentral. Each Outstanding Student Insert can be used to create a unique plaque, medal or trophy.518162General, Academic
custom-pagemedals-general102-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.5115014Classic Medallicsaward-medalsAcademic1:22%,25:24%,50:30%,100:36%,500:42%"School Medals" "School Award Medals" "Scholastic Medals" "Scholastic Award Medals" "Academic Medals" "Academic Award Medals" "Medals, School"Your students will love these colorful Mylar Outstanding Student Medals from TrophyCentral. Each Outstanding Student medal includes a neck ribbon!tm9789Academic
custom-pageeawardmedals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsAcademic1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "School Medals"These inexpensive 1 1/4 inch Outstanding Student Medals offer a high quality, but low price for those on a tight budget.e995112-10-2021Academic
custom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these quality Mylar Outstanding Student Decal Inserts at TrophyCentral. Each decal can be used to create a unique plaque, medal or trophy.489789Academic
custom-pageschool-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"Find this Outstanding Student - 3/4" Pin at TrophyCentral. Outstanding Student - 3/4" and other pins ship in just 1-2 business days!br314Academiccustom-pageschool-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:30%,100:33%,500:47%"Volunteer Items" "School Pins"Outstanding Student Letter Pins: EC Series Outstanding Student Lapel Pins feature a high-quality enameled finish and ship in just 1-2 business days!ec8312-20-2020Academiccustom-pageaward-medals1trophies-academictrophies105503-610.4511211.73Classic MedallicsTrophiesAcademic1:22%,10:25%,50:29%,100:34%"Honor Student Awards"Find outstanding student trophies discounted at TrophyCentral. Each trophy features free engraving. Fast 1 to 2 day shipping!schooltrophies1807-20-2010Generalcustom-pageteacher-appreciation1498552-311623.65TrophiesSchool1This quick-ship trophy from TrophyCentral features an apple figure, real marble base and marble trophy figure platform, choice of column size and color.mqt-apple-dmApplecustom-pageteacher-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"Find this Outstanding Teacher Pin at TrophyCentral. Outstanding Teacher and other pins ship in just 1-2 business days!br313Academiccustom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these high-quality Outstanding Teacher Inserts at TrophyCentral. Each Outstanding Teacher Insert can be used to create a unique plaque, medal or trophy.518186General, Academic
custom-pageteacher-appreciation1perpetual trophies498552-31234TrophiesSchool1Find this Perpetual Apple / Outstanding Teacher Trophy Discounted at TrophyCentral. Each Trophy has enough room for 32 names. Ships in just 1-2 days.mqt-apple-perpApplecustom-pageteacher-appreciation1"3-6 business days with engraving, Without engraving: 1-3 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"plaques105503-610.4511219.65Classic MedallicsPlaquesInsert1:22%,3:24%,5:27%"School Awards" "School Products"Genuine Walnut Outstanding Teacher Plaque with 2 Inch Insert and Free Engraving.51-8186Teacher's Awardcustom-pagevolunteerpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsBusiness1:30%,50:32%,100:35%,500:39%Find this Enameled Outstanding Volunteer Pin at TrophyCentral. Enameled Outstanding Volunteer and other pins ship in just 1-2 business days!br31206-30-2012Volunteer, Leadershipcustom-pagetrophies-volunteer1"3-6 business days with engraving, Without engraving: 1-3 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"plaques105503-610.4511219.65Classic MedallicsPlaquesInsert1:22%,3:24%,5:27%Genuine Walnut Outstanding Volunteer Plaque with 2 Inch Insert and Free Engraving.51-8188Volunteercustom-pagevolunteer-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsGeneral1:22%Buy these quality Mylar Outstanding Volunteer Work Decal Inserts at TrophyCentral. Each Outstanding Volunteer Work Decal can be used to create a unique plaque, medal or trophy.489830Volunteer
custom-pageacrylicawards11"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"general105503-610.451515.45Classic MedallicsCrystal Awards1:30%Shop for This 9" Oval Acrylic Award, and other Unique Crystal Awards, at TrophyCentral; Free Engraving.ac265custom-pagename-badges-tagswoyoulipr100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Find Oval Badges Discounted At TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.namebadges-ovlcustom-pageawri11"5-7 business days" "Topeka, Indiana" "UPS (Priority Mail also available)""1-2 business days" "Topeka, Indiana" "UPS (Priority Mail also available)""1-2 business days" "Topeka, Indiana" "UPS (Priority Mail also available)""1-2 business days" "Topeka, Indiana" "UPS (Priority Mail also available)"ribbons465715-71 260.4620016.46Tower RibbonRibbonsAwareness Ribbons1:22%,50:36%Find Ovarian Cancer Ribbons discounted at TrophyCentral. Each teal awareness ribbon features choice of backing and optional imprint.ovcariShop for Ovarian Cancer Ribbons with Ease at TrophyCentral TrophyCentral has a wonderful selection, discounted and bulk pricing and top-rated customer service. Each teal awareness ribbon comes with a tape or pin back and is available with optional imprinting.]]>Ovarian Cancercustom-pageindoor-outdoor-non-lighted14512310-171 3 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Ovation 1 Door Enclosed Fabric Bulletin Board with Black Frame, 3'H x 2'W, Beige discounted at TrophyCentral.ovk1-f96Enclosed - 1 Door, Indoorcustom-pageindoor-outdoor-non-lighted14512310-171 3 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Ovation 1 Door Enclosed Fabric Bulletin Board with Black Frame, 3'H x 2'W, Black discounted at TrophyCentral.ovk1-f96Enclosed - 1 Door, Indoorcustom-pageindoor-outdoor-non-lighted14512310-171 3 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Ovation 1 Door Enclosed Fabric Bulletin Board with Black Frame, 3'H x 2'W, Blue discounted at TrophyCentral.ovk1-f96Enclosed - 1 Door, Indoorcustom-pageindoor-outdoor-non-lighted14512310-171 3 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Ovation 1 Door Enclosed Fabric Bulletin Board with Black Frame, 3'H x 2'W, Gray discounted at TrophyCentral.ovk1-f96Enclosed - 1 Door, Indoorcustom-pageindoor-outdoor-non-lighted14512310-171 3 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Ovation 1 Door Enclosed Fabric Bulletin Board with Black Frame, 3'H x 2'W, Red discounted at TrophyCentral.ovk1-f96Enclosed - 1 Door, Indoorcustom-pageindoor-outdoor-non-lighted1Bulletin Boards4512310-171 3 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Ovation 1 Door Enclosed Fabric Bulletin Board with Black Frame, 3'H x 2'W, Taupe discounted at TrophyCentral.ovk1-f96Enclosed - 1 Door, Indoorcustom-pageindoor-outdoor-non-lighted14512310-171 3 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Ovation 1 Door Enclosed Fabric Bulletin Board with Black Frame, 3'H x 2'W, Teal discounted at TrophyCentral.ovk1-f96Enclosed - 1 Door, Indoorcustom-pageindoor-outdoor-non-lighted14512310-171 3 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Ovation 1 Door Enclosed Fabric Bulletin Board with Gray Frame, 3'H x 2'W, Beige discounted at TrophyCentral.ovk1-f96Enclosed - 1 Door, Indoorcustom-pageindoor-outdoor-non-lighted14512310-171 3 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Ovation 1 Door Enclosed Fabric Bulletin Board with Gray Frame, 3'H x 2'W, Black discounted at TrophyCentral.ovk1-f96Enclosed - 1 Door, Indoorcustom-pageindoor-outdoor-non-lighted14512310-171 3 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Ovation 1 Door Enclosed Fabric Bulletin Board with Gray Frame, 3'H x 2'W, Blue discounted at TrophyCentral.ovk1-f96Enclosed - 1 Door, Indoorcustom-pageindoor-outdoor-non-lighted14512310-171 3 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Ovation 1 Door Enclosed Fabric Bulletin Board with Gray Frame, 3'H x 2'W, Gray discounted at TrophyCentral.ovk1-f96Enclosed - 1 Door, Indoorcustom-pageindoor-outdoor-non-lighted14512310-171 3 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Ovation 1 Door Enclosed Fabric Bulletin Board with Gray Frame, 3'H x 2'W, Red discounted at TrophyCentral.ovk1-f96Enclosed - 1 Door, Indoorcustom-pageindoor-outdoor-non-lighted14512310-171 3 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Ovation 1 Door Enclosed Fabric Bulletin Board with Gray Frame, 3'H x 2'W, Taupe discounted at TrophyCentral.ovk1-f96Enclosed - 1 Door, Indoorcustom-pageindoor-outdoor-non-lighted14512310-171 3 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Ovation 1 Door Enclosed Fabric Bulletin Board with Gray Frame, 3'H x 2'W, Teal discounted at TrophyCentral.ovk1-f96Enclosed - 1 Door, Indoorcustom-pageindoor-enclosed-bulletin-boards1Bulletin Boards4512310-171 3 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Ovation 1 Door Enclosed Letter Board with Black Frame, 3'H x 2'W, Black discounted at TrophyCentral.Enclosed - 1 Door, Indoorcustom-pageindoor-enclosed-bulletin-boards14512310-171 3 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Ovation 1 Door Enclosed Letter Board with Black Frame, 3'H x 2'W, Burgundy discounted at TrophyCentral.ovk1-bbkEnclosed - 1 Door, Indoorcustom-pageindoor-enclosed-bulletin-boards14512310-171 3 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Ovation 1 Door Enclosed Letter Board with Gray Frame, 3'H x 2'W, Black discounted at TrophyCentral.ovk1-bbkEnclosed - 1 Door, Indoorcustom-pageindoor-enclosed-bulletin-boards14512310-171 3 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Ovation 1 Door Enclosed Letter Board with Gray Frame, 3'H x 2'W, Burgundy discounted at TrophyCentral.ovk1-bbkEnclosed - 1 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Black Frame, 3'H x 4'W, Beige discounted at TrophyCentral.ovk2-f95Enclosed - 2 Door, Indoorcustom-pageindoor-outdoor-non-lighted1Bulletin Boards45123110-171 3 4 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Black Frame, 3'H x 4'W, Black discounted at TrophyCentral.ovk2-f95Enclosed - 2 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Black Frame, 3'H x 4'W, Blue discounted at TrophyCentral.ovk2-f95Enclosed - 2 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Black Frame, 3'H x 4'W, Gray discounted at TrophyCentral.ovk2-f95Enclosed - 2 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Black Frame, 3'H x 4'W, Red discounted at TrophyCentral.ovk2-f95Enclosed - 2 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Black Frame, 3'H x 4'W, Taupe discounted at TrophyCentral.ovk2-f95Enclosed - 2 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Black Frame, 3'H x 4'W, Teal discounted at TrophyCentral.ovk2-f95Enclosed - 2 Door, Indoorcustom-pageindoor-outdoor-non-lighted14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Black Frame, 3'H x 5'W, Beige discounted at TrophyCentral.ovk4-f98Enclosed - 2 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Black Frame, 3'H x 5'W, Black discounted at TrophyCentral.ovg4-f95Enclosed - 2 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Black Frame, 3'H x 5'W, Blue discounted at TrophyCentral.ovk4-f98Enclosed - 2 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Black Frame, 3'H x 5'W, Gray discounted at TrophyCentral.ovg4-f95Enclosed - 2 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Gray Frame, 3'H x 4'W, Beige discounted at TrophyCentral.ovg2-f95Enclosed - 2 Door, Indoorcustom-pageindoor-outdoor-non-lighted1Bulletin Boards45123110-171 3 4 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Gray Frame, 3'H x 4'W, Black discounted at TrophyCentral.ovg2-f95Enclosed - 2 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Gray Frame, 3'H x 4'W, Blue discounted at TrophyCentral.ovg2-f95Enclosed - 2 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Gray Frame, 3'H x 4'W, Gray discounted at TrophyCentral.ovg2-f95Enclosed - 2 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Gray Frame, 3'H x 4'W, Red discounted at TrophyCentral.ovg2-f95Enclosed - 2 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Gray Frame, 3'H x 4'W, Taupe discounted at TrophyCentral.ovg2-f95Enclosed - 2 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Gray Frame, 3'H x 4'W, Teal discounted at TrophyCentral.ovg2-f95Enclosed - 2 Door, Indoorcustom-pageindoor-outdoor-non-lighted14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Gray Frame, 3'H x 5'W, Beige discounted at TrophyCentral.ovg4-f95Enclosed - 2 Door, Indoorcustom-pageindoor-outdoor-non-lighted1Bulletin Boards45123110-171 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Gray Frame, 3'H x 5'W, Black discounted at TrophyCentral.ovg4-f95Enclosed - 2 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Gray Frame, 3'H x 5'W, Blue discounted at TrophyCentral.ovk4-f98Enclosed - 2 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Gray Frame, 3'H x 5'W, Gray discounted at TrophyCentral.ovg4-f95Enclosed - 2 Door, Indoorcustom-pageindoor-enclosed-bulletin-boards145123110-171 3 4 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Letter Board with Black Frame, 3'H x 4'W, Black discounted at TrophyCentral.ovk2-bbgEnclosed - 2 Door, Indoorcustom-pageindoor-enclosed-bulletin-boards1Bulletin Boards45123110-171 3 4 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Letter Board with Black Frame, 3'H x 4'W, Burgundy discounted at TrophyCentral.ovk2-bbgEnclosed - 2 Door, Indoorcustom-pageindoor-enclosed-bulletin-boards145123110-171 3 4 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Letter Board with Gray Frame, 3'H x 4'W, Black discounted at TrophyCentral.ovg2-bbgEnclosed - 2 Door, Indoorcustom-pageindoor-enclosed-bulletin-boards145123110-171 3 4 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Letter Board with Gray Frame, 3'H x 4'W, Burgundy discounted at TrophyCentral.ovk2-bbgEnclosed - 2 Door, Indoorcustom-pageindoor-outdoor-non-lighted1Bulletin Boards45123110-171 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Black Frame, 3'H x 5'W, Red discounted at TrophyCentral.ovk4-f98Enclosed - 3 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Black Frame, 3'H x 5'W, Taupe discounted at TrophyCentral.ovk4-f98Enclosed - 3 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Black Frame, 3'H x 5'W, Teal discounted at TrophyCentral.ovk4-f98Enclosed - 3 Door, Indoorcustom-pageindoor-outdoor-non-lighted14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 3 Door Enclosed Fabric Bulletin Board with Black Frame, 4'H x 6'W, Beige discounted at TrophyCentral.ovk5-f93Enclosed - 3 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 3 Door Enclosed Fabric Bulletin Board with Black Frame, 4'H x 6'W, Black discounted at TrophyCentral.ovg5-f95Enclosed - 3 Door, Indoorcustom-pageindoor-outdoor-non-lighted1Bulletin Boards45123110-171 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 3 Door Enclosed Fabric Bulletin Board with Black Frame, 4'H x 6'W, Blue discounted at TrophyCentral.ovk5-f93Enclosed - 3 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 3 Door Enclosed Fabric Bulletin Board with Black Frame, 4'H x 6'W, Gray discounted at TrophyCentral.ovg5-f95Enclosed - 3 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 3 Door Enclosed Fabric Bulletin Board with Black Frame, 4'H x 6'W, Red discounted at TrophyCentral.ovk5-f93Enclosed - 3 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 3 Door Enclosed Fabric Bulletin Board with Black Frame, 4'H x 6'W, Taupe discounted at TrophyCentral.ovk5-f93Enclosed - 3 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 3 Door Enclosed Fabric Bulletin Board with Black Frame, 4'H x 6'W, Teal discounted at TrophyCentral.ovk5-f93Enclosed - 3 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Gray Frame, 3'H x 5'W, Red discounted at TrophyCentral.ovg4-f95Enclosed - 3 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Gray Frame, 3'H x 5'W, Taupe discounted at TrophyCentral.ovg4-f95Enclosed - 3 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Gray Frame, 3'H x 5'W, Teal discounted at TrophyCentral.ovg4-f95Enclosed - 3 Door, Indoorcustom-pageindoor-outdoor-non-lighted14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 3 Door Enclosed Fabric Bulletin Board with Gray Frame, 4'H x 6'W, Beige discounted at TrophyCentral.ovg5-f95Enclosed - 3 Door, Indoorcustom-pageindoor-outdoor-non-lighted1Bulletin Boards45123110-171 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 3 Door Enclosed Fabric Bulletin Board with Gray Frame, 4'H x 6'W, Black discounted at TrophyCentral.ovg5-f95Enclosed - 3 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 3 Door Enclosed Fabric Bulletin Board with Gray Frame, 4'H x 6'W, Blue discounted at TrophyCentral.ovk5-f93Enclosed - 3 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 3 Door Enclosed Fabric Bulletin Board with Gray Frame, 4'H x 6'W, Gray discounted at TrophyCentral.ovg5-f95Enclosed - 3 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 3 Door Enclosed Fabric Bulletin Board with Gray Frame, 4'H x 6'W, Red discounted at TrophyCentral.ovg5-f95Enclosed - 3 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 3 Door Enclosed Fabric Bulletin Board with Gray Frame, 4'H x 6'W, Taupe discounted at TrophyCentral.ovg5-f95Enclosed - 3 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 3 Door Enclosed Fabric Bulletin Board with Gray Frame, 4'H x 6'W, Teal discounted at TrophyCentral.ovg5-f95Enclosed - 3 Door, Indoorcustom-pagehigh-end-awards1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"general410187-1010.45424.45JcharlesCrystal Awards1:22%,25:30%"crystal awards"Ovation Awards will earn a standing ovation from all who receive this exceptional award. Available in two sizes. Personalization is free!noindexed-items111111custom-pagemascotpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:36%,100:46%,500:52%"Mascot Awards"Find These Owl Lapel Pins with Antique Finish Discounted at TrophyCentral! Also See Our Other Fabulous School Mascot Pins. Fast 1-2 Day Shipping!pm13Mascotcustom-pagemascot-plaques1plaques498552-41JDSPlaques1Find this owl plaque discounted at TrophyCentral. Our owl mascot plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Mascotcustom-pagemascottrophies1"4-6 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511016.25Classic MedallicsTrophiesAcademic1:22%,5:24%,10:28%,50:32%"Mascot Awards"Buy this Owl mascot trophy and other mascot awards at TrophyCentral.mt203010-05-2022Mascotcustom-pagemascotinserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsMascots1Buy these quality Owls Mascot Medal Inserts at TrophyCentral. Each Owls Insert can be used to create a unique plaque, medal or trophy.489948Mascot
custom-pagetrophies-golf1"10 business days" "Aliquippa, PA" "UPS"trophies1500110-1410.45424.45Glass AmericaCrystal AwardsSports, Hobby, Org, Livestock1:22%,10:25%Oxford Golf Ball Trophy. Ideal for leagues, schools, and tournaments. Fast shipping.Golf, Sportscustom-pageletter-shaped-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find these popular P-shaped custom mascot badges at TrophyCentral. Great for fundraising! TrophyCentral is a top-rated Yahoo merchant.letterbadges-pcustom-pageaward-medalsqtpaintncqtpaintscqtpaintdmqtpaintyrqtpaintplqtpaintttqtpaintttwqtpaint3cqtpaintperpmqtpaintscbcup-paint-scbcup-paint-pbdg-paintballpaintball-cup-place-column-trophypaintball-cup-place-trophy1trophies1Find Paintball Trophies Discounted at TrophyCentral. Each Paintball Trophy Includes Free Engraving. Fast 1-2 Day Shipping!

Custom Paintball Trophies and Awards - Honor Every Team, Tournament, and Champion

Paintball trophies celebrate the teamwork, strategy, and competitive intensity that define one of the most exciting action sports played today. From recreational speedball leagues where local teams compete for weekly bragging rights, to organized woodsball scenario events where squads battle across sprawling outdoor fields, from youth and amateur tournament circuits where up-and-coming players test their skills against regional competition, to serious competitive league play where teams train year-round to chase a championship, quality paintball awards give players and teams the recognition their effort and dedication deserves. Our versatile selection includes budget participation trophies and marble base awards ideal for recognizing every player on a team or in a league, single column and double platform trophies with paintball figurines in 1st, 2nd, and 3rd place trim for tournament podium finishers, two-tier and three-column championship trophies for season and tournament champions, a perpetual paintball trophy for leagues that crown a new champion each year, and medals with free ribbons for large events recognizing multiple divisions and categories. Every award includes free engraving personalized with player name, team, and tournament.

Frequently Asked Questions About Paintball Trophies

What trophy sizes work best for different paintball award categories?

Recreational league participation and end-of-season team awards benefit from 6-inch to 9-inch trophies ensuring every player receives recognition for competing, building enthusiasm and encouraging return play the following season. Individual category winners and division placers at local tournaments deserve 10-inch to 14-inch single column or double platform trophies with paintball figurines that distinguish competitive achievement from participation awards. Overall top finishers and division champions at invitational or multi-team events warrant 15-inch to 18-inch premium trophies with substantial presence reflecting strong tournament performance. Season champions and annual league title winners demand 20-inch to 24-inch two-tier or three-column trophies whose size conveys the weight of the achievement. Medals work especially well for large tournaments recognizing multiple divisions where awarding every placer a trophy is impractical.

What details should paintball trophy engraving include?

Essential elements include player or team name, award title, tournament or league name, and year. For competitive events, adding the division and place finish creates a more complete record of the achievement. Team trophies benefit from including the full team name and the field or venue name. Keep text concise and readable, prioritizing the most meaningful details when space on smaller trophies requires choices.

Do you offer bulk discounts for paintball tournaments and leagues?

Yes, Trophy Central offers significant bulk discounts on paintball trophies and medals that scale with order quantity, keeping award budgets manageable for tournaments and leagues of any size. Field owners ordering participation trophies for an entire season roster, tournament directors purchasing place trophies across multiple divisions, and leagues buying year-end awards for all competing teams all benefit from bulk pricing. Browse our paintball medals above for the most budget-friendly option when recognizing large fields.

If you need more information before deciding, see our expert resource section:
]]>
custom-pagetrophies-paintball1trophies498551-310.452429Trophies1Find this popular Paintball trophy discounted at TrophyCentral. Features a real marble base, free engraving and fast shipping.paintball-cup-place-trophy-tccustom-pagetrophies-paintball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular paintball figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!qtpaintplPaintball, 1st / 2nd / 3rd / Etc.custom-pagetrophies-paintball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%This popular Paintball Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!qtpaintyrPaintballcustom-pagetrophies-paintball1trophies498852-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with paintball figure discounted at TrophyCentral. Includes free text engraving!cup-paint-pPaintballcustom-pagefreeawardcertificates1"Download Only"free-sports49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Paintball template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Paintball-Certificatepaintball-freePaintballcustom-pagetrophies-paintball1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these paintball budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtpaintscbPaintballcustom-pagetrophies-paintball1498852-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Find this budget paintball award trophy discounted at Trophy Central. Features a real marble base and plastic paintball figure. Engraving is free. Fast 1-2 day shipping.bdg-paintballPaintballcustom-pagetrophies-paintball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous two-tier Paintball Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtpaintttPaintballcustom-pagetrophies-paintball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.215Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%See this championship trophy with a Paintball figure at TrophyCentral. Be sure to see all of our Paintball figure awards.qtpaintttwPaintballcustom-pagetrophies-paintball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%This popular Paintball Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtpaintscPaintballcustom-pagetrophies-paintball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451623.65Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%These quick-ship trophies from TrophyCentral feature a Paintball figure, real marble base and marble trophy figure platform, choice of column size and color.qtpaintdmPaintballcustom-pagetrophies-paintball1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Paintball figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-paint-scbPaintballcustom-pagetrophies-paintball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous two-tier, 3-column champion Paintball Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtpaint3cPaintballcustom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Paintabll Medals"Buy these quality Mylar Paintball Decal Inserts at TrophyCentral. Each Paintball Decal can be used to create a unique plaque, medal or trophy.489853Paintball
custom-pagetrophies-paintball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%,25:23%,50:29%,100:34%Our popular Paintball participation trophies feature a real slant-front marble base and free engraving.qtpaintncPaintballcustom-pagetrophies-paintball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498852-311.4234Quick TrophyTrophies1:14%,3:15%,10:16%Find this Perpetual Paintball Trophy Discounted at TrophyCentral. Each Trophy has enough room for 32 names. Ships in just 1-2 days.qtpaintperpPaintballcustom-pagemascotpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:36%,100:46%,500:52%"Mascot Awards"Find These Panther Lapel Pins with Antique Finish Discounted at TrophyCentral! Also See Our Other Fabulous School Mascot Pins. Fast 1-2 Day Shipping!pm12Mascotcustom-pagemascot-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Panther Mascot Badges Discounted At TrophyCentral.mascotbadges-panthercustom-pagemascotpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:30%,100:33%,500:47%"Mascot Awards"Find these Panther Lapel Pins and other colorful mascot pins at TrophyCentral. Fast 1-2 day shipping!em01Mascotcustom-pagemascotinserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsMascots1Buy these quality Panthers Mascot Medal Inserts at TrophyCentral. Each Panthers Insert can be used to create a unique plaque, medal or trophy.489926Mascot
custom-pageglass-crystal-awards1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"general410187-1010.45648.45JcharlesCrystal Awards1:22%,25:24%"crystal awards" "sales awards" "service awards" "corporate sales awards" "corporate service awards" "sales award" "service award" "corporate sales award" "corporate service award"Paradigm from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.custom-pagemedallion-inserts-occupational-subjects12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these quality Paramedic Inserts (Litho) at TrophyCentral. Each Paramedic Insert can be used to create a unique plaque, medal or trophy.493401Occupations
custom-pagetrophies-military-hero11plaques105503-610.4511219.65Classic MedallicsPlaquesBlank Plaques1:22%Shop for Paramedic Plaques from TrophyCentral; Free Engraving. TrophyCentral is a Top-Rated Yahoo Merchant.EMScustom-pagewalnut-insert-plaques1"3-6 business days with engraving, Without engraving: 1-3 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"plaques105503-610.4511222.05Classic MedallicsPlaquesInsert1:22%,3:23%,5:24%Genuine Walnut Paramedic Plaque with 2 Inch Insert and Free Engraving.49-3401Occupationscustom-pageteacher-appreciation1"3-6 business days with engraving, Without engraving: 1-3 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"plaques105503-610.4511219.65Classic MedallicsPlaquesInsert1:22%,3:24%,5:27%"School Awards" "School Products"Genuine Walnut Parent Teacher Association (PTA) Plaque with 2 Inch Insert and Free Engraving.51-3411custom-pageplace-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%Your athletes will love these colorful Mylar Participant Medals from TrophyCentral. Each Participant medal includes a neck ribbon!tm9967gSports
custom-pagefree-school-certificate-templates1free-school-certificate-templates"Download Only"free-sports49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"participationAcademiccustom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceCertificates / CoversEmbosser Seals1:22%,3:28%,5:31%Find these Participation Embossed Certificate Seals discounted at TrophyCentral. Seals are easy to apply with a pressure-sensitive backing.803partGeneralcustom-pageawardcertificates1participation1certificates290631-31 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,25:24%,100:40%,500:50%Find this participation certificate and other awards discounted at TrophyCentral. Participation certificates are beautifully printed; template measures 11 x 8 1/2 inches.920Academiccustom-pagetrophies-general1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our blank insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - BlankBlank, Generalcustom-pageresin-trophies1"1 - 2 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"trophies290631-21 2 3 230.451224.45Certificate SourceCertificates / CoversStickers1:22%,3:24%Find these colorful Participation Really Rocks Motivational Stickers discounted online at TrophyCentral. Fast 1-2 day shipping!bstick7Participationcustom-pagetrophies1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"465713-41012.11See these Classic Line School and Sports Participation Trophies at TrophyCentral. Classic Line Trophies Include Free Engraving and Ship in Just 1-2 Days!classic-line-allcustom-pageaward-medalspart-trophies-tcbstick77020vitrnoco803part920mqt-star-p-ncbdg-star-p1trophies1Find participation trophies discounted at TrophyCentral. Each participation trophy includes free engraving. Browse our budget trophies and awards now!

Inexpensive Participation Trophies and Awards

If you are shopping for trophies online, you have come to the right place! We offer significant quantity discounts for all of your team, league, school and event needs. We know there is a debate about whether every child deserves a trophy, but we also know that our youth sports budget trophies are sure to make kids smile! Also see our cup & large trophies and perpetual trophies sections.
]]>
custom-pagetrophies1trophies"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453631.77TrophyCentralTrophiesSports, Hobby, Org, Livestock1:14%,10:17%,25:23%,50:29%,100:34%Find cheap trophies at TrophyCentral. Each cheap trophy has a low price, but features a real marble base and free engraving!budget-trophiescustom-pageschool-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:28%,100:32%,500:42%"School Pins" "School Lapel Pins"Find Partners In Education pins at TrophyCentral. Each AP Series Partners In Education pin includes a clutch back.ap68Academiccustom-pagemedallion-inserts-general-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals" "Religious Medals"Buy these high-quality, Etched Partners In Faith Religious Cross Inserts Discounted at TrophyCentral.518245Religious
custom-pagereligioustrophies12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsReligious1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "Religious Medals"These inexpensive 1 1/4 inch Religious (Partners in Faith) Medals offer a high quality, but low price for those on a tight budget.e9132Religious
custom-pagegeneral-corporate-awards11"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"458221510.45633.45Vision AwardsTrophies1:22%,26:28%Partners In Success Teamwork Awards from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.custom-pagegift-certificate-templates1"Download Only"certificates4985501Trophy CentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our party themed template is free and designed exclusively for Trophy Central. This gift certificate measures 5" x 3" and can be easily downloaded and printed.Party-Gift-Certificategc-party-521Gift Certificate, Birthday, Holidaycustom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceCertificates / CoversEmbosser Seals1:22%,3:28%,5:31%Find these Paw (Die Cut) Embossed Certificate Seals discounted at TrophyCentral.803dpMascotcustom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceCertificates / CoversEmbosser Seals1:22%,3:28%,5:31%Find these Paw Blue (Round) Embossed Certificate Seals discounted at TrophyCentral.803pawbgMascotcustom-pagemascot-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Paw Mascot Badges Discounted At TrophyCentral.mascotbadges-pawcustom-pagemascot-medals50medals9303310-May1Simba Calaward-medals1These 2 1/2 inch custom paw mascot medals come with an outer-ring which allows you to add your school or league name, date and location.Mascotcustom-pagemascot-plaques1plaques498552-41JDSPlaques1Find this Paw Plaque discounted at TrophyCentral. Our mascot plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Mascotcustom-pagemascot-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Paw Nameplate Badges Discounted At TrophyCentral.mascotbadges-paw2custom-pagemascotpinsplasticpinboxvelapinbox10105502-30.31150030.3Classic Medallicslapel-award-pins11:22%,50:30%,100:33%,500:47%Find These Paw Print Mascot Pins Discounted at TrophyCentral. Paw Pins Feature a Clutch-Back and are Available in Many Colors. Fast 1-2 Day Shipping!Paw-Print-Mascot-PinsPaw, Mascotcustom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceCertificates / CoversEmbosser Seals1:22%,3:28%,5:31%Find these paw certificate seals discounted at TrophyCentral. Each paw certificate seal is packaged in rolls of 100.803pawMascotcustom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these high-quality Peak Performance Inserts at TrophyCentral. Each Peak Performance Insert can be used to create a unique plaque, medal or trophy.518501General, Business
custom-pagedisplaycases211"7-10 business days" "Connelly Springs, North Carolina" "UPS (FedEx available on request)"display case286127-1010.452.65SpartaCraftDisplay CasesSpecialty Cases1:14%Pedestal / Memorial Urn from TrophyCentral. Also see our great selection of engraved and personalized gifts!Flag Casescustom-pagecoaching-teaching-guides11Master pee-wee football coaching with safety-first tackling progressions, age-appropriate drills, and position basics for ages 5-12. Includes motivation and recognition strategies.custom-pageawardcertificates11certificates290631-31 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,25:24%,100:40%,500:50%Find this peer mediator certificate and other awards discounted at TrophyCentral. Peer mediator certificates are beautifully printed; template measures 11 x 8 1/2 inches.931Academiccustom-pagegeneral-corporate-awards11"7-10 business days w/engraving" "Kentucky" "UPS (FedEx available on request)"general410187-1010.45626.85JcharlesGeneral Awards1:22%,25:24%"Corporate Awards" "New Products" "Crystal Trophies"Perceptions Crystal Trophies from TrophyCentral. Also see our great selection of engraved and personalized gifts!06-01-2019custom-pageaward-medalsperfect-attendance-mcperfect-attendance-mc-prtm9755perfect-attendance-jigfperfect-attendance-jibfperfect-attendance-jisf1academic-general-medals1Find a great selection of Perfect Attendance Medals discounted at TrophyCentral. Each perfect attendance medal includes a neck ribbon. Fast 1-2 day shipping.Shop for with Ease at TrophyCentral! TrophyCentral has a great selection that will fit any budget. Our experts in New York and Michigan have been providing suggestions and guidance since 1999! They would be happy to help you, too!]]>academic-general-medalscustom-pageattendance-medals-pins1498551-30.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful Perfect Attendance 2" Epoxy-covered insert decal discounted at TrophyCentral. Fast 1-2 day shipping.Attendance, Academiccustom-pageachievement-certificates-awards1"Download Only"free-academic49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Download free perfect attendance certificates. Printable templates for classroom or school use. Easy to personalize. Recognize students' commitment today.Free-Perfect-Attendance-Award-Certificateperfect-attendance-awardParticipation, Academiccustom-pageachievement-certificates-awards1"Download Only"free-academic49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"See this Perfect Attendance Certificate designed exclusively for TrophyCentral! Each Perfect Attendance Certificate measures 11 x 8 1/2 inches and can be downloaded for free!attendanceAcademic, Perfect Attendancecustom-pageattendance-medals-pins1498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Perfect Attendance Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Perfect Attendance, Academiccustom-pageawardcertificates11certificates290631-31 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,25:24%,100:40%,500:50%Find this perfect attendance certificate discounted at TrophyCentral. Perfect attendance certificates are beautifully printed; template measures 11 x 8 1/2 inches.903Academiccustom-pageachievement-certificates-awards1"Download Only"free-academic4985501Trophy CentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Perfect Attendance template is free and designed exclusively for Trophy Central. Perfect Attendance certificate templates measure 11" x 8 1/2" and can be easily downloaded and printed.perfect-attendance-certificateperfect-attendance-frPerfect Attendance, Academiccustom-pageperfect-attendance-awards1498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Perfect Attendance insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-Perfect Attendance-InsertAttendance, Academiccustom-pageawardcertificates11certificates290631-31 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,25:24%,100:40%,500:50%Find this perfect attendance certificate with clock design discounted at TrophyCentral. Certificates are beautifully printed; template measures 11 x 8 1/2 inches.965Academiccustom-pageperfect-attendance-awards1498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Perfect Attendance single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - Perfect AttendancePerfect Attendance, Academiccustom-pageperfect-attendance-awards1498551-311821.06TrophyCentraltrophies1Attendance, Academiccustom-pageperfect-attendance-pinsplastic-pinbox-t1498551-30.5200040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find this Perfect Attendance Gold Enamel lapel pin discounted at TrophyCentral. Fast 1-2 day shipping.attendance-u-pbAttendance, Academiccustom-pageperfect-attendance-pinsplastic-pinbox-t5498551-30.550040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find our G-Series Gold Perfect Attendance pin discounted at TrophyCentral. Each pin has a 3D effect and measures 7/8". Fast 1-2 day shipping.5-28-2024Attendance, Academiccustom-pageattendance-medals-pins1498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Perfect Attendance Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Perfect Attendance, Academiccustom-pagenew-tc-color-medals1medals498551-30.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Colorful Perfect Attendance Insert Medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Perfect Attendance, Academiccustom-pageattendance-medals-pins1498551-30.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Perfect Attendance insert medal With A Personalized Front Rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Perfect Attendance, Academiccustom-pagecherry-insert-plaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these perfect attendance insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Academic, Perfect Attendancecustom-pageec34plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:28%,100:32%,500:42%"School Pins" "School Lapel Pins"Find Perfect Attendance pins at TrophyCentral. Each Perfect Attendance pin includes a clutch back. Browse our fabulous selection of school lapel pins now!ap10Academiccustom-pageacademic-lamp-general102-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.5115014Classic Medallicsaward-medalsAcademic1:22%,25:24%,50:30%,100:36%,500:42%"School Medals" "School Award Medals" "Scholastic Medals" "Scholastic Award Medals" "Academic Medals" "Academic Award Medals" "Medals, School"Find Perfect Attendance Medals discounted at TrophyCentral. Each Perfect Attendance Medal features a free neck ribbons. Fast 1-2 day shipping.tm9755General, Academic
custom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these high-quality Perfect Attendance Inserts at TrophyCentral. Each Perfect Attendance Insert can be used to create a unique plaque, medal or trophy.518301General, Business
custom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these quality Mylar Perfect Attendance Decal Inserts at TrophyCentral. Each decal can be used to create a unique plaque, medal or trophy.489755Academic, Perfect Attendance
custom-pageperfect-attendance-awards1498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Perfect Attendance insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - Perfect AttendancePerfect Attendance, Academiccustom-pageperfect-attendance-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"Find Perfect Attendance pins for your students at TrophyCentral. Each Perfect Attendance pin includes a clutch back. Large quantity discounts.br389Generalcustom-pageperfect-attendance-pinsplasticpinboxvelapinbox10105502-30.31150030.3Classic Medallicslapel-award-pins11:22%,50:30%,100:33%,500:47%Find Perfect Attendance Pins Discounted At TrophyCentral. Each Perfect Attendance Pin Features A Clutch-Back. Fast 1-2 Day Shipping!Perfect-AttendancePerfect Attendance, Academiccustom-pageperfect-attendance-pinsplasticpinboxvelapinbox107003 965 803p tm9755 ap10 hp15"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:30%,100:33%,500:47%"School Pins" "School Lapel Pins"Chenille PERFECT ATTENDANCE Letter Pins: EC Series Chenille PERFECT ATTENDANCE Lapel Pins feature a high-quality enameled finish and ship in just 1-2 business days!ec34Academiccustom-pagestar-pinsg-perfect-attendanceattendance-pbattendance-u-pbbr633hp15ap10br389ec34ec73ap71br325ec811school-pins1Find perfect attendance lapel pins discounted at TrophyCentral. Each perfect attendance pin features a clutch back for easily attaching to clothing. Shop with Ease at TrophyCentral! If you are looking to buy attendance pins for your students online, look no further! TrophyCentral has a great selection that will fit any budget. Our experts in New York and Michigan have been providing suggestions and guidance since 1999!]]>attendance-medals-pins school-pinscustom-pageperfect-attendance-pinsplastic-pinbox-t5lapel pins498551-20.525040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find this Perfect Attendance Gold Enamel lapel pin discounted at TrophyCentral. Features a clutch-pin back for easy attachment to clothing.. Fast 1-2 day shipping.attendance-u-pbAttendance, Academiccustom-pageec341"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceCertificates / CoversEmbosser Seals1:22%,3:28%,5:31%Find these Perfect Attendance Embossed Certificate Seals discounted at TrophyCentral.803pGeneralcustom-pageattendance-medals-pins1498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Perfect Attendance Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Perfect Attendance, Academiccustom-pageaward-medalsperfect-attendance-part-iperfect-attendance-single-iperfect-attendance-champ-iperfect-attendance-plaque-iperfect-attendance-e-part-iperfect-attendance-e-single-icup-attendance-in1trophies-academic1Find a great selection of perfect attendance trophies discounted at TrophyCentral. Also find perfect attendance awards, including certificates.Shop with Ease at TrophyCentral Be sure to browse our fabulous selection of student and school awards, all at discounted prices. Each Perfect Attendance medal includes a free neck ribbon. Trophy prices include engraving.]]>attendance-medals-pins academic-general-medalscustom-pageart-trophies1"3-6 business days with engraving, Without engraving: 1-3 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"plaques105503-610.4511219.65Classic MedallicsPlaquesInsert1:22%,3:24%,5:27%Genuine Walnut Performing Arts / Film Plaque with 2 Inch Insert and Free Engraving.51-7826Art, Academiccustom-pagedance-templates-free1"Download Only"free-certificate4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Performing Arts template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Performing-Arts-Certificateperforming-arts-freePerforming Artscustom-pagedrama-medals-pins12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105502-41130025Classic MedallicsInsertsMusic, Drama, Art, Dance1:22%"Award Medals" "Art / Dance / Drama Medals" "Award Medals - All Subjects" "Drama Awards" "Drama Trophies" "Drama Trophy"517826Drama
custom-pageengravingplates11"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"458221513.0010010.45Vision AwardsEngraving Plates1:22%"Engraving"Perpetual Fascination Engraved Plates from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.custom-pageperplaq11"7-10 business days w/engraving" "Chicago, Illinois" "UPS (FedEx available on request)"498554-61 3 230.451020.45RS Owens1:22%custom-pageplaquesperplaqplatperpetual-2perpetual-3perpetual-plate-for-goat-trophypefaenpl1plaques1Find perpetual plaque plates discounted at TrophyCentral. Each perpetual plaque plate includes expert custom text engraving.

Perpetual Plaque Plates - The Unsung Heroes of Ongoing Recognition

Engraving plates transform perpetual plaques from one-time investments into endlessly renewable recognition systems, delivering the practical magic where a single wall display serves organizations faithfully across decades through simple nameplate additions rather than complete plaque replacements. These small brass or aluminum rectangles featuring custom engraved text slip into perpetual plaque slots via magnetic backing or traditional screw mounting, adding new honorees chronologically while maintaining visual consistency across years of recognition. Perfect for updating Employee of the Month displays monthly without ordering new plaques, adding donor names to contribution walls as campaigns progress, documenting championship team rosters season after season, recognizing academic achievers each semester, and correcting those inevitable typos discovered after original installation when someone notices their name spelled creatively. Available in standard sizes matching most perpetual plaque configurations including half-inch through one-inch heights and two through four-inch widths, with finish options spanning black brass plates accepting gold or silver text, gold plates featuring black engraving, and silver aluminum alternatives. Magnetic versions cost slightly more but eliminate installation tools and avoid cumulative screw holes from years of updates, while traditional mounted plates provide security against accidental removal in high-traffic areas where curious hands might rearrange organizational history.

Complete your recognition display: Explore Perpetual Plaques, Explore Perpetual Trophies, and Explore Award Plaques for your recognition needs.

Frequently Asked Questions About Perpetual Plaque Plates

How do you determine the correct engraving plate size for an existing perpetual plaque?

Matching replacement plates to existing perpetual plaques requires measuring current nameplates precisely rather than guessing based on plaque dimensions. Use a ruler to measure an existing plate's width and height in inches, noting whether measurements include any visible border or represent only the engraved surface area. Common perpetual plaque plate sizes include half-inch by two-and-three-quarter-inch for compact displays, three-quarter-inch by three-inch for standard recognition, and one-inch by four-inch for larger formats, though dozens of size variations exist across manufacturers and plaque styles. When ordering, verify finish colors match existing plates since black brass with gold text differs noticeably from gold brass with black engraving, and mismatched finishes create distracting visual inconsistencies across plaque surfaces. If possible, photograph existing plates with a ruler visible for scale, helping suppliers confirm correct specifications before production. Organizations without access to original plaque sources sometimes remove a single existing plate temporarily for measurement verification, though this works only with magnetic or easily removable mounted plates.

What happens when you discover an engraving error after installing a nameplate?

Engraving mistakes discovered post-installation cause immediate panic followed by practical problem-solving depending on error severity and plate attachment methods. Minor errors like missing periods or slight spacing irregularities often go unnoticed by anyone except the perfectionist who ordered the plaque, making replacement optional rather than mandatory. Significant mistakes including misspelled names, wrong dates, or transposed information demand immediate correction to avoid permanent embarrassment and recipient disappointment. Magnetic plates allow quick error correction by simply removing incorrect plates and ordering replacements without visible damage to the plaque itself. Traditional mounted plates require careful removal with screwdrivers, potentially leaving visible screw holes if new plates shift positions slightly during reinstallation. Some organizations strategically position replacement plates to cover previous screw marks, while others embrace the minor imperfections as evidence of authentic recognition history rather than pristine but sterile displays. Reputable suppliers typically replace genuinely incorrect engraving at no charge when errors result from their mistakes rather than customer-supplied information.

Can you mix different engraving plate finishes on the same perpetual plaque?

Technically possible but visually questionable, mixing plate finishes on single perpetual plaques creates intentional or accidental tiered recognition systems where finish variations signal achievement levels or simply result from inconsistent ordering over time. Some organizations deliberately use gold plates for first-place winners, silver for runners-up, and bronze for third-place finishers, with finish differences communicating achievement hierarchy instantly. However, most perpetual plaques benefit from finish consistency maintaining visual cohesion across all nameplates regardless of when individuals earned recognition. Organizations discovering their original plate supplier discontinued or changed finishes face difficult choices between accepting mixed finishes going forward or replacing all existing plates for consistency. The latter option proves expensive and erases visible recognition history, while mixed finishes appear careless unless deliberately designed as tiered systems. Forward-thinking administrators document exact plate specifications including manufacturer details when establishing perpetual plaque programs, ensuring consistent replacement ordering across decades even as staff turnover eliminates institutional memory about original sourcing decisions.



If you need more information before deciding, see our expert resource section:
]]>
tagsbadges perplaq
custom-pagegeneral-corporate-awardsdplt043starplaquefs-166xperplaqcomsorosewood-perpetual-plaqueglpeplcomingsoon8101x13peplwpeapeplpepl14x20wpp12wpp18wpp24wpp36wpp45wpp60opp12opp18opp24epp12epp18epp241plaques2-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
498555-8.52Shop perpetual plaques and perpetual name plaques to honor ongoing achievements. Ideal for employee of the month, donor walls, and team recognition. Free engraving, many styles, and fast shipping.

Perpetual Plaques - Building Recognition History One Name at a Time

Perpetual plaques solve the eternal recognition dilemma where honoring monthly or annual achievements with individual awards creates storage nightmares and budget headaches, while verbal acknowledgment alone fails to satisfy anyone who just earned Employee of the Month and wants proof. These multi-nameplate wall displays accumulate winners chronologically on removable brass or aluminum plates arranged in elegant rows beneath header plates announcing the honor, creating living timelines of excellence visible to everyone passing the lobby, break room, or trophy hallway. Perfect for employee recognition programs tracking monthly standouts across years, donor walls acknowledging cumulative contributions without commissioning new plaques annually, sports teams documenting championship seasons and MVP selections, academic institutions celebrating honor roll achievements semester after semester, and volunteer organizations recognizing service milestones while maintaining permanent displays. Available in wood finishes including walnut, cherry, oak, and rosewood piano finishes delivering various levels of formality, with nameplate capacities ranging from compact 12-plate versions suitable for quarterly awards through expansive 60-plate monuments accommodating five years of monthly recognition. Magnetic plate options simplify updates by eliminating screws, though traditional mounted plates provide more permanent attachment preventing curious fingers from rearranging corporate history.

Expand your recognition program: Explore Award Plaques and Shop Additional Perpetual Engraving Plates for nameplate updates.

Frequently Asked Questions About Perpetual Plaques

How do organizations handle perpetual plaques after filling all available nameplate spaces?

Smart recognition programs anticipate this inevitable moment through capacity planning before mounting plaques permanently. Organizations typically choose between starting fresh with new plaques while archiving completed ones in alternate locations maintaining historical records, removing oldest nameplates to accommodate new winners creating rolling recognition windows, or expanding recognition by hanging additional plaques nearby forming gallery walls documenting decades of achievement. The replacement cycle depends on nameplate quantity and award frequency, with 24-plate versions supporting two years of monthly recognition before requiring decisions. Some programs deliberately select larger 45 or 60-plate configurations postponing capacity concerns for years, though massive plaques demand substantial wall space and may overwhelm smaller offices. Forward-thinking organizations photograph completed plaques before storage, maintaining digital archives ensuring past recipients remain documented even after physical displays move to storage rooms or executive offices.

What happens when someone wins the same perpetual award multiple times in non-consecutive periods?

Repeat winners present interesting chronological challenges since perpetual plaques document achievements sequentially rather than grouping by individual. Most organizations simply add new nameplates each time someone earns recognition, creating patterns where the same names appear multiple times throughout the display documenting their consistent excellence. This approach maintains historical accuracy showing exactly when achievements occurred while celebrating sustained performance visibly. Some programs add special indicators like stars or asterisks beside repeat winner names, though this requires custom engraving beyond standard nameplate formats. The visible repetition often becomes a point of pride for both individuals and organizations, with multiple appearances signaling exceptional sustained performance rather than recognition system failures. Observers scanning completed perpetual plaques can identify star performers instantly by spotting repeated names, creating informal hall of fame effects without requiring separate recognition tiers.

Should organizations choose magnetic plates or traditional mounted plates for perpetual plaques?

Magnetic plates offer undeniable convenience for organizations updating plaques monthly or correcting occasional engraving errors, eliminating screwdrivers and avoiding repeated drill marks from plate changes. They work beautifully in professional offices where adult supervision prevents tampering and in spaces where easy updates justify slightly higher costs. Traditional mounted plates suit settings requiring maximum security, including schools where curious students might rearrange magnetic displays during unsupervised hallway moments, high-traffic public areas where accidental bumps could dislodge plates, or organizations valuing the permanence symbolism of screwed-down achievement records. The practical difference matters less than perception in some environments where traditional mounting suggests greater prestige through its apparent permanence. Cost-conscious buyers appreciate traditional plates for their lower price points, while efficiency-focused administrators favor magnetic convenience despite premium pricing. Most suppliers offer both options across similar plaque styles, allowing organizations to match their specific security needs and update frequency against budget constraints.



]]>
photoplaques champion-perpetual-trophies
custom-pageengravingplates1"4-7 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"105503-60.431251.18Classic Medallics1:22%,10:21%"Engraving"custom-pageengravingplates1"7-10 business days" "Marquette, MI" "UPS (FedEx available on request)"498554-620.005020.43RS Owens1:14%,10:16%Perpetual Plaque Replacement Plates For -RS Plaques from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.perpetual-2custom-pageengravingplates1"4-6 business days" "Marquette, Michigan" "UPS"498553-610.05020.43TrophyCentral1:14%,10:17%Find this Replacement Perpetual Name Plates (For TrophyCentral Plaques) Discounted at TrophyCentral.perpetual-3custom-pagechampion-perpetual-trophies1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"perpetual trophies105503-610.451 2 3 4 5 6 7 8 9110.85Classic MedallicsTrophies1:22%"Minuteman" "Special Picks"See this Silver Cup Award at discounted at TrophyCentral. Free Engraving.10-09-2011Cupcustom-pagechampion-perpetual-trophies1"7-10 business days w/engraving" "Chicago, Illinois" "UPS (FedEx available on request)"perpetual trophies606307-101 3 230.45114.45RS Owens1:22%custom-pagecup-trophies-large-and-smalltr7218tr7219tr7220cup-trophy-pnoname3perpetual-trophieschamp-cup-tcgoat-award1cup-trophies-large-and-small1Perpetual trophies honor every champion year after year. Shop cups, revere bowls, and team awards with free engraving. Perfect for fantasy football, sports leagues, and annual competitions.

Custom Perpetual Trophies - Build a Tradition of Champions

Perpetual trophies create a living record of achievement that no single-winner award can match, accumulating the names of every champion across seasons, years, and decades into one prestigious award that becomes more impressive with every engraving added. From fantasy football leagues where bragging rights follow the trophy from winner's home to winner's home all year long, to recreational sports leagues whose champions etch their team names alongside every predecessor, from office sales competitions and corporate award programs that recognize top performers annually, to chess clubs, bowling leagues, golf associations, and academic competitions where the same title is contested year after year, a quality perpetual trophy transforms a single victory into a permanent chapter in a larger story of competition and excellence. Our selection includes champion's cups with a classic trophy silhouette ideal for any league or sport, perpetual classic trophies with figure toppers and multiple side nameplates for teams and individuals, silver revere bowls and wine cooler trophies with the weight and presence of a true heirloom award, and large team sports perpetual trophies designed to accommodate many years of engraved champions. Every award includes free engraving on the main plate and first nameplate, with additional trophy nameplates available as your list of champions grows.

Frequently Asked Questions About Perpetual Trophies

What is a perpetual trophy and how does it work?

A perpetual trophy is a reusable award designed to be passed from champion to champion each year rather than kept permanently by one winner. The trophy features a main engraved plate identifying the award title and a series of smaller nameplates where each year's winner is engraved and added. The winner typically displays the trophy for the year until the next champion is crowned, at which point a new nameplate is added and the trophy is transferred. Over time the growing list of past champions gives the award a history and weight that a standard single-winner trophy cannot match.

What events and leagues are perpetual trophies best suited for?

Perpetual trophies are ideal for any recurring competition that crowns a new champion each season or year. Fantasy football leagues, recreational sports leagues in bowling, golf, tennis, and softball, chess clubs and card tournament series, office and corporate sales competitions, academic department awards, and family reunion competitions are all excellent uses. The key is a repeating event where the same title is contested annually and where building a visible record of past champions adds meaning and tradition to the competition.

What should perpetual trophy engraving include?

The main plate should include the award title and league or organization name, for example Fantasy Football League Champion or Annual Sales Cup. Each nameplate added for a new winner should include the winner's name or team name and the year. For team competitions, adding a brief record or season note such as 12-2 or Undefeated adds an extra layer of history. Keep individual nameplate text concise so the trophy can accommodate many years of champions without crowding.

If you need more information before deciding, see our expert resource section:
]]>
custom-pagepersonalizedleather-leathergifts1"4-7 w/initials or name, 10-14 w/logo , 3-5 business days for stock items, (rush service available for additional charge - please call)" "Secaucus, NJ" "UPS (FedEx available on request)"498554-710.451611.65JDS IndustriesGiftsLeather Gifts1"Leather Gifts" "Executive Gifts" "Leather Portfolio Cases" "Portfolio Cases" "Leather Portfolio Case"Find these Custom Bottle Openers discounted at TrophyCentral. Each Opener Features Your Personalized Message. No Minimum Quantity!Groomsmencustom-pagegifts-desk-general11"7-10 business days w/engraving" "Chicago, Illinois" "UPS (FedEx available on request)"606307-101 3 230.454822.05RS Owens1custom-pagecertificate-diploma-covers1logsetfordiplogoproof50"1-3 business days wo/imprinting, 8-14 days w/imprinting" "Columbia, South Carolina" "UPS (FedEx available on request)"diploma covers290631-31 2 3 230.4520020.45Certificate Source1:22%,100:39%custom-pagetrophies-football1"3-4 business days" "Medina, MN" "UPS (FedEx available on request)"trophies553404-710.454834.05JDSGiftsGeneral Gifts1:22%,2:24%"Football Awards" "Fantasy Awards" "Fantasy Football" "New Products"Personalized Fantasy Football Champion Coaster Set. Ideal for leagues, schools, and tournaments. Fast shipping.Football, Sportscustom-pagepersonalizedleather-leathergifts1"4-7 w/initials or name, 10-14 w/logo , 3-5 business days for stock items, (rush service available for additional charge - please call)" "Secaucus, NJ" "UPS (FedEx available on request)"personalized gifts498553-610.451611.65JDS IndustriesGiftsLeather Gifts1"Leather Gifts" "Executive Gifts" "Executive Business Gifts" "Business Holiday Gifts" "Business Gifts" "Business Holiday Gifts" "Holiday Gifts" "Corporate Business Gifts" "Corporate Christmas Gifts" "Corporate Holiday Gifts" "Leather Portfolio Cases" "Portfolio Cases" "Leather Portfolio Case"Find personalized keychains discounted at TrophyCentral. Each keychain is customized just for you and is available in several colors.custom-pageclocks2071401-5405-5410-5wrpa745-10745-5755-5743-53010755-8743-83050306-5742-5301-5756-9305-5746-55014301-8551555051270101-512901personalized-gifts1Find personalized leather gifts discounted at TrophyCentral. Each personalized leather gift features a name, monogram or initials for a special touch.

Personalized Leather Gifts - Custom Engraved with Names, Monograms, and Initials

Personalized leather gifts strike the balance between practical and personal that makes a gift genuinely memorable rather than decorative and forgettable. A laser engraved journal, portfolio, or keychain that someone uses every day keeps the recognition visible in a way that a trophy on a shelf or a plaque on a wall simply cannot, making leather gifts the right choice when the goal is to give something the recipient will actually carry, use, and associate with the person or organization who gave it. Our leatherette gift collection covers the full range of professional and personal gifting needs, from padfolios and business card holders suited for corporate client gifts and employee recognition to journals and travel accessories appropriate for graduation gifts, coach appreciation, volunteer recognition, and personal milestone celebrations. Laser engraving permanently marks each item with a name, monogram, initials, or short personal message in clean precise lettering that will not fade, peel, or wear away with daily use the way printed or stamped personalization often does.

Frequently Asked Questions About Personalized Leather Gifts

What is leatherette and how does it compare to genuine leather?

Leatherette is a synthetic material engineered to replicate the look, feel, and texture of genuine leather while offering several practical advantages for personalized gifts. The surface of leatherette accepts laser engraving exceptionally well, producing clean, consistent lettering and monogram designs that contrast sharply against the material and remain permanent through years of regular use. Genuine leather can vary in texture and density from piece to piece, which can cause inconsistent engraving results, while leatherette's uniform composition produces predictable, professional results across every item in an order. From a durability standpoint, leatherette resists moisture and staining better than many genuine leather grades, making it a practical choice for daily use items like journals, portfolios, and travel accessories that will see regular handling. The price point of leatherette also makes it practical to order personalized gifts in volume for corporate programs, team gifts, and recognition events where presenting the same quality item to every recipient matters. For buyers specifically seeking genuine leather, the key question to ask is whether the look and feel matter more than the consistency and durability that leatherette provides for personalized items.

What occasions are personalized leather gifts best suited for?

Personalized leather gifts work across a wider range of occasions than most recognition award types because the practical nature of the items makes them appropriate in both formal professional contexts and personal celebratory ones. Corporate client gifts and employee recognition programs use engraved padfolios, business card holders, and portfolios because they sit naturally in a professional setting and get used daily in a way that reinforces the relationship with the person or company who gave them. Coach appreciation gifts at the end of a sports season suit leather journals and portfolios well, particularly for coaches who will appreciate a practical item over a trophy. Graduation gifts benefit from the forward-looking nature of a journal or portfolio that the recipient will actually use in their next chapter rather than display from their past accomplishments. Retirement gifts pair well with engraved leather travel accessories or journals that signal the recipient's time is now their own. Volunteer appreciation, board member recognition, and end-of-year teacher gifts all suit personalized leather items when the goal is a gift that feels thoughtful and personal rather than a formal award that belongs on a wall or shelf.

What personalization options are available and what should I include?

Personalized leather gifts can be engraved with a name, monogram, initials, or a short personal message depending on the item and available engraving area. Monograms are the most classic choice for personal gifts, using the traditional three-initial format with the last name initial in the center and larger than the first and middle initials on either side, producing an elegant personal mark that works equally well for professional and personal gift contexts. Full name engraving suits corporate and recognition gifts where the item is meant to clearly identify the recipient, making it appropriate for employee gifts, coach appreciation, and formal recognition presentations. Short personal messages work well for milestone gifts where adding a year, occasion, or brief sentiment captures the context of the gift, such as Class of 2025, Congratulations or Thank You Coach, Fall Season 2025. For corporate programs ordering multiple items, engraving each with the recipient's name and a consistent second line such as company name or award title creates a cohesive recognition gift that feels personal to each individual while maintaining a uniform program appearance across the full order. Keep text concise since leatherette engraving looks cleanest with no more than two or three lines, allowing each element to be rendered at a size that is clearly legible and visually balanced on the item surface.

If you need more information before deciding, see our expert resource section:
]]>
custom-pagepersonalizedleather-leathergifts1"5-7 business days (Rush service may be available - please call to confirm)" "Indianapolis, IN" "UPS"462195-710.82020.8Cathys ConceptsGiftsLeather Gifts1Find Quality 2-piece Cosmetic Cases Set at TrophyCentral.12-31-2014Leather Giftscustom-pagepersonalizedleather-leathergifts1"4-7 w/initials or name, 10-14 w/logo , 3-5 business days for stock items, (rush service available for additional charge - please call)" "Secaucus, NJ" "UPS (FedEx available on request)"personalized gifts498554-710.451611.65JDS IndustriesGiftsLeather Gifts1"Leather Gifts" "Executive Gifts"Find these personalized journals discounted at TrophyCentral. Each journal features choice of color and is custom engraved for a special touch!custom-pagepersonalizedleather-leathergifts1"4-7 w/initials or name, 10-14 w/logo , 3-5 business days for stock items, (rush service available for additional charge - please call)" "Secaucus, NJ" "UPS (FedEx available on request)"498554-71 7 5 100.451611.65JDS IndustriesGiftsLeather Gifts1"Leather Gifts" "Executive Gifts" "Leather Portfolio Cases" "Portfolio Cases" "Leather Portfolio Case"Find these custom power banks discounted at TrophyCentral. Each charger features your personalized message! No minimums!Leather Gifts, Groomsmencustom-pagetagsbadges1"10-14 business days w/engraving" "Chicago, Illinois" "UPS (FedEx available on request)"6063010-141 3 230.4624415.1RS Owens11"4-7 business days" "Mt. Vernon, NY" "UPS"105503-6150301Find these fabulous personalized medals at TrophyCentral. Price includes the name of your school or organization imprinted on the front of the medal!personalized-medals-allcustom-pagegifts-desk-general1105503-610.4511218.451custom-pagecustomlapel1100"4 - 6 Weeks" "Mt. Vernon, N.Y." "UPS (FedEx available on request)"lapel pins1055028-4210.451200020.45Classic Medallicslapel-award-pinsGeneral1:30%,1000:56%"Custom Lapel Pins" "Custom Trading Pins" "Baseball Pins" "Football Pins" "Basketball Pins" "Soccer Pins" "Volleyball Pins" "Swimming Pins" "Tracking Pins"Find These Oval Shaped Custom Brass Lapel Pins Discounted at TrophyCentral. Add Your Own Artwork! Large Quantity Discounts!diestbrlapicustom-pagecustom-ribbons1verprinproof2100"5-7 business days, 14 business days with custom logo" "Topeka, Indiana" "UPS (Priority Mail also available)"ribbons465715-71 260.36Tower RibbonRibbons1:22%,500:31%,1000:46%,5000:60%Find this Personalized Pinked-Top Ribbon discounted at TrophyCentral. Fast Shipping on Personalized Ribbons - Great Choice of Colors.custom-pageblank-medals10medals498552-40.525033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%This medal features an engravable front rim and a personalized front for your logo or artwork.custom-pagefreeawardcertificates1"Download Only"certificates49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Pet Adoption Award certificate templateFree-Pet-Adoption-Award-Certificatepet-adoption-awardPet Adoptioncustom-pagepersonalized-gifts11personalized gifts105503-610.4511610.85Classic MedallicsGiftsEngraved Frames1:22%"Graduation Gifts" "Graduation Gift"Shop for Pewter "Congratulations" Frames from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.Engraved Framescustom-pagekeychains21105502-40.39125035.39Classic MedallicsGiftsKeychains1:22%,10:25%,25:32%,50:39%,100:47%Find these popular Pewter Firefighter Key Chains at TrophyCentral; discounted prices! Add Optional Engraving for a Special Touch!pk95-cmKeychainscustom-pagekeychains21105502-40.39125035.39Classic MedallicsGiftsKeychains1:22%,10:25%,25:32%,50:39%,100:47%"Volleyball Awards"Find these popular Pewter Volleyball Key Chains at TrophyCentral; discounted prices. Add Optional Engraving for a Special Touch!pk66-cmKeychains1105502-41Find these popular Pewter Key Chains, Available in a large number of subjects, discounted at TrophyCentral!pewter-keychain-allcustom-pagephotoplaques11plaques105503-610.4511626.051"Plaques" "Trophies and Plaques" "Plaques and Trophies"custom-pagesimenplaq8x10photo9x12photo7x9photopictureplaquecomingsoon8picplaqmotdapn60xxpn605xstanclocwitp1plaques1Shop custom photo plaques and picture plaques with free engraving. Perfect for employee recognition, schools, memorials, and events with fast, professional results. Custom Photo Plaques for Recognition and Display

Create a unique and personal award by adding a photo to your plaque design. Whether you are recognizing employee achievements, honoring years of service, celebrating academic milestones, or commemorating special events, photo plaques provide a memorable way to capture both the moment and the message. Choose from multiple layout options, engraving styles, and mounting choices to match your needs.

Frequently Asked Questions

What are photo plaques used for?

Photo plaques are used to recognize achievements, commemorate special events, and preserve meaningful moments. They are popular for employee recognition, academic awards, retirement gifts, memorials, and event displays where both a photo and personalized message are important.

What materials are available for photo plaques?

Photo plaques are available in a variety of materials and finishes depending on the specific product. Options may include wood, metal, acrylic, and full-color designs, giving you choices from traditional recognition plaques to more modern photo awards.

Is engraving included with photo plaques?

Yes, at TrophyCentral engraving is included on most photo plaques. You can add names, dates, titles, and custom messages to create a personalized and meaningful award.

How long does it take to receive a custom photo plaque?

Most photo plaque orders ship within 1-2 business days after approval. Rush options are available if you need your award by a specific date.

Are photo plaques suitable for corporate and professional use?

Yes. Photo plaques are widely used for employee recognition, leadership awards, company milestones, and retirement gifts. They offer a professional way to combine visual impact with formal recognition.

What size photo plaque should I order?

Photo plaques are offered in standard sizes, such as 8" x 10", with exact options varying by product. Please review the individual product details to confirm available sizes, materials, and layout options before ordering.

Can photo plaques be used for memorials?

Yes, photo plaques are a popular choice for memorial displays. They provide a lasting way to honor and remember individuals with a meaningful image and engraved message.

What is the difference between photo plaques and picture plaques?

Photo plaques and picture plaques generally refer to the same type of award: a plaque that combines an image with personalized text. Both terms are commonly used for awards, recognition gifts, memorials, and display pieces.

]]>
simenplaq
custom-pagephotoplaques1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"plaques105503-610.451510.45Classic MedallicsPlaques1:22%Shop for Photo Sport Plaques from TrophyCentral. Free Engraving on Photo Plaques.custom-pageart-trophiesphotography-plaque-iphotography-ei1trophies1Find photography trophies discounted at TrophyCentral. Each photography trophy includes free personalization and most ship in just 1-2 days.

Photography Trophies and Awards - Honor the Art Behind Every Image

Photography awards recognize the technical skill, artistic vision, and patient dedication that produces a truly exceptional image. From middle school and high school fine arts programs presenting end-of-year photography awards to camera clubs running annual print competitions, from state and regional photo contests attracting hundreds of entries to university programs honoring graduating seniors with distinguished achievement in photography, quality awards give tangible form to an accomplishment that might otherwise exist only as a digital file. Our photography trophy collection features camera figurine designs in a range of sizes from economy participation trophies to impressive single-column awards for category winners and overall champions. Photography medals with free neck ribbons offer an affordable alternative suited for large competitions recognizing multiple placement levels across several categories. Photography plaques provide a permanent wall-mounted recognition option for studios, darkrooms, classroom displays, and program offices where the award will be seen by future students and competitors for years to come. Every photography award includes free engraving personalized with the photographer's name, award title, competition name, and year, and photography medals include a free neck ribbon for immediate wearable presentation at the awards ceremony.

Frequently Asked Questions About Photography Trophies and Awards

What types of photography competitions and events use these awards?

Photography competitions and events that commonly use these awards include camera club annual competitions that judge prints across landscape, portrait, wildlife, macro, and black and white categories, typically presenting trophies to first through third place winners in each category and an overall best in show. School and university fine arts programs present photography awards at end-of-year exhibitions recognizing outstanding work across skill levels. State and county fairs include photography divisions within their fine arts judging, where ribbons and medals recognize placement across multiple subject and technique categories. Corporate and nonprofit photography contests used for marketing, community engagement, and fundraising campaigns increasingly present physical awards alongside prizes to give recognition a tangible element. Youth photography programs and summer art camps use participation trophies to encourage young photographers completing their first formal instruction, building confidence and enthusiasm for continued creative development.

What engraving details work best for photography trophies and awards?

The engraving details that work best for photography trophies and awards capture the specific achievement and category clearly so the award remains meaningful as a keepsake long after the competition. Essential elements include photographer name, placement or award title, competition or event name, category if applicable, and year. For example: Daniel Park, First Place, Landscape Photography, Metro Camera Club Annual Exhibition, 2025, or Sofia Reyes, Best in Show, Jefferson High School Fine Arts Showcase, Spring 2025. Category-specific awards gain clarity from including the subject or technique, such as Wildlife Photography, First Place or Portrait Series, Judges Award. School program awards benefit from including the teacher or program name alongside the school. For large competitions with many categories, keeping the engraving to placement, category, competition name, and year ensures the text remains clean and readable without requiring a longer engraving plate. When the competition has a distinctive name or the award is part of a named series, leading with that program name reinforces the prestige of the recognition.

Should photography competitions use trophies, medals, or plaques?

The best choice for photography competitions depends on the format and scale of the event and how the awards will be presented and displayed afterward. Photography trophies are the strongest choice for overall winners and category champions where a standing award communicates the prestige of the top placement and gives the recipient something distinctive to display at home or in a studio. Medals with neck ribbons suit large multi-category competitions where recognizing first through third place across many categories simultaneously is practical and budget-conscious, and where immediate wearable presentation at the awards ceremony adds to the moment. Plaques are particularly well suited to photography recognition because they can be hung near the winning image itself in a studio, classroom, or exhibition space, pairing the physical award with the work it honors. Many photography programs combine formats, presenting trophies to overall and best in show winners, medals to category placers, and a permanent plaque for the program wall recognizing the competition's top honor year over year. See our complete collection of award medals and award plaques for all available styles.

If you need more information before deciding, see our expert resource section:
]]>
photography-medals star-trophies
custom-pagephotography-trophies-and-awards1trophies498551-310.452429Trophies1Find this popular Photography trophy discounted at TrophyCentral. Features a real marble base, free engraving and fast shipping.photography-cup-place-trophy-icustom-pagephotography-trophies-and-awards1medals498551-30.5100021TrophyCentralInsertsSports, Hobby, Org, Livestock1Find this fabulous Photography 2" epoxy-covered insert sticker discounted at TrophyCentral. Fast 1-2 day shipping.Photographycustom-pagefree-sports-templates1"Download Only"certificates4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Photography template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Photography-Certificatephotography-freePhotographycustom-pagephotography-trophies-and-awards11Discover 15+ creative photography award ideas with engraving examples. From Master of Light to Portrait Perfectionist, find the perfect way to recognize your photo club members and visual artists. Free engraving included.11Discover the ultimate photography trophy and medal guide! From camera club competitions to professional contests, find creative award ideas that celebrate photographic excellence and artistic vision.custom-pagephotography-trophies-and-awards1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Photography epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Photographycustom-pagephotography-trophies-and-awards1trophies498551-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Photography insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Photography11Explore photography club recognition ideas for schools, camera clubs, and creative organizations. Discover meaningful ways to celebrate artistic growth, technical excellence, mentorship, and community contribution.custom-pagephotography-trophies-and-awards1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Photography single column insert trophy features a choice of column color, a marble base and free trophy engraving.Photographycustom-pagephotography-trophies-and-awards1trophies498551-311821.06TrophyCentraltrophies1Photographycustom-pagephotography-trophies-and-awards1trophies498551-310.71217.38trophies1Photographycustom-pagephotography-trophies-and-awards1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Photography epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Photographycustom-pagephotography-trophies-and-awards1medals498551-30.525035.5TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find this fabulous Photography insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Photographycustom-pagephotography-trophies-and-awards1medals498551-30.525035.5TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find this Photography insert medal with a personalized front rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Photographycustom-pagephotography-trophies-and-awards1plaques498551-311.1Plaques1Find these Photography insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Photography11Find photography medals in a variety of sizes and styles. Choose from several popular finishes, including gold, silver and bronze. Each photography award medal includes a ribbons. Fast 1-2 day shipping.Shop for Photography Award Medals with Ease Our photography medals are a perfect way to recognize photo contest winners, photography students or anyone you want to recognize. We have gold, silver and bronze medal frames for contests with multiple place winners.]]>photography-trophies-and-awardscustom-pagephotography-trophies-and-awards1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our photography insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Photographycustom-pagephotography-trophies-and-awards1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Photography epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Photographycustom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these high-quality Physical Fitness Inserts at TrophyCentral. Each Physical Fitness Insert can be used to create a unique plaque, medal or trophy.517334Physical Education
custom-pagetrophies-music1medals498551-30.525033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Piano Keys 2 1/4" Antique Gold Medal Discounted at TrophyCentral. Each medal features a free ribbon. Fast shipping!Music / Band / Choruscustom-pagemusic-certificate-templates1"Download Only"free-music49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Piano template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Piano-Certificatepiano-freePiano, Musiccustom-pagemusicartpins1plasticpinboxvelapinbox1"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsMusic, Drama, Art, Dance1:30%,50:34%,100:38%"Music Lapel Pins" "Band Lapel Pins" "Band Awards" "School Pins"Find These Piano Excellence Pins Discounted at TrophyCentral. Each Piano Excellence Lapel Pin features a clutch-back for safe attachment to clothing.br586Music / Band / Choruscustom-pagemusicartpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsMusic, Drama, Art, Dance1:22%,50:30%,100:33%,500:45%"Music Lapel Pins" "Band Lapel Pins" "Music Pins"Find These Piano Lapel Pins Discounted at TrophyCentral. Features a Clutch-Pin Back and Fast 1-2 Day Shipping!mp14Music / Band / Choruscustom-pagetrophies-music12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsMusic, Drama, Art, Dance1:22%,100:28%,500:34%,1000:45%"Music Awards" "Award Medals - All Subjects" "School Medals" "Music Medals"These inexpensive 1 1/4 inch Piano Medals offer a high quality, but low price for those on a tight budget.e984701-30-2019Music / Band / Chorus
custom-pagekeychains21105502-40.39125035.39Classic MedallicsGiftsKeychains1:22%,10:25%,25:32%,50:39%,100:47%Find these popular Pewter Piano Key Chains at TrophyCentral; discounted prices!pk96-cmKeychainscustom-pagenew-trophies-21trophies498551-310.452429Trophies1Find this popular Pick-up Truck trophy discounted at TrophyCentral. Features a real marble base, free engraving and fast shipping.pick-up-truck-cup-place-trophy-tccustom-pagepickleball-templatespickleball-award-plaquepickleball-plaque-i1trophies1Shop pickleball trophies, medals and plaques for every level of play. Hundreds of styles for players, leagues and tournaments. Free engraving. Fast shipping.Custom Pickleball Trophies and Awards - Celebrate Every Dink, Drive, and Championship

Pickleball trophies recognize the skill, strategy, and competitive spirit of the fastest-growing sport in America. From recreational club play and beginner leagues introducing new players to the game, to competitive open and age-division tournaments for men, women, and mixed doubles, quality pickleball awards celebrate participants at every level. Our selection includes affordable participation trophies for club events and casual leagues, single and double column trophies with pickleball figurines for division winners, cup trophies and two-tier championship designs for tournament finals, and perpetual trophies ideal for clubs that honor the same title year after year. Every trophy includes free engraving personalized with player names, club, division, and season.

Frequently Asked Questions About Pickleball Trophies

What trophy styles work best for different pickleball events?

Column trophies with pickleball figurines are the most popular choice for recreational leagues and club tournaments, offering affordable recognition across multiple divisions and skill levels with free engraving for player names and event details. Cup trophies work well for open and competitive division championships where a more traditional award presentation is expected. Two-tier championship trophies with wood bases make a strong impression at larger regional tournaments where the top finishers deserve a standout award. Perpetual trophies are an excellent fit for established clubs that want a single trophy engraved with each year's champion rather than presenting a new award annually. Medals are a practical complement to trophies for large round-robin events or festivals where every participant receives individual recognition.

What size pickleball trophy is right for my event?

For casual club play and beginner events, 6-inch to 9-inch participation trophies strike the right balance between meaningful recognition and budget-friendly pricing across a large field of players. Competitive division winners at club tournaments are well served by 10-inch to 14-inch single column trophies that feel substantial without overshadowing the occasion. Open division and championship finalists at organized tournaments typically receive 15-inch to 18-inch trophies that make an impression at the awards table and display well at home. For overall tournament champions and annual club titles, a two-tier or cup trophy in the 18-inch to 24-inch range creates a memorable presentation moment that players will talk about long after the event.

What should pickleball trophy engraving include?

The most meaningful pickleball awards include player name, division or skill rating, finishing position, tournament or club name, and year. For example: Carol Bennett, Women's 4.0 Division Champion, Riverside Pickleball Classic 2025. For doubles teams, list both partners on the engraving plate. Club awards benefit from adding the club name and season, while recreational league trophies can keep it simple with player name, award title, and year. Keep text concise so it reads cleanly on the plate, and prioritize the details that will make the most sense to the recipient years from now when the trophy is on display.

Do you offer bulk pricing for pickleball tournaments and clubs?

Yes - prices drop significantly as order quantities increase, which is especially valuable for tournament directors recognizing multiple divisions, skill levels, and age brackets at a single event. Most organizers build a tiered order combining a standout championship trophy for each division winner with medals or smaller trophies for runners-up and all participants. Orders over $99 qualify for free economy shipping, and our team can provide a custom quote for large multi-division or multi-event orders. We have supplied trophies and medals for recreational clubs, competitive tournaments, and community events for over 25 years and can help you put together a complete recognition program that fits your budget.

]]>
trophies
custom-pagepickleball-trophies1trophies498551-310.452429Trophies1Find this popular Pickleball trophy discounted at TrophyCentral. Features a real marble base, free engraving and fast shipping.pickleball-cup-place-trophy-icustom-pagepickleball-trophies1trophies498552-310.45Trophy CentralTrophies1Find this popular pickleball figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!Pickleball, Sportscustom-pagepickleball-medals20medals498552-40.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful Pickleball 2" Epoxy-covered insert decal discounted at TrophyCentral. Fast 1-2 day shipping.Pickleball, Sportscustom-pagepickleball-trophies1medals498552-30.525033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Pickleball Paddle 2 1/4" Antique Gold Medal Discounted at TrophyCentral. Each medal features a free ribbon. Fast shipping!Pickleball, Sportscustom-pagepickleball-templates1"Download Only"free-sports4985501Trophy CentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Men's Doubles Pickleball template is free and designed exclusively for Trophy Central. Award certificate templates measure 11" x 8 1/2" and can be easily downloaded and printed.pickleball-mens-doublespickleball-mens-doublesPickleball, Sportscustom-pagepickleball-templates1"Download Only"free-sports4985501Trophy CentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Men's Singles Pickleball template is free and designed exclusively for Trophy Central. Award certificate templates measure 11" x 8 1/2" and can be easily downloaded and printed.pickleball-mens-singlespickleball-mens-singlesPickleball, Sportscustom-pagepickleball-templates1"Download Only"free-sports4985501Trophy CentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Mixed Doubles Pickleball template is free and designed exclusively for Trophy Central. Award certificate templates measure 11" x 8 1/2" and can be easily downloaded and printed.pickleball-mixed-doublespickleball-mixed-doublesPickleball, Sportscustom-pagepickleball-templates1"Download Only"free-sports4985501Trophy CentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Women's Doubles Pickleball template is free and designed exclusively for Trophy Central. Award certificate templates measure 11" x 8 1/2" and can be easily downloaded and printed.pickleball-womens-doublespickleball-womens-doublesPickleball, Sportscustom-pagepickleball-templates1"Download Only"free-sports4985501Trophy CentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Women's Singles Pickleball template is free and designed exclusively for Trophy Central. Award certificate templates measure 11" x 8 1/2" and can be easily downloaded and printed.pickleball-womens-singlespickleball-womens-singlesPickleball, Sportscustom-pagepickleball-trophies1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Pickleball Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Pickleball, Sportscustom-pagepickleball-trophies1trophies498552-31Trophy CentralTrophies1Find these pickleball budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Pickleball, Sportscustom-pagepickleball-trophies1trophies498552-310.45Trophy CentralTrophies1Find this budget pickleball award trophy discounted at Trophy Central. Features a real marble base and plastic pickleball figure. Engraving is free. Fast 1-2 day shipping.Pickleball, Sportscustom-pagepickleball-trophies1trophies498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Pickleball insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-Pickleball-InsertPickleball, Sportscustom-pagepickleball-trophies1trophies498552-310.75Trophy CentralTrophies1Find these fabulous two-tier pickleball three-column trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!Pickleball, Sportscustom-pagepickleball-trophies1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Pickleball single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - PickleballPickleball, Sportscustom-pagepickleball-trophies1trophies498552-310.45Trophy CentralTrophies1This popular pickleball award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.Pickleball, Sportscustom-pagepickleball-trophies1trophies498551-311821.06TrophyCentraltrophies1Pickleball, Sportscustom-pagepickleball-trophies1trophies498552-310.45Trophy CentralTrophies1These quick-ship trophies from TrophyCentral feature a pickleball figure, real marble base and marble trophy figure platform, choice of column size and color.Pickleball, Sportscustom-pagepickleball-trophies1trophies498551-310.71217.38trophies1Pickleball, Sportscustom-pagepickleball-trophies1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Pickleball Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Pickleball, Sportscustom-pagepickleball-trophies1medals498552-30.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Colorful Pickleball insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Pickleball, Sportscustom-pagepickleball-trophies1medals498552-40.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Pickleball insert medal With A Personalized Front Rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Pickleball, Sportscustom-pagecherry-insert-plaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these pickleball insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Pickleball, Sports11Find pickleball medals discounted at TrophyCentral. Each pickleball medal includes a free neck ribbon.Shop for Pickleball Award Medals With Ease At TrophyCentral We have a great selection, discounted prices and top-rated customer service to help with all of your pickleball award needs. Need help? Contact our expert team in Michigan, New York and online. Also see our Be sure to also see our main pickleball trophies section. If you need more information before deciding, see our expert resource section: ]]>pickleball-trophiescustom-pagepickleball-trophies1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our pickleball insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - PickleballPickleball, Sportscustom-pagepickleball-trophies1trophies498552-310.45Trophy CentralTrophies1Our pickleball participation trophies feature a real slant-front white marble base and free personalization. Significant quantity discounts available.Pickleball, Sportscustom-pagepickleball-trophies1perpetual trophies498552-311.4Trophy CentralTrophies1Find this Perpetual Pickleball Trophy Discounted at TrophyCentral. Each Trophy has enough room for 32 names. Ships in just 1-2 days.Pickleball, Sportscustom-pagepickleball-trophies1plaques498552-41JDSPlaques1Find this pickleball plaque discounted at TrophyCentral. Our pickleball plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Pickleball, Sportscustom-pagesports-pinsplastic-pinbox-t5lapel pins498551-20.525040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find this Gold Pickleball Enamel lapel pin discounted at TrophyCentral. Features a clutch-pin back for easy attachment to clothing.. Fast 1-2 day shipping.pickleball-u-pbPickleballcustom-pagepickleball-trophies1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Pickleball Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Pickleball, Sportscustom-pagequickshiptrophies-pickup1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%This popular Pickup Truck Figure Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!qtvintagepickupyrcustom-pagetrophies-car-truckqtvintagepickupncqtvintagepickupscqtvintagepickupplqtvintagepickupyrqtvintagepickupttqtvintagepickupttwqtvintagepickup3cqtvintagepickupdmcup-vintagepickup-scbcup-vintagepickup-pmqtvintagepickupscb11Find a great selection of pickup truck trophies discounted at TrophyCentral. Each pickup truck trophy includes free personalization!

Shop with Confidence at TrophyCentral

We offer a huge selection, discounted prices and great customer service. Do you need help with some ideas or with ordering? Yes, we sell online, but we have real people who would love to help you! Feel free to call our customer service experts in Michigan, New York and online. TrophyCentral - delivering smiles since 1999!


]]>
quickshiptrophies-wheel racing-medals
custom-pagequickshiptrophies-pig1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Fabulous Pig Figure trophy with choice of 1st, 2nd or 3rd place trim.qtpigplcustom-pagequickshiptrophies-pig1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%This popular Pig Figure trophy features a real marble base, column, figure and trim indicating year of award. Includes up to three lines of free engraving!qtpigyrcustom-pagequickshiptrophies-pig1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with pig figure discounted at TrophyCentral. Includes free text engraving!cup-pig-pcustom-pagequickshiptrophies-pig1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these pig budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtpigscbcustom-pagequickshiptrophies-pig1498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Find this budget pig award trophy discounted at Trophy Central. Features a real marble base and plastic pig figure. Engraving is free. Fast 1-2 day shipping.bdg-pigcustom-pagequickshiptrophies-pig1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:26%Find these fabulous two-tier Pig Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtpigttcustom-pagequickshiptrophies-pig1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:28%See this championship trophy with a Pig figure at TrophyCentral. Be sure to see all of our Pig figure awards.qtpigttwcustom-pagequickshiptrophies-pig1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:21%,100:24%This popular Pig Figure Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtpigsccustom-pagequickshiptrophies-pig1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.05Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%These quick-ship trophies from TrophyCentral feature a Pig figure, real marble base and marble trophy figure platform, choice of column size and color.custom-pagequickshiptrophies-pig1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Pig figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-pig-scbcustom-pagequickshiptrophies-pig1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.4226Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:18%,10:23%Find these fabulous two-tier, 3-column champion Pig Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtpig3ccustom-pagequickshiptrophies-pig1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:27%,100:32%Our popular Pig Figure Participation Trophies feature a real slant-front marble base and free personalization. Significant quantity discounts available.qtpignccustom-pagequickshiptrophies-rabbitqtpigncqtpigscqtpigplqtpigyrqtpigttqtpigttwqtpig3cqtpigdmmqtpigscbcup-pig-pcup-pig-scbbdg-pig11Find Pig Trophies discounted at TrophyCentral. Each Pig (Hog) trophy includes engraving. Fast 1-2 day shipping.

Shop With Confidence at TrophyCentral

We offer a huge selection, discounted prices and top-rated customer service. Do you need help with some ideas or with ordering? Yes, we sell online, but we have real people who would love to help you! Feel free to call our customer service experts in Michigan, New York and online. TrophyCentral - delivering smiles since 1999!


]]>
quickshiptrophies-goat
custom-pagemedallion-inserts-general-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these quality Pigeons Flying Inserts (Litho) at TrophyCentral. Each Pigeons Flying Insert can be used to create a unique plaque, medal or trophy.502461General
custom-pageschool-pins1"1-2 business days" "Columbia, SC"lapel pins292121-31 2 3 230.65245.45Certificate Sourcelapel-award-pinsGeneral1:22%,50:28%,100:32%Find This Pin Presentation Box at TrophyCentral. This Box is Perfect for Displaying Your Favorite Pins.custom-pageaward-medalsqtpinencqtpinescqtpinedmqtpineyrqtpineplqtpinettqtpinettwqtpine3cqtpinetrqtpineperpmqtpinescbcup-pine-pcup-pine-scbbdg-pinewoodqsinplaqpinewoodqtdogderbypinewood-derby-cup-place-column-trophypinewood-derby-cup-place-trophy1trophies1"Trophies"Don't forget to recognize your outstanding scouts. See our great selection of pinewood trophies. Each pinewood derby trophy includes engraving!Shop for Pinewood Derby Recognition Trophies with Ease and TrophyCentral! TrophyCentral has a great online selection of high quality trophies, discounted prices and free personalization. We also have a top-rated customer service team waiting to help you. Be sure to see our Scout Derby Participation Trophies, popular with younger children. Our Single Column Trophies with a derby racer figure is also a customer favorite. Find the perfect award to celebrate your scouts in categories like speed, creativity, best in show and sportsmanship. ]]>first-place-ribbons 1st-place-medalscustom-pagetrophies-pinewood-derby-scouts1trophies498551-310.452429Trophies1Find this popular Pinewood Derby trophy discounted at TrophyCentral. Features a real marble base, free engraving and fast shipping.pinewood-derby-cup-place-trophy-tccustom-pagetrophies-pinewood-derby-scouts1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.85Quick TrophyTrophiesAcademic1:14%,10:18%,50:22%,100:25%Find this popular pinewood derby figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at trophyCentral. Ships in a fast 1-2 days!qtpineplPinewood Derby, 1st / 2nd / 3rd / Etc.custom-pagetrophies-pinewood-derby-scouts1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.85Quick TrophyTrophiesAcademic1:14%,10:18%,50:22%,100:25%Find this popular Pinewood Derby year trim trophy discounted at trophyCentral. Available in multiple sizes and includes free engraving.qtpineyrPinewood Derbycustom-pagetrophies-pinewood-derby-scouts1trophies498552-311821.06TrophiesAcademic1Find this achievement cup trophy with pinewood derby figure discounted at TrophyCentral. Includes free text engraving!cup-pine-pPinewood Derbycustom-pagefreeawardcertificates1"Download Only"certificates49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Pinewood Derby template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Pinewood-Derby-Certificatepinewood-derbyPinewood Derbyblog-trophycentral11custom-pagetrophies-pinewood-derby-scouts1trophies498552-312421.33TrophiesAcademic1Find these pinewood derby budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtpinescbPinewood Derbycustom-pagetrophies-pinewood-derby-scouts1498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Find this budget pinewood derby award trophy discounted at Trophy Central. Features a real marble base and plastic pinewood derby figure. Engraving is free. Fast 1-2 day shipping.bdg-pinewoodPinewood Derbycustom-pagetrophies-pinewood-derby-scouts1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.75219Quick TrophyTrophiesAcademic1:14%,3:19%,10:27%Find these fabulous two-tier Pinewood Derby Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtpinettPinewood Derbycustom-pagetrophies-pinewood-derby-scouts1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-411.215Quick TrophyTrophiesAcademic1:14%,3:19%,10:28%See this championship trophy with a Pinewood Derby figure at TrophyCentral. Be sure to see all of our Pinewood Derby figure awards.qtpinettwPinewood Derbycustom-pagetrophies-pinewood-derby-scouts1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.452421.33Quick TrophyTrophiesAcademic1:14%,10:18%,50:24%,100:28%This popular Pinewood Derby Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtpinescPinewood Derbycustom-pagetrophies-pinewood-derby-scouts1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451623.65Quick TrophyTrophiesAcademic1:14%,10:18%,50:24%,100:28%These quick-ship trophies from TrophyCentral feature a Pinewood Derby figure, real marble base and marble trophy figure platform, choice of column size and color.qtpinedmPinewood Derbycustom-pagetrophies-pinewood-derby-scouts1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-30.38150030Quick TrophyDog TagsSports, Hobby, Org, Livestock1:14%,10:15%Find these pinewood derby dog tags discounted at TrophyCentral. The price of each pinewood derby dog tag includes custom engraving and 24" chain!qtdogderbyPinewood Derbycustom-pagetrophies-pinewood-derby-scouts1trophies498552-311218.84TrophiesAcademic1Find this unique cup trophy with Pinewood Derby figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-pine-scbPinewood Derbycustom-pagetrophies-pinewood-derby-scouts1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-411.418Quick TrophyTrophiesAcademic1:14%,3:19%,10:24%Find these fabulous Champions Line Pinewood Derby Trophies discounted online at TrophyCentral. Quick 1-2 day shipping! Free Personalization!qtpine3cPinewood Derbycustom-pageholographic-insert-plaques1"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498852-310.45811.6Quick TrophyPlaquesInsert1:14%,3:14%"Pinewood Derby Awards"See this stunning Pinewood Derby plaque and other Holographic Plaques at TrophyCentral.qsinplaqpinewoodPinewood Derbycustom-pagetrophies-pinewood-derby-scouts1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.453633.4Quick TrophyTrophiesAcademic1:14%,10:17%,25:23%,50:29%,100:34%Our popular Pinewood Derby participation trophies feature a real slant-front marble base and free engraving.qtpinencPinewood Derbycustom-pagetrophies-pinewood-derby-scouts1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.4234Quick TrophyTrophies1:14%,3:15%,10:16%Find this Perpetual Pinewood Derby Trophy Discounted at TrophyCentral. Each Trophy has enough room for 32 names. Ships in just 1-2 days.qtpineperpReturn to thesection for additional choices.trophies-pinewood-derby-scoutsPinewood Derbycustom-pagemascot-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Pirate Mascot Badges Discounted At TrophyCentral.mascotbadges-piratecustom-pagemascot-plaques1plaques498552-41JDSPlaques1Find this pirate plaque discounted at TrophyCentral. Our pirate mascot plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Mascotcustom-pagemascottrophies1"4-6 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511016.25Classic MedallicsTrophiesAcademic1:22%,5:24%,10:28%,50:32%"Mascot Awards"Buy this Pirate mascot trophy and other mascot awards at TrophyCentral.mt2016Mascotcustom-pagemascotinserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsMascots1Buy these quality Pirates Mascot Medal Inserts at TrophyCentral. Each Pirates Insert can be used to create a unique plaque, medal or trophy.489927Mascot
custom-pagetrophies-marksman-shooting-rifle1medals498551-30.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful Pistols 2" Epoxy-covered insert decal discounted at TrophyCentral. Fast 1-2 day shipping.custom-pagetrophies-marksman-shooting-rifle1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Pistols Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.custom-pagetrophies-marksman-shooting-rifle1trophies498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Pistols insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-Pistols-Insertcustom-pagetrophies-marksman-shooting-rifle1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Pistols single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - Pistolscustom-pagetrophies-marksman-shooting-rifle1trophies498551-311821.06TrophyCentraltrophies1custom-pagetrophies-marksman-shooting-rifle1trophies498551-310.71217.38trophies1custom-pagetrophies-marksman-shooting-rifle1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Pistols Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.custom-pagetrophies-marksman-shooting-rifle1medals498551-30.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Colorful Pistols Insert Medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.custom-pagetrophies-marksman-shooting-rifle1medals498551-30.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Pistol insert medal With A Personalized Front Rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.custom-pagecherry-insert-plaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these pistols insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.custom-pagetrophies-marksman-shooting-rifle1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our pistols insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - Pistolscustom-pagetrophies-marksman-shooting-rifle1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Pistols Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.custom-pagefreeawardcertificates1"Download Only"free-sports4985501Trophy CentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Pistols template is free and designed exclusively for Trophy Central. Pistols certificate templates measure 11" x 8 1/2" and can be easily downloaded and printed.pistols-certificatepistols-frHunting / Shootingcustom-pageaward-medalsclasac1st-ei1achievement-medals1Celebrate champions with 1st Place Medals in gold, silver, and bronze. Perfect for sports, academic, and competition winners. Ribbons included, fast shipping.place-medals

🥇 1st Place Medals & Championship Awards - Honor Your Winners

First place medals represent the ultimate recognition of championship performance and competitive excellence across sports tournaments, academic competitions, science fairs, spelling bees, field days, and athletic events of every level. As the definitive symbol of victory and achievement, gold medals and first place awards provide prestigious, tangible recognition that winners display with pride for years to come. These quality awards feature durable metal construction with traditional gold, silver, and bronze finishes, detailed designs celebrating specific sports and activities, and free neck ribbons in coordinating colors for immediate presentation. Available in multiple sizes from budget-friendly 1.25-inch economy medals to impressive 2.75-inch premium designs, first place medals accommodate every budget while maintaining professional quality and lasting durability. Perfect for recognizing tournament champions, relay race winners, top academic performers, spelling bee victors, science fair champions, field day first place finishers, or any competitive achievement deserving of top honors, these medals create memorable recognition moments that motivate continued excellence and celebrate the dedication required to reach the pinnacle of competitive success in any field of endeavor.

Expand your recognition program: Explore Olympic-Style Torch Medals and Explore Blue Ribbons for timeless achievement recognition. Learn more: Gold Medal History & Olympic Tradition.

Frequently Asked Questions About 1st Place Medals

What size medals are best for different age groups?

For younger children (ages 5-10), 1.25-inch economy medals work well as they're lighter and easier to wear. For teens and adults, 2-inch to 2.75-inch medals provide a more substantial and prestigious feel. Consider the event significance when choosing size - championship tournaments typically warrant larger, premium medals while participation events may use smaller, budget-friendly options.

Do all 1st place medals come with ribbons?

Yes, all our first place medals include a free neck ribbon for immediate presentation. Ribbons are available in multiple colors including traditional blue for first place, red for second, and white for third. You can also choose ribbon styles-standard neck ribbons for most events or drape-style ribbons for more formal ceremonies and championship presentations.

Can 1st place medals be engraved or personalized?

Many first place medals offer optional engraving on the back, allowing you to add participant names, event dates, competition names, or achievement details. Some medals feature personalized rims where you can add custom text around the edge. Insert medals allow you to customize the center with logos, graphics, or event-specific designs for truly unique recognition.

]]>
custom-pagemedallion-inserts-general-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these quality Plain Wreath For Engraving Inserts (Litho) at TrophyCentral. Each Plain Wreath For Engraving Insert can be used to create a unique plaque, medal or trophy.507382General
11This popup shows sample colors for plaque fabric backing used in Waddell trophy cases. Choose a color to match your school or organizations branding.noindexed-items1TrophyCentralPlaquesSetup1:0%Plaques Proof from TrophyCentral.1custom-pagecup-trophies-large-and-smallstarplaque2blankplaquelapplaqcomso7x9medalframeblprplservice-anniversary-plaque9x7cherryh10x8cherryh12x9cherryh7x9cherryp8x10cherryp9x12cherryp9x7walnuth10x8walnuth12x9walnuth7x9walnutp8x10walnutp9x12walnutp9x7blackh10x8blackh12x9blackh7x9blackp8x10blackp9x12blackp9x7pianoh10x8pianoh12x9pianoh7x9pianop8x10pianop9x12pianopfloating-plaquesinsertplaquesperplaqgavelplaquescertificateplaquesphotoplaquesmascot-plaquescolor-wall-plaqueseagle-plaques-awardsengravingplates1index1Shop wood, glass, acrylic, and perpetual award plaques. - all with free custom engraving. Trusted since 1999, 4.9-star rated. Most orders ship in 1–2 business days.

Award Plaques - Personalized Recognition Built to Last

Award plaques occupy a unique place in recognition because they are built for permanence. Where trophies and medals sit on shelves and in drawers, plaques hang on walls, displayed in offices, hallways, lobbies, and reception areas where they are seen daily by colleagues, visitors, and future recipients who aspire to earn one themselves. That visibility makes the award choice matter. TrophyCentral's plaque collection spans every recognition need and setting, from engraved wood plaques in walnut, cherry, and rosewood finishes suited for individual employee and academic honors to perpetual plaques that add new name plates year after year, building a permanent record of a program's champions and outstanding performers. Photo plaques incorporate a personalized photograph alongside the engraved recognition for retirement tributes, memorial honors, and milestone celebrations where a name and title alone do not fully capture the person being recognized. Certificate plaques frame and protect diplomas and professional credentials under clear plexiglass for polished office display. Gavel plaques honor board officers, committee chairpersons, and organizational leaders completing terms of service. Every plaque in our collection includes free engraving and ships with the hardware needed for immediate wall mounting.

Frequently Asked Questions About Award Plaques

What plaque material and finish should I choose?

Plaque material and finish should match the setting where the award will be displayed and the culture of the organization presenting it. Walnut and cherry wood finishes are the most traditional and widely used choices, conveying warmth, craftsmanship, and timeless professionalism that suits corporate offices, school hallways, athletic facilities, and civic settings equally well. Rosewood finishes offer a slightly richer, darker tone that works particularly well for executive recognition and distinguished service awards where a premium appearance is appropriate. Black marble plaques present a sophisticated contemporary look suited for modern office environments and corporate recognition programs where a sleek aesthetic complements the workspace design. Acrylic plaques offer a lighter, more contemporary alternative that works well for creative industries, technology companies, and organizations with a modern brand identity. When building a recognition program that will present plaques across multiple years or categories, choosing a consistent material and finish across all awards creates a cohesive display that grows more impressive over time rather than looking like a collection of unrelated pieces.

What size award plaque do I need?

Plaque size should reflect the significance of the recognition and the amount of engraved text the award needs to accommodate. Small plaques in the 5x7 inch range work well for individual achievement recognition with concise engraving such as employee of the month or a single-year championship honor. Mid-size plaques in the 7x9 and 9x12 inch range are the most versatile, fitting comfortably on office walls and hallway displays while accommodating several lines of engraving including name, title, organization, a brief description of the achievement, and date. Large plaques in the 10x13 inch and larger range suit retirement tributes, distinguished service awards, and recognition pieces where the weight and presence of the award should match the depth of the accomplishment being honored. Perpetual plaques that will accumulate name plates over many years benefit from a larger base size that allows room for future additions without requiring a replacement plaque after only a few years of use. When in doubt, choosing one size larger than you initially consider is rarely a mistake since a plaque that feels slightly oversized at presentation almost always looks more impressive on the wall than one that feels cramped.

When should I choose a plaque over a trophy or medal?

Plaques are the right choice when the award is intended for permanent wall display, when the recognition involves a professional or organizational role rather than a competitive achievement, or when the setting where the award will live is a shared space like an office, hallway, or reception area rather than a personal desk or home shelf. Employee of the year, years of service milestones, board officer recognition, retirement tributes, donor appreciation, and coach and volunteer honors are all occasions where a plaque's wall-mounted permanence suits the nature of the recognition better than a freestanding trophy. Trophies are the stronger choice for athletic and competitive achievements where the figurine design communicates the activity and the award will be displayed in a personal space. Medals suit large events where wearable immediate presentation matters and portability is important. Many programs use plaques and trophies together, presenting a trophy at the awards ceremony for its visual impact and following up with a plaque for the recipient's office wall. See our complete collections of perpetual plaques, photo plaques, certificate plaques, and gavel plaques for all available styles.

If you need more information before deciding, see our expert resource section:
]]>
gavelplaques perplaq
custom-pagebadgeribbonsholders1"1-3 business days" "Topeka, Indiana" "UPS (FedEx available on request)"465711-31 260.36Tower RibbonRibbons1Find name badge holders at TrophyCentral. Each name badge holder is made of durable plastic. Fast 1-2 day shipping.custom-pagenoindexed-items11This page shows a sample of the 2" x 3" plastic badge holder from TrophyCentral. Each badge holder features a safety pin back.1custom-pagecup-trophies-large-and-smallqtcupncqtcupscqtcupdmqtcupyrqtcupplqtcupttqtcupttwqtcup3cmqtcupscbchamp-cup-tc11Shop for Plastic Cup Trophies from TrophyCentral. Each Cup Trophy Includes Free Engraving. Fast Shipping on Cup Trophies.cup-trophies-large-and-smallBe sure to see all of our fabulous

Shop for Cup Awards with Confidence at TrophyCentral

We offer a huge selection, discounted prices and top-rated customer service. Do you need help with some ideas or with ordering? Yes, we sell online, but we have real people who would love to help you! Feel free to call our customer service experts in Michigan, New York and online. TrophyCentral - delivering smiles since 1999!


]]>
custom-pagesoccerwaterbottles196"5-8 business days (rush service may be available for additional charge - please call)" "Los Angeles, CA" "UPS (FedEx available on request)"910105-810.453616.65Cosmo FiberPromotional ProductsWater Bottles1"PT=Promotional Products" "G=Him" "G=Her"Plastic Sports Bottles from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.Sports / Water Bottlescustom-pageribbons11muimse1woyoulipr100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Texas" "UPS (FedEx available on request)"7745310-1410.453618.45PepcoPromotional ProductsSpirit1Plastic Footballs. Ideal for leagues, schools, and tournaments. Fast shipping.Spiritcustom-pageservicepins21"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"105502-310.4517211.25Classic Medallics1:22%,50:30%,100:38%,500:47%Plastic Pin Presentation Box: Protect your special lapel pin with this enclosed pin box from TrophyCentral.noindexed-items11"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)""PT1=105502-310.45729.09Classic MedallicsLapel PinsGeneral1:22%,50:30%,100:38%,500:47%"Custom Lapel Pins" "Lapel Pins, Custom" "Custom Trading Pins"Shop for Plastic Boxes at TrophyCentral. Perfect for any lapel pin. We offer free shipping on award orders over $100.custom-pagebronze-stars1lapel-award-pins498551-310.457211.25TrophyCentrallapel-award-pins1:22%,50:30%,100:38%,500:47%This presentation pin box adds a special touch for presenting lapel pins. Made of plastic and measures: 1 1/4" x 1 1/4" x 7/8".custom-pagesoccerwaterbottlessportsbottles-goldsportsbottles-royalsportsbottles-redsportsbottles-whitesportsbottles-clear11"Basketball Water Bottles" "Logo Sports Bottles" "Sports Bottles" "Promotional Sports Bottles" "Aluminum Sports Bottles" "Stainless Water Bottles" "Aluminum Water Bottles" "Bike Water Bottles" "Bicycle Water Bottles" "Baseball Water Bottles" "Football Water Bottles" "Promotional Water Bottles" "Soccer Water Bottles"Find these plastic sports water bottles discounted at TrophyCentral. Each sports bottle includes a logo imprint. Perfect for soccer, baseball and more!11Find our Player Series Budget Trophies at TrophyCentral. Even at this great price, each budget trophy includes free engraving! Large quantity discounts available!Trophies to Recognize Participation These are TrophyCentral's most popular trophies and are often given to younger children. They have a great low price and a real marble base with a slant front so they don't feel cheap or light weight. Each participation trophy includes free personalization and most ship in just 1 to 2 business days (sometimes even the same day!)! ]]>custom-pagetrophies-cards-poker1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with cards figure discounted at TrophyCentral. Includes free text engraving!cup-cards-pcustom-pagetrophies-cards-poker1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these cards budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtcardsscbcustom-pagetrophies-cards-poker1498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Find this budget cards (poker) award trophy discounted at Trophy Central. Features a real marble base and plastic 5 card poker hand figure. Engraving is free. Fast 1-2 day shipping.bdg-cardscustom-pagetrophies-cards-poker1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.4234Quick TrophyTrophies1:14%,3:15%,10:16%Find this Perpetual Cards / Poker Trophy Discounted at TrophyCentral. Each Trophy has enough room for 32 names. Ships in just 1-2 days.qtcardsperpcustom-pagecrystalgifts6"7-10 business days" "Kentucky" "UPS (FedEx available on request)"personalized gifts410187-1010.45416.45JcharlesGiftsCrystal Gifts1:22%,100:22%"personalized gifts"Balanced on one corner, our plaza crystal paperweight with logo takes on a dynamic appearance! Shop our discounted paperweights today!Crystal Giftscustom-pagemascotpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:36%,100:46%,500:52%"Mascot Awards"Find These Blue Jays Lapel Pins with Antique Finish Discounted at TrophyCentral! Also See Our Other Fabulous School Mascot Pins. Fast 1-2 Day Shipping!pm26Mascotcustom-pagemascotpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:36%,100:46%,500:52%"Mascot Awards"Find These Buffalo Lapel Pins with Antique Finish Discounted at TrophyCentral! Also See Our Other Fabulous School Mascot Pins. Fast 1-2 Day Shipping!pm2505-01-2019Mascotcustom-pagemascotpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:36%,100:46%,500:52%"Mascot Awards"Find These Bull Dog Lapel Pins with Antique Finish Discounted at TrophyCentral! Also See Our Other Fabulous School Mascot Pins. Fast 1-2 Day Shipping!pm28Mascotcustom-pagemascotpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:36%,100:46%,500:52%"Mascot Awards"Find These Cowboy Saddle Lapel Pins with Antique Finish Discounted at TrophyCentral! Also See Our Other Fabulous School Mascot Pins. Fast 1-2 Day Shipping!pm22Mascotcustom-pagemascotpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:36%,100:46%,500:52%"Mascot Awards"Find These Eagle Lapel Pins with Antique Finish Discounted at TrophyCentral! Also See Our Other Fabulous School Mascot Pins. Fast 1-2 Day Shipping!pm2310-15-2011Mascotcustom-pagemascotpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:36%,100:46%,500:52%"Mascot Awards"Find These Falcon Lapel Pins with Antique Finish Discounted at TrophyCentral! Also See Our Other Fabulous School Mascot Pins. Fast 1-2 Day Shipping!pm15Mascotcustom-pagemascotpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:36%,100:46%,500:52%"Mascot Awards"Find These Knight Lapel Pins with Antique Finish Discounted at TrophyCentral! Also See Our Other Fabulous School Mascot Pins. Fast 1-2 Day Shipping!pm27Mascotcustom-pagemascotpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:36%,100:46%,500:52%"Mascot Awards"Find These Trojan Lapel Pins with Antique Finish Discounted at TrophyCentral! Also See Our Other Fabulous School Mascot Pins. Fast 1-2 Day Shipping!pm18Mascotcustom-pagemascotpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:36%,100:46%,500:52%"Mascot Awards"Find These Viking Lapel Pins with Antique Finish Discounted at TrophyCentral! Also See Our Other Fabulous School Mascot Pins. Fast 1-2 Day Shipping!pm1711-28-2011Mascot1"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"105502-31500301"Mascot Awards"Shop for Mascot Pins at TrophyCentral. We have a great selection of Mascots, including: panther, knights, bobcats and more!1pm-mascot-pinscustom-pagetrophies-cards-poker11"2-4 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"trophies105503-60.39125035.39Classic MedallicsGiftsKeychains1:14%Find this popular Poker Keychain discounted at TrophyCentral. Available with a gold or silver finish and with optional engraving on back.12-20-2020custom-pagetrophies-cards-poker1plasticpinboxvelapinbox1"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsSports, Hobby, Org, Livestock1:30%,50:34%,100:38%"Cards Pins"These poker pins discounted at TrophyCentral. Each poker lapel pin features a clutch-back and quality finish.lapelpin12-20-2020custom-pagetrophies-cards-poker11"2-4 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"trophies105503-60.75130042.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,500:42%Find these fabulous Poker Medals at TrophyCentral. Each Poker Medal includes a free neck ribbon!pokermedalcustom-pagetrophies-cards-poker5"Engraved: 3-5 business days, Without engraving: 1-3 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"105503-60.5115014Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"School Medals" "School Award Medals" "Scholastic Medals" "Scholastic Award Medals" "Academic Medals" "Academic Award Medals" "Medals, School"Your students will love these colorful Mylar Poker Medals from TrophyCentral. Each Poker medal includes a neck ribbon!tm9862custom-pagetrophies-cards-poker11"2-4 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"plaques105503-610.4513629.25Classic MedallicsPlaquesEngraved Plaques1:22%Shop for Poker Plaques (5" x 7") from TrophyCentral.custom-pagekeychains21105502-40.39125035.39Classic MedallicsGiftsKeychains1:22%,10:25%,25:32%,50:39%,100:47%Find these popular Pewter Police Officer Key Chains at TrophyCentral; discounted prices! Add Optional Engraving for a Special Touch!pk81-cmKeychainscustom-pagemedallion-inserts-occupational-subjects12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-31130025Classic MedallicsInsertsHero1:22%Buy these quality Police, GENERAL Inserts (Litho) at TrophyCentral. Each Police, GENERAL Insert can be used to create a unique plaque, medal or trophy.506691General
custom-pagesports-inserts1105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Pom Pom Girls Inserts (Litho) at TrophyCentral. Each Pom Pom Girls Insert can be used to create a unique plaque, medal or trophy.502591Cheerleading, Sportscustom-pagetrophies-golf1trophies-golf1Discover the most popular golf awards for tournaments including longest drive, closest to pin, hole-in-one recognition, and more. Complete guide with trophy selection tips and contest rules.12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
498555-8.521
12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
498555-8.521
custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these high-quality Power Lifting Inserts at TrophyCentral. Each Power Lifting Insert can be used to create a unique plaque, medal or trophy.517668Weightlifting, Sports
custom-pagemedallion-inserts-general-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these quality Praying Hands Inserts (Litho) at TrophyCentral. Each Praying Hands Insert can be used to create a unique plaque, medal or trophy.506701Religious
custom-pagequickshiptrophies-graduate1certificates290631-31 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,25:24%,100:40%,500:50%"Graduation Award" "Graduation Awards"Find this preschool certificate and other awards discounted at TrophyCentral. Preschool diploma certificates are beautifully printed; template measures 11 x 8 1/2 inches.971Pre-schoolcustom-pagequickshiptrophies-graduate102-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.5115014Classic Medallicsaward-medalsAcademic1:22%,25:24%,50:30%,100:36%,500:42%"School Medals" "School Award Medals" "Scholastic Medals" "Scholastic Award Medals" "Academic Medals" "Academic Award Medals" "Medals, School"Your students will love these colorful Preschool Graduation Medals from TrophyCentral. Each Preschool medal includes a neck ribbon!tm982805-25-2009Preschool
custom-pagegift-certificate-templates1"Download Only"certificates4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Gift Certificate template (design 2) is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.gift-certificate-design-2gift-certificate-a2Gift Certificate, Holidaycustom-pagegift-certificate-templates1"Download Only"certificates4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Gift Certificate template (design 5) is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.gift-certificate-design-5gift-certificate-a5Gift Certificate, Holiday, Christmascustom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these high-quality President's Award Inserts at TrophyCentral. Each President's Award Insert can be used to create a unique plaque, medal or trophy.51780112-20-2020General
custom-pagedisplaycases21medicapedestal1display case286125-1010.456108.45SpartaCraftDisplay CasesSpecialty Cases1:14%Buy this Presidential Display Case and other Flag Cases from TrophyCentral at discounted prices.Flag Casescustom-pageflagdisplay11286125-1010.453.45SpartaCraftDisplay CasesSpecialty Cases1:14%Presidential Display Cases: Pedestal from TrophyCentral.Flag Casescustom-pageflagdisplay11display case286125-1010.45660.45SpartaCraftDisplay CasesSpecialty Cases1:22%Find The Presidential Series Award Medal Display Case Discounted At TrophyCentral. Available In Cherry Or Walnut Finish.Ribbons / Medals Displaysnoindexed-items11Press Release from TrophyCentral. TrophyCentral is a Leading Online Supplier of Trophies and Awards.1custom-pagetrophy-award-guideschampionships-and-trophieshigh-school-academic-awardsbasketball-award-24high-school-football-2024amateur-tennis-2024-2025amateur-golf-2024-2025high-school-swimmingjames-beard-2024heisman-2024-2025high-school-track-awardscheerleading-2024spelling-bee-competitionsprestigious-science-awardsprestigious-music-awards11Prestigious awards defined, plus the most recognized honors in sports, academics, and entertainment - from Nobel Prizes to Olympic gold.custom-pagetop-awards-by-category11Explore the world of prestigious music awards, from the Grammys and Pulitzers to student competitions like All-State, YoungArts, and the Fischoff Chamber Music Competition.custom-pagetop-awards-by-category11Explore the world's most prestigious science awards, from the Nobel Prize to student science fairs. Learn their history, significance, and how they inspire future generations of scientists.custom-pageacademic-lamp-general12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105502-30.37115016.87Classic Medallicsaward-medalsAcademic1:22%,25:24%,50:30%,100:36%,500:42%Find this Principal's Award Antique Brass medal at TrophyCentral. Also see other great school and academic medals at discounted prices.Antique Brass Principal's Award MedalAcademic
custom-pageawardcertificates11certificates290631-31 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,25:24%,100:40%,500:50%Find these Principal's Certificates discounted at TrophyCentral. Each Principal's Certificate is beautifully printed and template measures 8 1/2 x 11.950Academiccustom-pageachievement-certificates-awards1"Download Only"free-academic4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Principal's Award template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Principal's-Award-Certificateprincipals-award-freeAcademic, Achievementcustom-pageschool-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:28%,100:32%,500:42%"School Pins" "School Lapel Pins"Find Principal's Award pins at TrophyCentral. Each AP Series Principal's Award pin includes a clutch back.ap72Academiccustom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these high-quality Principal's Award Inserts at TrophyCentral. Each Principal's Award Insert can be used to create a unique plaque, medal or trophy.518204General, Academic
custom-pageeawardmedals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsAcademic1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "School Medals"These inexpensive 1 1/4 inch Principal's Award Medals offer a high quality, but low price for those on a tight budget.e9930Academic
custom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these quality Mylar Principal's Award Decal Inserts at TrophyCentral. Each decal can be used to create a unique plaque, medal or trophy.489748Academic
custom-pageschool-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"Find these Principal's Award Pins at TrophyCentral. Each Principal's Award pin features a quality clutch back and ships in just 1-2 business days!br47102-20-2011Academiccustom-pageawardcertificates115"1-3 business days" "Columbia, South Carolina; Marquette, Michigan" "UPS (FedEx available on request)"certificates290631-21 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,50:38%,100:42%Find these Principal's certificates discounted at TrophyCentral. Each Principal's certificate measures 8 1/2 x 11 inches and typically ships in 1-2 days.7050Academiccustom-pageacademic-lamp-general102-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.5115014Classic Medallicsaward-medalsAcademic1:22%,25:24%,50:30%,100:36%,500:42%"School Medals" "School Award Medals" "Scholastic Medals" "Scholastic Award Medals" "Academic Medals" "Academic Award Medals" "Medals, School"Your students will love these colorful Mylar Principal's Medals from TrophyCentral. Each Principal's medal includes a neck ribbon!tm9748General, Academic
custom-pageschool-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:30%,100:35%,500:48%"School Pins" "School Lapel Pins"Find these popular Principal's Award HP Series Award Pins Discounted at TrophyCentral. Fast 1-2 Days Shipping!hp2210-31-2014Academiccustom-pageaward-ribbons-rosetteseventribbonsfunribbonsblue-ribbonsscoolribbonsrsubxxrsubxxcres6xx1esxstocawribwitflatstocpinrs2cx2dgsxresxrosetteribbonbaseball-ribbonsswimming-ribbonstrack-ribbonsbasketball-ribbonssoccer-ribbonsstockrosette11Shop printed award ribbons in stock, full color, and sport-specific styles for field days, classroom recognition, and youth sports leagues. Place ribbons from 1st through participant, sold in packs with fast 1-2 day shipping.award-ribbons-rosettes

Printed Award Ribbons - Ready-to-Present Recognition for Schools and Events

Printed award ribbons are the practical recognition solution for teachers, coaches, and event coordinators who need to present meaningful awards to large groups quickly and affordably. Where engraved trophies and medals require personalization lead time, printed ribbons ship fast and arrive ready to hand out at the next class, meet, or tournament. Available in economy 1-5/8 inch styles for maximum budget efficiency, standard 2 x 8 inch stock ribbons in traditional place colors, full color printed designs featuring sport-specific and subject-specific artwork, and ribbon sets with card and string attachment for immediate pinning, our selection covers every common recognition need from 1st through 3rd place finishes to participation acknowledgment to school subject awards. Sport-specific ribbon sets for baseball, basketball, soccer, swimming, and track include coordinating designs that connect the award to the activity, while school and fun ribbon styles serve classroom reward programs across grade levels and subjects.

Frequently Asked Questions About Printed Award Ribbons

What is the difference between stock ribbons, printed ribbons, and full color ribbons?

Stock ribbons are the most basic style, featuring a solid color fabric with a simple pre-printed title such as 1st Place, 2nd Place, or Participant in a single ink color. They are the most affordable option and work well for large field days, track meets, and youth league programs where volume matters most and budget is the primary consideration. Printed recognition ribbons add more graphic detail to the ribbon face, incorporating award titles with decorative borders or simple design elements that make the ribbon feel more distinctive than a plain stock style. Full color ribbons feature vibrant multicolor printed designs, often incorporating sport-specific imagery or detailed artwork alongside the award title, producing a finished ribbon that looks more substantial and visually appealing at presentation. Sport-specific ribbon sets such as those for baseball, basketball, soccer, swimming, and track use full color designs tied directly to the activity, making them ideal when you want the ribbon to immediately communicate both the achievement and the sport. The right choice depends on your budget, the size of your program, and how prominently the visual design of the ribbon matters to your recipients.

What occasions are printed award ribbons most commonly used for?

Printed award ribbons are used most heavily in elementary and middle school classroom recognition programs, where teachers distribute ribbons for reading milestones, spelling bees, math challenges, science fairs, and general academic achievement on a regular basis throughout the school year. School field days where students compete across multiple events in a single day represent another major use case, since printed ribbons can be handed out immediately after each event without any customization step. Youth sports leagues use place ribbons for end-of-season ceremonies and tournament finishes, particularly at younger age divisions where participation recognition is as important as competitive placement. County fairs, 4-H competitions, livestock shows, and community events with multiple competitive categories have a long tradition of ribbon presentation and rely on printed styles for their affordability and immediate availability. Event ribbons featuring general titles like Guest, Speaker, Volunteer, and Staff are also widely used at conferences, ceremonies, and organized gatherings where identifying roles visually helps manage large groups of attendees.

What is the difference between ribbons sold individually and ribbons sold with card and string?

Ribbons with a pinked top edge are designed to be pinned or attached directly to clothing, bulletin boards, or award displays. They are sold in packs and are the more economical format, suited for programs that pin ribbons onto shirts at the event or attach them to certificates and award packets after the fact. Ribbons sold with card and string include a small printed card at the top of the ribbon with a string loop, allowing the ribbon to be hung from a nail, pinboard, or display hook without pinning. This format is popular for classroom displays where ribbons are shown on a wall or bulletin board as part of an ongoing recognition program, and for county fair and livestock show presentations where ribbons are traditionally hung on stall doors or display panels. Both formats are sold in packs of 25 for most styles, making it practical to stock up for an entire season or event series at one time.

If you need more information before deciding, see our expert resource section:
]]>
custom-ribbons rosetteribbons
custom-page12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
498555-8.52
custom-pagegifts-desk-general11"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"personalized gifts458221510.45416.45Vision AwardsGiftsEngraved Gifts1:22%,51:38%"New Products"Private Stock from TrophyCentral. Also see our great selection of engraved and personalized gifts!Engraved Giftscustom-pageaward-ribbons-printed10"1-2 business days" "Topeka, Indiana" "UPS (Post Office Priority Mail may also be available)"ribbons465711-21 263.00Tower RibbonRibbons1:22%,20:28%,50:34%,100:40%07-01-2022Blue Ribbon, Red Ribbon, Exhibitor, 1st / 2nd / 3rd / Etc., 4th Place, 5th Place, 6th Place, 7th Place, 8th Place, 9th Place, 10th Place, Honorable Mention, Participant, Achievement, Assistant, Chairman, Board Member, Best of Show, Chairperson, Co-Chairman, Co-Chairperson, Committee, Contestant, Director, Excellent, Exhibitor, Facilitator, Finalist, Grand Price, Good, Grand Champion, Hostess, Hospitality, Guest, Speaker, Host, Judge, Participation, Past President, Perfect Attendance, Official, Presenter, President, Press, Reserve Champion, Secretary, Treasurer, Staff, Steward, Sponsor, Usher, Vice President, Visitor, Volunteer, Winner, Meritcustom-pageglass-crystal-awards1"14 business days" "Erlanger, KY" "UPS"general410187-1010.451 2 3 4 5 6 7 8 9430.45JcharlesGeneral Awards1:22%,25:25%Allow achievements to shine brightly with our optical crystal Prizmas. These spectacular pieces feature bold geometric cuts and plenty of weight.05-05-2017custom-pagecrystalcups1"10 business days" "Kentucky" "UPS"general410187-1010.4512108.45J CharlesCrystal Awards1:22%,10:25%See this Strabane Biscuit Barrel at TrophyCentral. Discounted Prices and Quick Shipping.custom-pagegeneral-corporate-awards1"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"458221510.45224.45Vision AwardsTrophies1:22%,26:43% "General Recognition Awards" "Corporate Trophies"Progress Awards and Trophies from TrophyCentral. Discounted Trophies, Awards and Promotional Products.custom-pagedo-not-erase11105502-4111Click here if you need to see a proof for your custom football artwork. Proofs enable you to confirm the look is exactly what you want.1custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these quality Public Speaker Classic Inserts (Litho) at TrophyCentral. Each Public Speaker Classic Insert can be used to create a unique plaque, medal or trophy.504251General, Business
custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these quality Public Speaker Modern Inserts (Litho) at TrophyCentral. Each Public Speaker Modern Insert can be used to create a unique plaque, medal or trophy.501401General
custom-pagename-badges-tagswoyoulipr100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Pumpkin Badges Discounted At TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.namebadges-pumkincustom-pagetrophies-golf1"3-6 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"trophies105503-610.611815Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,3:22%"Golf Awards"Golf, Sportscustom-pagecrystalgifts6"7-10 business days" "Kentucky" "UPS (FedEx available on request)"personalized gifts410187-1010.4569.45JcharlesGiftsCrystal Gifts1:22%,100:22%"personalized gifts"Find this Pyramid Paperweight at TrophyCentral. Add engraving to your paperweight for a special touch!Crystal Giftscustom-page111TrophyCentral's QR code generator is free. Add your logo and even create QR codes for engraving. Create QR codes for events, marketing and more!custom-pagecorporatepinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsBusiness1:30%,50:32%,100:35%,500:39%Find these Quality - A Continuous Process Pins discounted at TrophyCentral. Each lapel pin features a high-quality finish and clutch back.br524Businesscustom-pageeawardmedals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsGeneral1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "School Medals" "General Award Medals"These inexpensive 1 1/4 inch Quality Medals offer a high quality, but low price for those on a tight budget.e9211General, Business, Academic
custom-pageribbons1-tiaras1"1-3 business days" "Topeka, Indiana" "UPS (FedEx available on request)"465711-21 260.8244.4Tower RibbonSashes / Crowns / TiarasTiaras1:22%Wear This Stylish Queen Tiara To Your Event With Pride! Queen Tiaras ship In Just 1-2 Business Days! TrophyCentral Is A Top-Rated Yahoo Merchant.rtp6622custom-pageclocks11"3-5 business days w/engraving" "Brewster, New York" "UPS (FedEx available on request)"personalized gifts498553-510.45510.45JDS-S1:22%custom-pageletter-shaped-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find these popular R-shaped custom mascot badges at TrophyCentral. Great for fundraising! TrophyCentral is a top-rated Yahoo merchant.letterbadges-rcustom-pagequickshiptrophies-rabbit1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:25%Fabulous Rabbit trophy with choice of 1st, 2nd or 3rd place trim.qtrabbitplcustom-pagequickshiptrophies-rabbit1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:25%This popular tabbit trophy features a real marble base, column, figure and trim indicating year of award. Includes up to three lines of free engraving!qtrabbityrcustom-pagequickshiptrophies-rabbit1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with bunny rabbit figure discounted at TrophyCentral. Includes free text engraving!cup-rabbit-pcustom-pagequickshiptrophies-rabbit1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these bunny rabbit budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtrabbitscbcustom-pagequickshiptrophies-rabbit1498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Find this budget rabbit award trophy discounted at Trophy Central. Features a real marble base and plastic rabbit figure. Engraving is free. Fast 1-2 day shipping.bdg-rabbitRabbit, Farmcustom-pagequickshiptrophies-rabbit1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:26%Find these fabulous Rabbit Figure Winners Line Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qtrabbitttcustom-pagequickshiptrophies-rabbit1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:28%See this championship trophy with a Rabbit figure at TrophyCentral. Be sure to see all of our Rabbit figure awards.qtrabbitttwcustom-pagequickshiptrophies-rabbit1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:21%,100:24%These popular Bunny Rabbit Figure Elite Series Trophies feature a choice of column size and color, a white marble base and free trophy personalization!qtrabbitsccustom-pagequickshiptrophies-rabbit1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.05Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%Find This Popular Bunny Rabbit Deluxe Platform Series Trophy Discounted at TrophyCentral. Features A Real Marble Base And Free Personalization!custom-pagequickshiptrophies-rabbit1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Bunny Rabbit figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-rabbit-scbcustom-pagequickshiptrophies-rabbit1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.4226Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:18%,10:23%Find these fabulous Champions Line 3-Column Rabbit Trophies discounted at TrophyCentral. Free personalization and fast 1-2 day shipping!qtrabbit3ccustom-pagequickshiptrophies-rabbit1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:27%,100:32%Our popular Rabbit Figure participation trophies feature a real slant-front marble base and free engraving.qtrabbitnccustom-pagequickshiptrophies-chickenqtrabbitncqtrabbitscqtrabbitplqtrabbityrqtrabbitttqtrabbitttwqtrabbit3cqtrabbitdmmqtrabbitscbcup-rabbit-scbcup-rabbit-pbdg-rabbit11Find Rabbit Trophies discounted at TrophyCentral. Each Rabbit Trophy includes free engraving. Fast 1-2 day shipping.

Shop With Confidence at TrophyCentral

We offer a huge selection, discounted prices and fast shipping. Do you need help with some ideas or with ordering? Yes, we sell online, but we have real people who would love to help you! Feel free to call our customer service experts in Michigan, New York and online. TrophyCentral - delivering smiles since 1999!


]]>
custom-pagemedallion-inserts-general-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these quality Rabbits Inserts (Litho) at TrophyCentral. Each Rabbits Insert can be used to create a unique plaque, medal or trophy.501811
custom-pageracing-medals20498551-30.5100021TrophyCentralInsertsSports, Hobby, Org, Livestock1Find this colorful Racing 2" Epoxy-covered insert discounted at TrophyCentral. Fast 1-2 day shipping.Racing, Sportscustom-pageracing-medals1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Racing Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Racing, Sportscustom-pagetrophies-car-truck1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511230.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,6:23%,12:24%,24:26%"Racing Awards" "Car Racing Awards"Find This Racing Flags Cast Stone Racing Trophy Discounted at TrophyCentral. Price Includes 3 Lines of Engraving!tr9926custom-pageracing-trophies-awards1trophies498551-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Racing insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Racing, Sportscustom-pageracing-trophies-awards1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Racing single column insert trophy features a choice of column color, a marble base and free trophy engraving.Racing, Sportscustom-pageracing-medals50medals9303310-May1Simba Calaward-medals1These 2 1/2 inch custom racing medals come with an outer-ring which allows you to add your school or league name, date and location.Racing, Sportscustom-pagetrophies-car-truck1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-30.38150030Quick TrophyDog TagsSports, Hobby, Org, Livestock1:14%,10:15%Find These Racing Dog Tags Discounted At TrophyCentral. Price Includes Engraving And Choice of 6 colors!Shop for Sports Dog Tags at TrophyCentral. Each Sports Tag Can Be Engraved.qtdogracecustom-pageracing-trophies-awards1trophies498551-310.71217.38trophies1Racing, Sportscustom-pageracing-medals1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Racing Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Racing, Sportscustom-pageracing-medals1medals498551-30.525035.5TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find this colorful Racing insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Racing, Sportscustom-pageracing-medals1medals498551-30.525035.5TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find this Racing insert medal with a personalized front rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Racing, Sportscustom-pageracing-trophies-awards1plaques498551-311.11623.5TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these racing insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Racing, Sportscustom-pagequickshiptrophies-stock-carrace-qcmracing-jigfracing-jisfracing-jibfracing-mcracing-mc-prtm9913g11Find racing medals discounted at TrophyCentral. Choose from gold, silver, bronze and other popular finishes. Each racing medal features a free neck ribbon. Shop for Racing Award Medals with Ease at TrophyCentral Find a great selection of high quality medals at discounted prices. We also offer top-rated customer service. Be sure to see our related categories, including Safe Driving and Stock Car Racing.]]>racing-trophies-awardscustom-pageracing-trophies-awards1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our racing insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Racing, Sportscustom-pageracing-medals1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Racing Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Racing, Sportscustom-pageaward-medalsracing-part-iracing-single-iracing-champ-iracing-e-part-iracing-e-single-iracing-plaque-icup-racing-scb-i10631trophies1Find a great selection of racing trophies discounted at TrophyCentral. Each racing trophy includes free personalization! Also see our racing medals and other awards!

Custom Racing Trophies and Awards - Honor Every Finish Line and Champion

Racing trophies celebrate the speed, competition, and thrill of motorsport at every level, from the young Pinewood Derby racer crossing the finish line for the first time to the seasoned go-kart competitor chasing a track championship. Whether you are organizing a youth recreational program, a club racing series, a stock car event, or a community racing festival, our complete selection of racing trophies and medals ensures every driver and team receives recognition worthy of their effort on the track. Our versatile collection includes affordable participation trophies and insert medals for youth programs and large multi-heat events, single column and cup trophies for heat winners and class champions, impressive champion's trophies for overall race day winners and season titles, and plaques for permanent recognition at tracks, schools, and recreation centers. Every trophy includes free engraving personalized with driver names, event, and season. Racing medals include a free ribbon.

Racing Medals

In addition to trophies, we offer a wide selection of racing medals perfect for Pinewood Derby events, multi-class tournaments, and large participation fields where every driver deserves recognition. Choose from classic gold, silver, and bronze finishes along with sport-specific designs featuring checkered flags, racing cars, and finish line imagery, with engraving options to highlight each driver's achievement. Every racing medal includes a free ribbon, making them a practical and budget-friendly choice for youth programs, club series, and community racing events of any size.

Frequently Asked Questions About Racing Trophies

What racing trophy styles work best for different event types?

Participation insert trophies and medals are the practical choice for large youth racing programs and multi-class events where every driver receives recognition for competing, keeping per-unit costs manageable across a full field. Single column insert trophies work well for heat winners, class finishers, and podium positions at club and recreational events, offering a meaningful tiered award that drivers are proud to display. Cup trophies and champion's designs are well suited for overall race day winners, season champions, and end-of-year banquet recognition where a more substantial award reflects the significance of the achievement. Plaques are an excellent option for permanent recognition at a track, recreation center, or club facility, listing each season's champions in a format that builds year over year. Also see our related go-kart trophies, stock car trophies, Pinewood Derby trophies, motocross trophies, and BMX trophies for sport-specific designs.

What size racing trophy is right for my event?

For youth programs and Pinewood Derby events, 6-inch to 9-inch participation trophies strike the right balance between meaningful recognition and budget-friendly pricing across a large field of young racers. Heat winners and class finishers at club and recreational events are well served by 10-inch to 14-inch single column trophies that feel substantial on a shelf or mantle. Overall race day champions and season title winners typically receive 15-inch to 18-inch trophies that make an impression at the awards ceremony and display well long-term. For a grand champion award or an annual series title, a champion's trophy or cup design in the 18-inch to 24-inch range creates a memorable presentation moment that drivers will talk about long after race day.

What should racing trophy engraving include?

The most meaningful racing awards include driver name, finishing position or award title, event or series name, and year. For example: Jake Morales, Overall Champion, Riverside Go-Kart Series, 2025, or Emma Torres, 1st Place Junior Class, Spring Racing Festival, 2025. For team or crew recognition, include the team name alongside the driver. Season-long championship awards benefit from adding the number of races entered or wins accumulated for additional context. Plaques displayed permanently at a track or facility should use a consistent format across all recipients so the display reads as a cohesive historical record as new names are added each year.

Do you offer bulk pricing for racing events and series?

Yes - prices drop significantly as quantities increase, which matters for race organizers recognizing multiple classes, heat winners, and full participant fields at a single event or across a season. Most event directors build a tiered order combining participation medals or small trophies for every driver with larger trophies reserved for podium finishers and overall champions. Orders over $99 qualify for free economy shipping, and our team can provide a custom quote for large multi-class or multi-event orders. We have supplied racing trophies for youth programs, club series, recreational leagues, and community events for over 25 years and can help you build a complete recognition program that fits your event format and budget.

If you need more information before deciding, see our expert resource section:
]]>
trophies racing-medals
custom-pageaward-medalsqtraqtncqtraqtscqtraqtdmqtraqtyrqtraqtplqtraqtttqtraqtttwqtraqt3cmqtramqtscbcup-racup--scbcup-racup--p1trophies1"Sports Trophies"Racquetball Trophies from TrophyCentral. Most Trophies Ship in 1-2 Days and Include Engraving!Custom Racquetball Recognition Trophies TrophyCentral has a great online selection of discounted racquetball trophies to meet all of your needs. Be sure to see our racquetball participation trophies, popular with younger children. Our single column trophies with racquetball figures are also a customer favorite. All of our subject trophies include up to three lines of free personalization (larger awards include additional lines).]]>custom-pagetrophies-racquetball1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular racquetball figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!qtraqtplRacquetball, 1st / 2nd / 3rd / Etc., Sportscustom-pagetrophies-racquetball1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%This popular Racquetball Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!qtraqtyrRacquetball, Sportscustom-pagetrophies-racquetball1trophies498852-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with racquetball figure discounted at TrophyCentral. Includes free text engraving!cup-racup--pRacquetball, Sportscustom-pagetrophies-racquetball1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these racquetball budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtramqtscbRacquetball, Sportscustom-pagetrophies-racquetball1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous two-tier Racquetball Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtraqtttRacquetball, Sportscustom-pagetrophies-racquetball1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-411.215Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%See this championship trophy with a Racquetball figure at TrophyCentral. Be sure to see all of our Racquetball figure awards.qtraqtttwRacquetball, Sportscustom-pagetrophies-racquetball1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:19%,50:28%,100:35%This popular Racquetball Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtraqtscRacquetball, Sportscustom-pagetrophies-racquetball1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.451622.05Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%Find Our Racquetball Deluxe Platform Series Trophies Discounted at TrophyCentral. Real Marble Base; Free Personalization!qtraqtdmRacquetball, Sportscustom-pagetrophies-racquetball1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Racquetball figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-racup--scbRacquetball, Sportscustom-pagetrophies-racquetball1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-411.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous two-tier, 3-column champion Racquetball Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtraqt3cRacquetball, Sportscustom-pagetrophies-racquetball1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%,25:23%,50:29%,100:34%Our popular Racquetball participation trophies feature a real slant-front marble base and free engraving.qtraqtncRacquetball, Sportscustom-pageribbons111465711-21 260.452420.85Tower RibbonRibbonsGeneral1:22%"School Products" "Quick-Ship Items"custom-pagestar-pinsbr199gbr199bbr199s11Find These Popular 3/4 Inch Raised Star Pins Are Discounted At TrophyCentral!star-pinscustom-pagemascotpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:36%,100:46%,500:52%"Mascot Awards"Find These Ram Lapel Pins with Antique Finish Discounted at TrophyCentral! Also See Our Other Fabulous School Mascot Pins. Fast 1-2 Day Shipping!pm10Mascotcustom-pagemascot-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Ram Mascot Badges Discounted At TrophyCentral.mascotbadges-ramcustom-pagemascot-plaques1plaques498552-41JDSPlaques1Find this ram plaque discounted at TrophyCentral. Our ram mascot plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Mascotcustom-pagemascotinserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsMascots1Buy these quality Rams Mascot Medal Inserts at TrophyCentral. Each Rams Insert can be used to create a unique plaque, medal or trophy.489928Mascot
custom-page11Heartwarming stories of kindness and community support from the week of May 4, 2025.custom-pagemascot-plaques1plaques498552-41JDSPlaques1Find this rattlesnake plaque discounted at TrophyCentral. Our rattlesnake mascot plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Mascotcustom-pagemascottrophies1"4-6 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)""PT1=Trophies" "PT1=105503-610.4511016.25Classic MedallicsTrophiesAcademic1:22%,5:24%,10:28%,50:32%"Mascot Awards"This realistic looking Rattlesnake trophy measures 6"H x 4"W x 3 1/4"d and is sculptured in resin. Includes up to 3 lines of free personalization.masc20004-15-2018Mascotcustom-pagetrophies-mascot1trophies498552-410.55615TrophyCentral1:22%,5:24%,10:28%,50:32%Find rattlesnake trophies discounted at TrophyCentral. Each rattlesnake trophy is made of resin and includes up to 3 lines of free engraving!07-12-2023Mascotcustom-pagemascot-plaques1plaques498552-41JDSPlaques1Find this raven plaque discounted at TrophyCentral. Our raven mascot plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Mascotcustom-pagemascotinserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsMascots1Buy these quality Ravens Mascot Medal Inserts at TrophyCentral. Each Ravens Insert can be used to create a unique plaque, medal or trophy.489949Mascot
custom-pageacademic-general-medalsreading-plaque-i908968bstick3reading-ei4899011trophies-academic1Find a great selection of reading trophies discounted at TrophyCentral. Choose from many popular styles. Each reading trophy includes personalization. Fast 1-2 day shipping.

Custom Reading Trophies and Awards - Recognize Every Reader and Milestone

Reading trophies and awards inspire students to develop a lifelong love of books by giving tangible recognition to an achievement that can otherwise feel invisible. From classroom reading challenges and school-wide literacy programs to summer reading clubs and library events, quality reading awards reinforce the message that effort and progress matter. Our selection includes affordable participation trophies and medals for classroom incentive programs, single column trophies with book-themed inserts for top readers and contest winners, cup trophies and champion designs for reading competition finals, plaques for permanent recognition in school hallways and library displays, and lapel pins for everyday motivational recognition that keeps students engaged throughout the year. Every trophy includes free engraving personalized with student names, achievement, and school or program name.

Frequently Asked Questions About Reading Trophies

What reading trophy styles work best for different programs?

Participation trophies and medals are the most practical choice for classroom reading challenges and school-wide incentive programs where the goal is broad engagement and every student receives recognition for completing a milestone or reaching a book count. Single column trophies with reading inserts are well suited for top reader awards, most improved recognition, and reading contest winners where a more substantial award is appropriate. Cup trophies and champion designs work well for competitive reading bowl events and literacy olympiad finals. Plaques are ideal for permanent recognition in school lobbies, library walls, and classroom displays honoring outstanding readers by year. Lapel pins and certificates are cost-effective tools for ongoing daily and weekly motivation that keeps students progressing throughout a semester-long program.

What details should reading trophy engraving include?

The most meaningful reading awards include student name, specific achievement or award title, program or school name, and year. For classroom awards presented to multiple students, keeping a consistent format across the batch makes the ceremony feel organized and intentional. For perpetual plaques displayed in a library or hallway, include the program name on the plaque header and engrave each recipient's name, grade, and year on individual plates added annually. Keep text concise and readable, prioritizing the most meaningful details when space on smaller awards requires choices.

Do you offer bulk pricing for schools and libraries?

Yes, prices drop significantly as quantities increase, which matters for reading programs that are often recognizing entire classrooms or grade levels at once. Most program coordinators combine a mix of medals or small participation awards for every student with larger trophies or plaques for top performers and program champions. Orders over $99 qualify for free economy shipping, and we have supplied reading awards to teachers, librarians, and literacy program coordinators for over 25 years.

If you need more information before deciding, see our expert resource section:
]]>
readingpins
custom-pagereadingawards20498552-40.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful Reading 2" Epoxy-covered insert decal discounted at TrophyCentral. Fast 1-2 day shipping.Readingcustom-pagereadingpinsplastic-pinbox-t5498551-20.550040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find our 3D Series gold reading pin discounted at TrophyCentral. Each outstanding volunteer pin features a clutch back so it can be easily and safely attached to clothing. Fast 1-2 day shipping.Readingcustom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%Buy these quality Reading Achievement Inserts (Litho) at TrophyCentral. Each Reading Achievement Insert can be used to create a unique plaque, medal or trophy.507231Reading
custom-pagereadingawards1medals498552-30.525033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Reading Book 2 1/4" Antique Gold Medal Discounted at TrophyCentral. Each medal features a free ribbon. Fast shipping!Readingcustom-pageachievement-certificates-awards1"Download Only"free-academic49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Reading template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Reading-Certificatereading-freeReadingcustom-pagecoaching-teaching-guides11Creative reading award ideas with engraving examples for schools and reading programs. From Bookworm Champion to Reading Marathon Winner, discover 15+ unique ways to recognize young readers with actual trophy wording templates.custom-pagereadingawards10br371 7008 j9078 908 hp17 br4702-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105503-60.5115014Classic Medallicsaward-medalsAcademic1:22%,25:24%,50:30%,100:36%,500:42%"School Medals" "School Award Medals" "Scholastic Medals" "Scholastic Award Medals" "Academic Medals" "Academic Award Medals" "Medals, School" "Reading Award" "Reading Awards" "Reading Medals" "Reading Lapel Pins" "Reading Award Pins"Students love this colorful Mylar Reading Award Medal from TrophyCentral. Each Reading Award Medal includes a neck ribbon!tm9901Reading
custom-pagereadingawards12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105502-40.3713003.37Classic MedallicsInsertsAcademic1:22%Buy these quality Mylar Reading Award Decal Inserts at TrophyCentral. Each Reading Award Decal can be used to create a unique plaque, medal or trophy.489901Reading
custom-pagetm9901plasticpinboxvelapinbox10readingpinsbr371 7008 j9078 908 tm9901 hp17"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"Reading Award" "Reading Awards" "Reading Award Pins"Find this Reading Award Pin at TrophyCentral. Reading Award pins feature a clutch back and ship in just 1-2 business days!br470Readingcustom-pagereadingawards1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Reading Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Readingcustom-pagereadingpins70089089681awardcertificates11Find these reading certificates discounted at TrophyCentral. Each reading certificate is beautifully printed; templates measure 8 1/2 x 11.Printed Reading Certificates TrophyCentral has an industry-leading selection of certificates and templates in a variety of styles. Each reading certificate measures 11 x 8 1/2". If you have any questions, please contact our experts in New York and Michigan. They have been helping customers with excellent service since 1999!]]>trophies readingpinscustom-pagemotivational-stickers1"1 - 2 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-21 2 3 230.451224.45Certificate SourceCertificates / CoversStickers1:22%,3:24%bstick1Readingcustom-pageachievement-certificates-awards1"Download Only"free-academic49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates" "Reading Award" "Reading Awards" "Reading Lapel Pins" "Reading Award Pins"See this reading certificate designed exclusively for TrophyCentral! Reading certificates can be downloaded for free! Each reading award certificate measures 11 x 8 1/2 inches.readingReadingcustom-pagereadingawards1certificates290631-31 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,25:24%,100:40%,500:50%"Reading Award" "Reading Awards" "Reading Medals" "Reading Lapel Pins" "Reading Award Pins"Find These Printed Reading Certificate Awards with a Unique Lizard Design at TrophyCentral. Measures 8 1/2 x 11.968Readingcustom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceCertificates / CoversEmbosser Seals1:22%,3:28%,5:31%Find these Reading Certificate Seals discounted at TrophyCentral. Seals are easy to apply with a pressure-sensitive backing. Buy in bulk for large discounts!803readReadingcustom-pagereadingawards1498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Reading insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-Reading-InsertReadingcustom-pagereadingawards1498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Reading single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - ReadingReadingcustom-pagereadingawards1498551-311821.06TrophyCentraltrophies1Readingcustom-pagereadingawards1498551-310.71217.38trophies1Readingcustom-pagereadingpinsplastic-pinbox-t1498551-30.5200040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find this Reading Gold Enamel lapel pin discounted at TrophyCentral. Features a clutch-pin back for easy attachment to clothing.. Fast 1-2 day shipping.reading-u-pbReadingcustom-pagereadingawards1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Reading Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Readingcustom-pagereadingawards1medals498552-30.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Colorful Reading insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Readingcustom-pagereadingawards1medals498552-40.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Reading insert medal With A Personalized Front Rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Readingcustom-pagereadingawards1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these reading insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Readingcustom-pagetm9901plasticpinboxvelapinbox10br371 7008 j9078 908 tm9901 br470"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:30%,100:35%,500:48%"Reading Award" "Reading Awards" "Reading Medals" "Reading Lapel Pins" "Reading Award Pins"Find These Fabulous Reading Pins Discounted At Top-Rated TrophyCentral.hp17Readingcustom-pagereadingpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:28%,100:32%,500:42%Find Reading pins at TrophyCentral. Each AP Series Reading pin includes a clutch back.ap81Readingcustom-pagereadingawards12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsAcademic1:22%,100:28%,500:34%,1000:45%These inexpensive 1 1/4 inch Reading Award Medals offer a high quality, but low price for those on a tight budget. Add Engraving to your Reading Award for a Special touch!e990508-15-2014Reading
custom-pagereadingawards12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsAcademic1:22%,100:28%,500:34%,1000:45%These inexpensive 1 1/4 inch Reading Medals offer a high quality, but low price for those on a tight budget.e9078Reading
1academic-general-medals1Find Reading Medals discounted at TrophyCentral. Each Reading Medal includes a free neck ribbon. Fast 1-2 day shipping.readingmedalsCelebrate a Love for Reading with Custom Medals TrophyCentral has an great selection of reading award medals to meet your needs. Choose from popular reading subjects, such as: "Reading Award", "Really Into Reading" and many more. Each reading medal includes a neck ribbon; ribbons are even available in a large number of color combinations to match your school colors!

Engraved Reading Medals with Custom Text

Personalize the back of your medals with names and dates. You can even add an organization or event name on our exclusive front rim medals.

Gold, Silver & Bronze Reading Medals

These medals are perfect for reading programs and motivational competitions.

Bulk Orders for Schools & Libraries

In addition to our low prices, we offer large quantity discounts. Click on an item image above and then on "View Quantity Pricing".

The TrophyCentral Difference

We have the guaranteed lowest prices and top-rated customer service. Yes, there are real people at TrophyCentral ready to answer your questions and to help you find the right reading medal award to fit your needs. If you have any questions regarding your order, simply call us toll-free at 1-888-809-8800.

Frequently Asked Questions (FAQ)

📚 What are reading medals?

Reading medals are special awards designed to recognize students for reading achievements, literacy programs, and book challenges. They help motivate young readers and celebrate their progress.

🏆 Who can receive a reading medal?

Reading medals are perfect for students of all ages, including elementary, middle, and high school readers. They are often awarded for completing reading challenges, summer reading programs, or excelling in literacy-based activities.

📖 What types of reading medals are available?

We offer a variety of reading medals, including gold, silver, and bronze options, as well as medals featuring books, reading mascots, and other themed designs.

🎨 Can I customize reading medals with engraving?

Yes! Many of our reading medals include custom engraving options where you can add the recipient's name, event title, or a short message to make the award extra special.

📦 Do you offer bulk discounts for schools and libraries?

Yes! We provide discounted pricing for bulk orders, making it easy for schools, libraries, and literacy programs to reward multiple students.

⏳ How long does shipping take?

Most reading medals ship within 1-2 days without engraving and a bit longer with engraving. Expedited shipping options are available for last-minute award ceremonies.

🎁 Are reading medals a good way to encourage kids to read?

Absolutely! Reading medals provide positive reinforcement, making reading fun and rewarding. They encourage students to set goals and develop a lifelong love for books.

]]>
readingawards readingpins
custom-pagereadingawards1498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our reading insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - ReadingReadingcustom-pageperfect-attendance-pinsbr470ap81br721hp17br371reading-pbreading-u-pb3d10-reading1school-pins1Find reading pins discounted at TrophyCentral. If you are looking for an inexpensive, yet quality way to recognize your top reading students, you have come to the right place!Lapel Pins: Reading If you are looking for an inexpensive, yet quality way to recognize the achievements of your top reading students, you have come to the right place! Whether you are looking to award students at the end of the year ceremony or motivate them throughout, we have a pin for you. Fast 1-2 day shipping.

Shop with Ease at TrophyCentral!

If you are looking to buy reading lapel pins online, look no further! TrophyCentral has a great selection that will fit any budget. Our top-rated representatives are happy to assist you with all of your reading pin needs. Our customer service experts in New York and Michigan have been providing suggestions and guidance since 1999!
]]>
readingmedals reading-certificates school-pins
custom-pagereadingpinsplastic-pinbox-t5lapel pins498551-20.550040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find this Reading Gold Enamel lapel pin discounted at TrophyCentral. Features a clutch-pin back for easy attachment to clothing.. Fast 1-2 day shipping.reading-u-pbReadingcustom-pagereadingawards1"1 - 2 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"290631-21 2 3 230.451224.45Certificate SourceCertificates / CoversStickers1:22%,3:24%"Reading Award" "Reading Awards" "Reading Medals" "Reading Lapel Pins" "Reading Award Pins"Find these popular Reading Rocks! motivational stickers discounted online at TrophyCentral. Fast 1-2 day shipping!bstick3Readingcustom-pagereadingawards1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Reading Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Readingcustom-pagereadingpinsplasticpinboxvelapinbox1"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%Find these Reading Star Pins discounted at TrophyCentral. Each reading star pin features a clutch-back. Fast 1-2 day shipping!br721Readingcustom-pagereadingawards1br371 7008 908 tm9901 hp17 br4702-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105503-60.75130042.75Classic Medallicsaward-medalsAcademic1:22%,50:28%,100:34%,500:41%Find our Reading 2" Olympic-Style J-Series Medals 2" Olympic-Style J-Series Medals at a super price point at TrophyCentral. Large quantity discounts available!j907807-15-11Reading
custom-pageglass-crystal-awards11"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"458221510.45618.45Vision AwardsTrophies1:22%,200:32%Find this paperweight with a Real Estate House design discounted at TrophyCentral. Includes etching and a gift box.custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these quality Real Estate Sales Inserts (Litho) at TrophyCentral. Each Real Estate Sales Insert can be used to create a unique plaque, medal or trophy.507165Occupations
custom-pagewall-mounted-recessed1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell recessed wall display case w/ cork back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 48"H x 48"W x 16"D.14404-ck-bzWall-Mountedcustom-pagewall-mounted-recessed145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell recessed wall display case w/ cork back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 60"H x 48"W x 16"D.14404-ck-bzWall-Mountedcustom-pagewall-mounted-recessed1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell recessed wall display case w/ cork back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 48"W x 16"D.14406-ck-bzWall-Mountedcustom-pagewall-mounted-recessed145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell recessed wall display case w/ cork back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 96"H x 48"W x 16"D.14408-wb-bzWall-Mountedcustom-pagewall-mounted-recessed145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell recessed wall display case w/ cork back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 48"H x 48"W x 16"D.14404-ck-bzWall-Mountedcustom-pagewall-mounted-recessed145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell recessed wall display case w/ cork back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 60"H x 48"W x 16"D.14404-ck-bzWall-Mountedcustom-pagewall-mounted-recessed145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell recessed wall display case w/ cork back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 48"W x 16"D.14406-ck-bzWall-Mountedcustom-pagewall-mounted-recessed1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell recessed wall display case w/ cork back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 96"H x 48"W x 16"D.14408-ck-snWall-Mountedcustom-pagewall-mounted-recessed145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell recessed wall display case w/ white laminate back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 48"H x 48"W x 16"D.14404-ck-bzWall-Mountedcustom-pagewall-mounted-recessed145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell recessed wall display case w/ white laminate back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 60"H x 48"W x 16"D.14404-ck-bzWall-Mountedcustom-pagewall-mounted-recessed145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell recessed wall display case w/ white laminate back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 48"W x 16"D.14406-ck-bzWall-Mountedcustom-pagewall-mounted-recessed1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell recessed wall display case w/ white laminate back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 96"H x 48"W x 16"D.14408-wb-bzWall-Mountedcustom-pagewall-mounted-recessed145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell recessed wall display case w/ white laminate back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 48"H x 48"W x 16"D.14404-ck-bzWall-Mountedcustom-pagewall-mounted-recessed145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell recessed wall display case w/ white laminate back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 60"H x 48"W x 16"D.14404-ck-bzWall-Mountedcustom-pagewall-mounted-recessed145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell recessed wall display case w/ white laminate back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 48"W x 16"D.14406-ck-bzWall-Mountedcustom-pagewall-mounted-recessed145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell recessed wall display case w/ white laminate back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 96"H x 48"W x 16"D.14408-ck-snWall-Mountedcustom-pageglobal-crystal-awards1"5-10 business days" "Mount Vernon, NY" "UPS"general105503-610.4511213.65Classic MedallicsCrystal Awards1:30%"Crystal Awards"Find this Optical Crystal Recessed Globe at TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.See more: glass-crystal-awardsLeadershipcustom-pagescholarship-resource-hub11Comprehensive guide for coaches and teachers to recognize and document sportsmanship in athletes. Includes sport-specific examples.custom-pagescholarship-resource-hub11Complete teacher resource for writing powerful scholarship recommendations. Includes template, before-after examples, and time-saving questionnaire.custom-pageglass-crystal-awards1"1-2 business days" "Marquette, MI" "UPS"general498852-310.45826Quick TrophyCrystal Awards1:14%"New Products"Rectangle Prestige Glass Awards from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.For other great alternatives, be sure to see our mainsection.glass-crystal-awardsLeadershipcustom-pagebaseballdisplay11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.5119.5Perfect CaseDisplay Cases11:14%,5:19%Rectangular Batting Helmet Glass Display Cases from TrophyCentral.Baseball / T-Ball, Sportscustom-pagefootballdisplay11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.5116.524 12 10Perfect CaseDisplay Cases11:14%,5:17%Rectangular Glass Football Display Case. Ideal for leagues, schools, and tournaments. Fast shipping.10-16-2017Football, Sportscustom-pagefootballdisplay11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.5119.5Perfect CaseDisplay Cases11:14%,5:19%Rectangular Glass Football Helmet Display Case. Ideal for leagues, schools, and tournaments. Fast shipping.Football, Sportscustom-pagebaseballdisplay11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.5115.5Perfect CaseDisplay Cases11:14%,5:17%Rectangular Glove Glass Display Cases from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.Baseball / T-Ball, Sportscustom-pagename-badges-tagswoyoulipr100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Rectangular Name Badges Discounted At TrophyCentral.namebadges-rectcustom-pagesports-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsGeneral1:22%,50:30%,100:33%,500:47%"School Pins" "School Lapel Pins"Red #1 Letter Pins: EC Series Red #1 Lapel Pins feature a high-quality enameled finish and ship in just 1-2 business days!ec28rd12-20-2020Academiccustom-pageachievement-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsGeneral1:22%,50:30%,100:33%,500:47%"School Pins" "School Lapel Pins"Our red achievement letter pins (EC Series) feature a high-quality enameled finish and ship in just 1-2 business days!ec60custom-pagebottles-st80"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14142013.4Glass AmericaPromotional ProductsSports / Water Bottles1:14%,640:31%Find these Red Backpack Collection Custom Water Bottles at TrophyCentral. Add your own logo or artwork!41076Sports / Water Bottlescustom-pagemascotinserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsMascots1Buy these quality Red Devils Mascot Medal Inserts at TrophyCentral. Each Red Devils Insert can be used to create a unique plaque, medal or trophy.489947Mascot
custom-pageteacher-appreciation1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"410187-1010.451010.45JcharlesGiftsCrystal Gifts1:22%,25:23%"personalized gifts"Find this Red Royale Apple Award Discounted at TrophyCentral. Price includes etching and gift box.Apple, Crystal Gifts, Teacher's Award, Academiccustom-pagecospwabo50"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745315125016.5PepcoPromotional ProductsSports / Water Bottles1:14%,250:21%,500:31%,1000:45%,2500:49%Red Custom Sports Bottles from TrophyCentral.sportsbottles-redSports / Water Bottlescustom-pagesports-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsGeneral1:22%,50:30%,100:33%,500:47%"Star Awards" "Star Award"Red Stars Letter Pins: EC Series Red Stars Lapel Pins feature a high-quality enameled finish and ship in just 1-2 business days!ec113-28-2016Star, General, Academiccustom-pageawri11"3-4 business days" "Topeka, Indiana" "UPS (Priority Mail also available)"medals465715-71 260.4620016.46Tower RibbonRibbonsAwareness Ribbons1:22%,50:35%Buy Red, White and Blue Patriotic Ribbons at TrophyCentral. Each Red, White and Blue Ribbon Features A Tape Or Pin Back And Is Available With Optional Imprinting.reawriShop for Patriotic Red, White and Blue Ribbons with Ease at TrophyCentral TrophyCentral has a wonderful selection, discounted and bulk pricing and great customer service. Each red, white and blue awareness ribbon comes with a tape or pin back and is available with optional imprinting.]]>Red White Blue, Patriotic1"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)""PT1=7745310-141350018PepcoPromotional ProductsMagnetic Signs1See a great selection of custom mascot magnets at TrophyCentral. Choose your school color and add your own artwork!mascot-magnets-allMascotcustom-pagecrystalcups1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"general410187-1010.45212.45JcharlesCrystal Awards1:22%,25:24%"crystal awards"Find these fabulous Regatta Championship Trophies discounted at TrophyCentral. TrophyCentral is known for its top-rated customer serviceLeadership, Golf, Tennis, Sportscustom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock Bottles1:22%,100:28%,500:34%,1000:45%"Track Medals"These inexpensive 1 1/4 inch Relay Race (Female) Medals offer a high quality, but low price for those on a tight budget.e9044
custom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock Bottles1:22%,100:28%,500:34%,1000:45%"Track Medals"These inexpensive 1 1/4 inch Relay Race (Male) Medals offer a high quality, but low price for those on a tight budget.e9111
custom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281mb-gd-mk.2281mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074mb-gd-mk.2074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075mb-gd-mk.2075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076mb-gd-mk.2076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281mb-bz-mk.2281mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074mb-bz-mk.2074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075mb-bz-mk.2075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076mb-bz-mk.2076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281mb-sn-mk.2281mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074mb-sn-mk.2074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075mb-sn-mk.2075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076mb-sn-mk.2076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281pb-gd-mk.2281pb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074pb-gd-mk.2074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075pb-gd-mk.2075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076pb-gd-mk.2076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281pb-bz-mk.2281pb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074pb-bz-mk.2074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075pb-bz-mk.2075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076pb-bz-mk.2076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281pb-sn-mk.2281pb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074pb-sn-mk.2074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075pb-sn-mk.2075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076pb-sn-mk.2076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281wb-gd-mk.2281wb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074wb-gd-mk.2074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075wb-gd-mk.2075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076wb-gd-mk.2076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281wb-bz-mk.2281wb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074wb-bz-mk.2074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075wb-bz-mk.2075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076wb-bz-mk.2076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281wb-sn-mk.2281wb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074wb-sn-mk.2074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075wb-sn-mk.2075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076wb-sn-mk.2076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281mb-gd-dk.2281mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074mb-gd-dk.2074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076mb-gd-dk.2076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281mb-bz-dk.2281mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074mb-bz-dk.2074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075mb-bz-dk.2075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076mb-bz-dk.2076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281mb-sn-dk.2281mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074mb-sn-dk.2074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075mb-sn-dk.2075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076mb-sn-dk.2076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281pb-gd-dk.2281pb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074pb-gd-dk.2074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075pb-gd-dk.2075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076pb-gd-dk.2076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281pb-bz-dk.2281pb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074pb-bz-dk.2074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075pb-bz-dk.2075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076pb-bz-dk.2076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281pb-sn-dk.2281pb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074pb-sn-dk.2074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075pb-sn-dk.2075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076pb-sn-dk.2076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281wb-gd-dk.2281wb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074wb-gd-dk.2074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075wb-gd-dk.2075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076wb-gd-dk.2076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281wb-bz-dk.2281wb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074wb-bz-dk.2074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075wb-bz-dk.2075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076wb-bz-dk.2076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281wb-sn-dk.2281wb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074wb-sn-dk.2074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075wb-sn-dk.2075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076wb-sn-dk.2076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075mb-gd-dk.2075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281mb-gd-lv.2281mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074mb-gd-lv.2074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075mb-gd-lv.2075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076mb-gd-lv.2076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281mb-bz-lv.2281mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074mb-bz-lv.2074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075mb-bz-lv.2075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076mb-bz-lv.2076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281mb-sn-lv.2281mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074mb-sn-lv.2074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075mb-sn-lv.2075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076mb-sn-lv.2076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281pb-gd-lv.2281pb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074pb-gd-lv.2074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075pb-gd-lv.2075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076pb-gd-lv.2076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281pb-bz-lv.2281pb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074pb-bz-lv.2074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075pb-bz-lv.2075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076pb-bz-lv.2076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281pb-sn-lv.2281pb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074pb-sn-lv.2074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075pb-sn-lv.2075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076pb-sn-lv.2076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281wb-gd-lv.2281wb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074wb-gd-lv.2074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075wb-gd-lv.2075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076wb-gd-lv.2076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281wb-bz-lv.2281wb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074wb-bz-lv.2074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075wb-bz-lv.2075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076wb-bz-lv.2076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281wb-sn-lv.2281wb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074wb-sn-lv.2074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075wb-sn-lv.2075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076wb-sn-lv.2076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174mb-gd-mk.2174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175mb-gd-mk.2175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176mb-gd-mk.2176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174mb-bz-mk.2174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175mb-bz-mk.2175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176mb-bz-mk.2176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174mb-sn-mk.2174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175mb-sn-mk.2175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176mb-sn-mk.2176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174pb-gd-mk.2174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175pb-gd-mk.2175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176pb-gd-mk.2176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174pb-bz-mk.2174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175pb-bz-mk.2175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176pb-bz-mk.2176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174pb-sn-mk.2174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175pb-sn-mk.2175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176pb-sn-mk.2176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174wb-gd-mk.2174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175wb-gd-mk.2175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176wb-gd-mk.2176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174wb-bz-mk.2174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175wb-bz-mk.2175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176wb-bz-mk.2176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174wb-sn-mk.2174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175wb-sn-mk.2175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176wb-sn-mk.2176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174mb-gd-dk.2174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175mb-gd-dk.2175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176mb-gd-dk.2176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174mb-bz-dk.2174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175mb-bz-dk.2175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176mb-bz-dk.2176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174mb-sn-dk.2174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175mb-sn-dk.2175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176mb-sn-dk.2176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174pb-gd-dk.2174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175pb-gd-dk.2175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176pb-gd-dk.2176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174pb-bz-dk.2174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175pb-bz-dk.2175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176pb-bz-dk.2176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174pb-sn-dk.2174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175pb-sn-dk.2175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176pb-sn-dk.2176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174wb-gd-dk.2174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175wb-gd-dk.2175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176wb-gd-dk.2176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174wb-bz-dk.2174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175wb-bz-dk.2175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176wb-bz-dk.2176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174wb-sn-dk.2174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175wb-sn-dk.2175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176wb-sn-dk.2176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174mb-gd-lv.2174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175mb-gd-lv.2175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176mb-gd-lv.2176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174mb-bz-lv.2174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175mb-bz-lv.2175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176mb-bz-lv.2176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174mb-sn-lv.2174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175mb-sn-lv.2175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176mb-sn-lv.2176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174pb-gd-lv.2174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175pb-gd-lv.2175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176pb-gd-lv.2176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174pb-bz-lv.2174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175pb-bz-lv.2175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176pb-bz-lv.2176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174pb-sn-lv.2174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175pb-sn-lv.2175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176pb-sn-lv.2176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174wb-gd-lv.2174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175wb-gd-lv.2175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176wb-gd-lv.2176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174wb-bz-lv.2174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175wb-bz-lv.2175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176wb-bz-lv.2176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174wb-sn-lv.2174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175wb-sn-lv.2175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176wb-sn-lv.2176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174mb-gd-ak.2174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175mb-gd-ak.2175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176mb-gd-ak.2176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174mb-bz-ak.2174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175mb-bz-ak.2175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176mb-bz-ak.2176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174mb-sn-ak.2174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175mb-sn-ak.2175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176mb-sn-ak.2176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174pb-gd-ak.2174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175pb-gd-ak.2175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176pb-gd-ak.2176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174pb-bz-ak.2174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175pb-bz-ak.2175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176pb-bz-ak.2176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174pb-sn-ak.2174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175pb-sn-ak.2175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176pb-sn-ak.2176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174wb-gd-ak.2174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175wb-gd-ak.2175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176wb-gd-ak.2176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174wb-bz-ak.2174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175wb-bz-ak.2175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176wb-bz-ak.2176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174wb-sn-ak.2174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175wb-sn-ak.2175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176wb-sn-ak.2176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174mb-gd-wv.2174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175mb-gd-wv.2175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176mb-gd-wv.2176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174mb-bz-wv.2174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175mb-bz-wv.2175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176mb-bz-wv.2176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174mb-sn-wv.2174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175mb-sn-wv.2175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176mb-sn-wv.2176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174pb-gd-wv.2174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175pb-gd-wv.2175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176pb-gd-wv.2176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174pb-bz-wv.2174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175pb-bz-wv.2175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176pb-bz-wv.2176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174pb-sn-wv.2174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175pb-sn-wv.2175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176pb-sn-wv.2176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174wb-gd-wv.2174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175wb-gd-wv.2175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176wb-gd-wv.2176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174wb-bz-wv.2174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175wb-bz-wv.2175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176wb-bz-wv.2176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174wb-sn-wv.2174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175wb-sn-wv.2175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176wb-sn-wv.2176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281mb-gd-ak.2281mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074mb-gd-ak.2074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075mb-gd-ak.2075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076mb-gd-ak.2076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281mb-bz-ak.2281mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074mb-bz-ak.2074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075mb-bz-ak.2075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076mb-bz-ak.2076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281mb-sn-ak.2281mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074mb-sn-ak.2074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075mb-sn-ak.2075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076mb-sn-ak.2076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281pb-gd-ak.2281pb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074pb-gd-ak.2074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075pb-gd-ak.2075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076pb-gd-ak.2076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281pb-bz-ak.2281pb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074pb-bz-ak.2074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075pb-bz-ak.2075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076pb-bz-ak.2076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281pb-sn-ak.2281pb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074pb-sn-ak.2074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075pb-sn-ak.2075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076pb-sn-ak.2076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281wb-gd-ak.2281wb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074wb-gd-ak.2074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075wb-gd-ak.2075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076wb-gd-ak.2076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281wb-bz-ak.2281wb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074wb-bz-ak.2074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075wb-bz-ak.2075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076wb-bz-ak.2076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281wb-sn-ak.2281wb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074wb-sn-ak.2074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075wb-sn-ak.2075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076wb-sn-ak.2076mb-bz-mkFloor-Standingcustom-pagedisplaycases12074mb-gd-mk2075mb-gd-mk2076mb-gd-mk2281mb-gd-mk2074mb-gd-ak2075mb-gd-ak2076mb-gd-ak2281mb-gd-ak2074mb-gd-wv2075mb-gd-wv2076mb-gd-wv2281mb-gd-wv2074mb-gd-dk2076mb-gd-dk2281mb-gd-dk2074mb-gd-lv2075mb-gd-lv2076mb-gd-lv2281mb-gd-lv2174mb-gd-mk2175mb-gd-mk2176mb-gd-mk2075mb-gd-dk2174mb-gd-ak2175mb-gd-ak2176mb-gd-ak2174mb-gd-wv2175mb-gd-wv2176mb-gd-wv2174mb-gd-dk2175mb-gd-dk2176mb-gd-dk2174mb-gd-lv2175mb-gd-lv2176mb-gd-lv2074mb-bz-mk2075mb-bz-mk2076mb-bz-mk2281mb-bz-mk2074mb-bz-ak2075mb-bz-ak2076mb-bz-ak2281mb-bz-ak2074mb-bz-wv2075mb-bz-wv2076mb-bz-wv2281mb-bz-wv2074mb-bz-dk2075mb-bz-dk2076mb-bz-dk2281mb-bz-dk2074mb-bz-lv2075mb-bz-lv2076mb-bz-lv2281mb-bz-lv2174mb-bz-mk2175mb-bz-mk2176mb-bz-mk2174mb-bz-ak2175mb-bz-ak2176mb-bz-ak2174mb-bz-wv2175mb-bz-wv2176mb-bz-wv2174mb-bz-dk2175mb-bz-dk2176mb-bz-dk2174mb-bz-lv2175mb-bz-lv2176mb-bz-lv2074mb-sn-mk2075mb-sn-mk2076mb-sn-mk2281mb-sn-mk2074mb-sn-ak2075mb-sn-ak2076mb-sn-ak2281mb-sn-ak2074mb-sn-wv2075mb-sn-wv2076mb-sn-wv2281mb-sn-wv2074mb-sn-dk2075mb-sn-dk2076mb-sn-dk2281mb-sn-dk2074mb-sn-lv2075mb-sn-lv2076mb-sn-lv2281mb-sn-lv2174mb-sn-mk2175mb-sn-mk2176mb-sn-mk2174mb-sn-ak2175mb-sn-ak2176mb-sn-ak2174mb-sn-wv2175mb-sn-wv2176mb-sn-wv2174mb-sn-dk2175mb-sn-dk2176mb-sn-dk2174mb-sn-lv2175mb-sn-lv2176mb-sn-lv2074pb-gd-mk2075pb-gd-mk2076pb-gd-mk2281pb-gd-mk2074pb-gd-ak2075pb-gd-ak2076pb-gd-ak2281pb-gd-ak2074pb-gd-wv2075pb-gd-wv2076pb-gd-wv2281pb-gd-wv2074pb-gd-dk2075pb-gd-dk2076pb-gd-dk2281pb-gd-dk2074pb-gd-lv2075pb-gd-lv2076pb-gd-lv2281pb-gd-lv2174pb-gd-mk2175pb-gd-mk2176pb-gd-mk2174pb-gd-ak2175pb-gd-ak2176pb-gd-ak2174pb-gd-wv2175pb-gd-wv2176pb-gd-wv2174pb-gd-dk2175pb-gd-dk2176pb-gd-dk2174pb-gd-lv2175pb-gd-lv2176pb-gd-lv2074pb-bz-mk2075pb-bz-mk2076pb-bz-mk2281pb-bz-mk2074pb-bz-ak2075pb-bz-ak2076pb-bz-ak2281pb-bz-ak2074pb-bz-wv2075pb-bz-wv2076pb-bz-wv2281pb-bz-wv2074pb-bz-dk2075pb-bz-dk2076pb-bz-dk2281pb-bz-dk2074pb-bz-lv2075pb-bz-lv2076pb-bz-lv2281pb-bz-lv2174pb-bz-mk2175pb-bz-mk2176pb-bz-mk2174pb-bz-ak2175pb-bz-ak2176pb-bz-ak2174pb-bz-wv2175pb-bz-wv2176pb-bz-wv2174pb-bz-dk2175pb-bz-dk2176pb-bz-dk2174pb-bz-lv2175pb-bz-lv2176pb-bz-lv2074pb-sn-mk2075pb-sn-mk2076pb-sn-mk2281pb-sn-mk2074pb-sn-ak2075pb-sn-ak2076pb-sn-ak2281pb-sn-ak2074pb-sn-wv2075pb-sn-wv2076pb-sn-wv2281pb-sn-wv2074pb-sn-dk2075pb-sn-dk2076pb-sn-dk2281pb-sn-dk2074pb-sn-lv2075pb-sn-lv2076pb-sn-lv2281pb-sn-lv2174pb-sn-mk2175pb-sn-mk2176pb-sn-mk2174pb-sn-ak2175pb-sn-ak2176pb-sn-ak2174pb-sn-wv2175pb-sn-wv2176pb-sn-wv2174pb-sn-dk2175pb-sn-dk2176pb-sn-dk2174pb-sn-lv2175pb-sn-lv2176pb-sn-lv2074wb-gd-mk2075wb-gd-mk2076wb-gd-mk2281wb-gd-mk2074wb-gd-ak2075wb-gd-ak2076wb-gd-ak2281wb-gd-ak2074wb-gd-wv2075wb-gd-wv2076wb-gd-wv2281wb-gd-wv2074wb-gd-dk2075wb-gd-dk2076wb-gd-dk2281wb-gd-dk2074wb-gd-lv2075wb-gd-lv2076wb-gd-lv2281wb-gd-lv2174wb-gd-mk2175wb-gd-mk2176wb-gd-mk2174wb-gd-ak2175wb-gd-ak2176wb-gd-ak2174wb-gd-wv2175wb-gd-wv2176wb-gd-wv2174wb-gd-dk2175wb-gd-dk2176wb-gd-dk2174wb-gd-lv2175wb-gd-lv2176wb-gd-lv2074wb-bz-mk2075wb-bz-mk2076wb-bz-mk2281wb-bz-mk2074wb-bz-ak2075wb-bz-ak2076wb-bz-ak2281wb-bz-ak2074wb-bz-wv2075wb-bz-wv2076wb-bz-wv2281wb-bz-wv2074wb-bz-dk2075wb-bz-dk2076wb-bz-dk2281wb-bz-dk2074wb-bz-lv2075wb-bz-lv2076wb-bz-lv2281wb-bz-lv2174wb-bz-mk2175wb-bz-mk2176wb-bz-mk2174wb-bz-ak2175wb-bz-ak2176wb-bz-ak2174wb-bz-wv2175wb-bz-wv2176wb-bz-wv2174wb-bz-dk2175wb-bz-dk2176wb-bz-dk2174wb-bz-lv2175wb-bz-lv2176wb-bz-lv2074wb-sn-mk2075wb-sn-mk2076wb-sn-mk2281wb-sn-mk2074wb-sn-ak2075wb-sn-ak2076wb-sn-ak2281wb-sn-ak2074wb-sn-wv2075wb-sn-wv2076wb-sn-wv2281wb-sn-wv2074wb-sn-dk2075wb-sn-dk2076wb-sn-dk2281wb-sn-dk2074wb-sn-lv2075wb-sn-lv2076wb-sn-lv2281wb-sn-lv2174wb-sn-mk2175wb-sn-mk2176wb-sn-mk2174wb-sn-ak2175wb-sn-ak2176wb-sn-ak2174wb-sn-wv2175wb-sn-wv2176wb-sn-wv2174wb-sn-dk2175wb-sn-dk2176wb-sn-dk2174wb-sn-lv2175wb-sn-lv2176wb-sn-lv11Find Reliant Series trophy cases discounted at TrophyCentral. These quality display cases from Waddell are ideal for schools and offices.displaycases1trophycases15 floor-standing-merchandisercustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281mb-gd-wv.2281mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074mb-gd-wv.2074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075mb-gd-wv.2075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076mb-gd-wv.2076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281mb-bz-wv.2281mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074mb-bz-wv.2074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075mb-bz-wv.2075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076mb-bz-wv.2076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281mb-sn-wv.2281mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074mb-sn-wv.2074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075mb-sn-wv.2075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076mb-sn-wv.2076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281pb-gd-wv.2281pb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074pb-gd-wv.2074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075pb-gd-wv.2075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076pb-gd-wv.2076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281pb-bz-wv.2281pb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074pb-bz-wv.2074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075pb-bz-wv.2075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076pb-bz-wv.2076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281pb-sn-wv.2281pb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074pb-sn-wv.2074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075pb-sn-wv.2075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076pb-sn-wv.2076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281wb-gd-wv.2281wb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074wb-gd-wv.2074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075wb-gd-wv.2075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076wb-gd-wv.2076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281wb-bz-wv.2281wb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074wb-bz-wv.2074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075wb-bz-wv.2075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076wb-bz-wv.2076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281wb-sn-wv.2281wb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074wb-sn-wv.2074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075wb-sn-wv.2075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076wb-sn-wv.2076mb-bz-mkFloor-Standingcustom-pageaward-medalscross-award-plaquestar-of-david-award-plaquecross-plaque-icross-ei1trophies1Find a great selection of religious trophies at TrophyCentral. Each religious trophy includes free engraving. Medals include a ribbon. Free engraving and fast shipping!

Custom Religious Trophies and Awards - Honor Every Faith Milestone and Achievement

Religious trophies and awards honor the spiritual growth, dedicated service, and faith community achievements that mark meaningful moments in the lives of young people and congregation members alike. From youth group bible study competitions and vacation bible school completion awards that encourage children to engage with their faith, to confirmation and bar and bat mitzvah recognition commemorating important spiritual coming-of-age ceremonies, from Sunday school achievement programs rewarding consistent attendance and scripture memorization, to congregation service awards honoring volunteers and leaders who give generously of their time and talents, quality religious awards create lasting keepsakes that families treasure as reminders of these significant occasions. Our versatile selection includes cross and Star of David trophies in participation, single column, double platform, and two-tier championship designs, cup trophies and champion's awards for faith-based competitions and games, insert plaques suitable for permanent display in church halls and congregation offices, and medals in gold, silver, and bronze with free neck ribbons perfect for recognizing large groups at vacation bible school, confirmation classes, and religious education programs. Every award ships with free custom engraving to commemorate the recipient's name, congregation, occasion, and year, creating keepsakes that honor faith milestones long after the ceremony ends.

Frequently Asked Questions About Religious Trophies

What religious programs and occasions are these awards suitable for?

Our religious trophies, medals, and plaques are suitable for a wide range of faith community occasions including vacation bible school, Sunday school achievement programs, confirmation ceremonies, first communion, baptism recognition, bar and bat mitzvah celebrations, youth group competitions, bible study awards, congregation volunteer service recognition, and religious education graduation. Medals and smaller participation trophies work especially well for VBS and Sunday school programs recognizing large groups of children, while column trophies and plaques suit individual milestone ceremonies and special achievement recognition.

What details should religious trophy engraving include?

Essential elements include recipient name, occasion or award title, congregation or church name, and year. For milestone ceremonies such as confirmation or bar mitzvah, including the date creates a more complete and meaningful keepsake. Volunteer and service awards benefit from noting years of service or a brief title such as Youth Group Leader or Sunday School Teacher. Keep text concise and readable, prioritizing the most meaningful details when space on smaller trophies and medals requires choices.

Do you offer bulk discounts for churches and religious programs?

Yes, Trophy Central offers significant bulk discounts on religious trophies and medals that scale with order quantity, keeping award budgets manageable for congregations and programs of any size. Churches ordering medals for an entire vacation bible school enrollment, religious education coordinators purchasing participation trophies for a full confirmation class, and youth group leaders buying year-end awards for all members all benefit from bulk pricing. Browse our religious medals above for the most budget-friendly option when recognizing large groups.

If you need more information before deciding, see our expert resource section:
]]>
trophies religious-medals
custom-pageemployee-resource-hub11Complete religious and faith-based recognition guide for churches, religious schools, and faith communities. Discover meaningful award ideas for confirmation, Sunday school, pastoral appreciation, and spiritual milestone celebrations.11From scripture memory medals to confirmation trophies, here are the religious school recognition ideas that honor faith, learning, and the kids who showed up all year. Programs of every tradition covered. custom-pageblog-trophycentral11Faith community recognition ideas: youth education awards, coming-of-age milestones, adult service honors, and long-term member recognition across all traditions.custom-pageinserts112-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsReligious1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals" "Religious Medals"Buy these quality Religious Cross (501111) Inserts (Litho) at TrophyCentral. Each Religious Cross (501111) Insert can be used to create a unique plaque, medal or trophy.501111Religious
custom-pagereligioustrophies1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesReligious1:14%,10:18%,50:22%,100:25%"Religious Awards"Find this popular religious cross figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at trophyCentral. Ships in a fast 1-2 days!qtcrossplReligious, 1st / 2nd / 3rd / Etc.custom-pagereligioustrophies20medals498551-30.5100021TrophyCentralInsertsSports, Hobby, Org, Livestock1Find this colorful Cross 2" Epoxy-covered insert discounted at TrophyCentral. Fast 1-2 day shipping.Religiouscustom-pagereligioustrophies1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesReligious1:14%,10:18%,50:22%,100:25%"Religious Awards"This popular Religious Cross trophy features a real marble base, column, figure and trim indicating year of award. Includes up to three lines of free engraving!qtcrossyrReligiouscustom-pagereligioustrophies1trophies498552-311821.06TrophiesReligious1Find this achievement cup trophy with religious cross figure discounted at TrophyCentral. Includes free text engraving!cup-cross-pReligiouscustom-pagemedallion-inserts-general-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsReligious1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals" "Religious Medals"50749004-29-2017Religious
custom-pagereligioustrophies1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Cross Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Religiouscustom-pagereligioustrophies1trophies498552-312421.33TrophiesReligious1Find these religious cross budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtcrossscbReligiouscustom-pagereligioustrophies1498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Find this budget cross award trophy discounted at Trophy Central. Features a real marble base and plastic religious cross figure. Engraving is free. Fast 1-2 day shipping.bdg-crossReligiouscustom-pagereligioustrophies1trophies498551-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Cross insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Religiouscustom-pagereligioustrophies1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75434.75Quick TrophyTrophiesReligious1:14%,3:19%,10:27%"Religious Awards"Find these fabulous two-tier Cross Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtcrossttReligiouscustom-pagereligioustrophies1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75434.75Quick TrophyTrophiesReligious1:14%,10:28%"Religious Awards"See this championship trophy with a Religious figure at TrophyCentral. Be sure to see all of our Religious figure awards.qtcrossttwReligiouscustom-pagereligioustrophies1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Cross single column insert trophy features a choice of column color, a marble base and free trophy engraving.Religiouscustom-pagereligioustrophies1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesReligious1:14%,10:18%,50:24%,100:28%"Religious Awards"This popular Religious Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtcrossscReligiouscustom-pagereligioustrophies1trophies498551-311821.06TrophyCentraltrophies1Religiouscustom-pagereligioustrophies1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.05Quick TrophyTrophiesReligious1:14%,10:18%"Religious Awards"Find This Popular Religious Cross Deluxe Platform Series Trophies Discounted at TrophyCentral. Real Marble Base; Free Personalization!qtcrossdmReligiouscustom-pagereligioustrophies1trophies498552-311218.84TrophiesReligious1Find this unique cup trophy with Religious Cross figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-cross-scbReligiouscustom-pagereligioustrophies1trophies498551-310.71217.38trophies1Religiouscustom-pagereligioustrophies1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Cross Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Religiouscustom-pagereligioustrophies1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.4226Quick TrophyTrophiesReligious1:14%,3:19%,10:24%"Religious Awards"Find these fabulous two-tier, 3-column Religious Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtcross3cReligiouscustom-pagereligioustrophies1medals498551-30.525035.5TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find this colorful Cross insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Crosscustom-pagereligioustrophies1medals498551-30.525035.5TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find this Cross insert medal with a personalized front rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Crosscustom-pagereligioustrophies1plaques498551-311.11623.5TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these religious cross insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Religiouscustom-pagereligioustrophies1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our cross insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Religiouscustom-pagereligioustrophies1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453633.4Quick TrophyTrophiesReligious1:14%,100:38%"Religious Awards"Our popular Religious participation trophies feature a real slant-front marble base and free engraving.qtcrossncReligiouscustom-pagereligioustrophies1plaques498552-41JDSPlaques1Find this cross plaque discounted at TrophyCentral. Our cross plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Religiouscustom-pagereligioustrophies1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Cross Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Religiouscustom-pageachievement-certificates-awards1"Download Only"free-academic4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Religious School Diploma template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Religious-School-Diploma-Certificatereligious-school-diplomaDiploma, Academic, Graduationcustom-pagetrophies-military-hero1trophies105503-610.4513028.65Classic MedallicsTrophiesAcademic1:22%,50:27%"Achievement Award" "Achievement Awards"Find This Popular American Flag Award Discounted at TrophyCentral! Price Includes Choice of 2" Subject Insert and Free Engraving!12-20-2020custom-pageart-trophies1trophies105503-610.4511211.73Classic MedallicsTrophiesAcademic1:22%,10:25%,50:29%,100:34%"Art Awards"Find Art Trophies discounted at TrophyCentral. Each art trophy features free engraving. Large quantity discounts.schooltrophies1306-15-2011Art, Academiccustom-pagetrophies-drama1trophies105503-610.4513028.65Classic MedallicsTrophiesAcademic1:22%,10:25%,50:29%,100:34%"Drama Awards" "Drama Trophies" "Drama Trophy"This sculptured resin Drama Trophy Includes Engraving. Be sure to see other section for additional Drama Awards.schooltrophies12See more popularin a large variety of styles.trophies-drama07-28-2010Dramacustom-pagetrophies-football1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511224.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,6:24%,12:26%,24:29%,48:31%"Football Awards"Star Series - Star Series Resin Trophies - Football. Ideal for leagues, schools, and tournaments. Fast shipping.tr7002Football, Sportscustom-pagetrophies-golf1"3-6 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"trophies105503-610.811215.2Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,3:26%"Golf Awards"tr5419Golf, Sportscustom-pagetrophies-golf1"3-6 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"trophies105503-610.811815.2Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,3:26%"Golf Awards"Resin Golf Club Head - 3 1/2" Award. Ideal for leagues, schools, and tournaments. Fast shipping.Golf, Sportscustom-pagereadingawards1105503-610.4513028.65Classic MedallicsTrophiesAcademic1:22%,100:34%This sculptured resin Reading Awards Trophy Includes Engraving. Be sure to see other section for additional Reading Awards.schooltrophies303-20-2016Readingcustom-pagescienceawards1105503-610.4511211.73Classic MedallicsTrophiesAcademic1:22%,10:25%,50:29%,100:34% "Science Awards"This sculptured resin Science Award Trophy Includes Engraving. Be sure to see other section for additional Science Awards.schooltrophies603-15-2016Sciencecustom-pagequickshiptrophies-spelling1trophies105503-610.4511224.45Classic MedallicsTrophiesAcademic1:22%,10:25%,50:29%,100:34%"Spelling Awards"This sculptured resin Spelling Award Trophy Includes Engraving. Be sure to see other section for additional Spelling Awards.schooltrophies1512-20-2020Spellingcustom-pageaward-medals1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-611224plaques1Find resin trophies discounted at TrophyCentral. Each resin trophy features free engraving. Fast 1-2 day shipping.tr-resin-trophiescustom-pagetrophies-wrestling1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.451 2 3 4 5 6 7 8 911224.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,6:24%,12:26%,24:29%,48:31%"Wresling Awards"Star Series Wrestling - trophies have been meticulously sculptured and hand painted in an antique gold finish with a star shape base.tr7014Wrestling, Sportscustom-pageaward-medals1trophies105503-610.4511211.73Classic MedallicsTrophiesAcademic1:22%,10:25%,50:29%,100:34%This sculptured resin Writing Award Trophy Includes Engraving. Be sure to see other section for additional Writing Awards.schooltrophies1401-15-2013Writing, Academiccustom-pageemployee-resource-hub11Comprehensive retirement and service milestone recognition guide. Discover meaningful ways to honor career achievements, service anniversaries, and retirement celebrations that create lasting memories.custom-pageghent-new-mobile-boards1Bulletin Boards4512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Reversible Magnetic Hygienic Porcelain Whiteboard with Aluminum Frame, 3'H x 4'W discounted at TrophyCentral.arm4m434Mobile, Reversiblecustom-pageghent-new-mobile-boards1Bulletin Boards4512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Reversible Magnetic Hygienic Porcelain Whiteboard with Aluminum Frame, 4'H x 6'W discounted at TrophyCentral.Mobile, Reversiblecustom-pageghent-new-mobile-boards1Bulletin Boards4512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Reversible Magnetic Hygienic Porcelain Whiteboard with Aluminum Frame, 4'H x 8'W discounted at TrophyCentral.Mobile, Reversiblecustom-pageghent-new-mobile-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Reversible Magnetic Porcelain Whiteboard with Aluminum Frame, 3'H x 4'W discounted at TrophyCentral.arm1m143Mobile, Reversiblecustom-pageghent-new-mobile-boards1Bulletin Boards4512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Reversible Magnetic Porcelain Whiteboard with Aluminum Frame, 4'H x 3'W discounted at TrophyCentral.arm1m143Mobile, Reversiblecustom-pageghent-new-mobile-boards1Bulletin Boards4512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Reversible Magnetic Porcelain Whiteboard with Aluminum Frame, 4'H x 6'W discounted at TrophyCentral.Mobile, Reversiblecustom-pageghent-new-mobile-boards1Bulletin Boards4512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Reversible Magnetic Porcelain Whiteboard with Aluminum Frame, 4'H x 8'W discounted at TrophyCentral.Mobile, Reversiblecustom-pageghent-new-mobile-boards1Bulletin Boards4512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Reversible Music Staff Porcelain Magnetic Whiteboard, 3'H x 4''W, 1-Sided discounted at TrophyCentral.Mobile, Reversiblecustom-pageghent-new-mobile-boards1Bulletin Boards4512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Reversible Music Staff Porcelain Magnetic Whiteboard, 3'H x 4''W, 2-Sided discounted at TrophyCentral.Mobilecustom-pageghent-new-mobile-boards1Bulletin Boards4512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Reversible Music Staff Porcelain Magnetic Whiteboard, 4'H x 6''W, 1-Sided discounted at TrophyCentral.Mobile, Reversiblecustom-pageghent-new-mobile-boards1Bulletin Boards4512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Reversible Music Staff Porcelain Magnetic Whiteboard, 4'H x 6''W, 2-Sided discounted at TrophyCentral.Mobile, Reversiblecustom-pageghent-new-mobile-boards1Bulletin Boards4512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Reversible Whiteboard / Cork Bulletin Board with Aluminum Frame, 4'H x 6'W discounted at TrophyCentral.Mobile, Reversiblecustom-pageghent-new-mobile-boards1Bulletin Boards4512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Reversible Whiteboard / Cork Bulletin Board with Wood Frame, 3'H x 4'W discounted at TrophyCentral.Mobile, Reversiblecustom-pageghent-new-mobile-boards1Bulletin Boards4512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Reversible Whiteboard / Cork Bulletin Board with Wood Frame, 4'H x 6'W discounted at TrophyCentral.Mobilecustom-pageghent-new-mobile-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Reversible Whiteboard / Cork Bulletin Board with Aluminum Frame, 3'H x 4'W discounted at TrophyCentral.armk43Mobile, Reversiblecustom-pageghent-new-mobile-boards1Bulletin Boards4512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Reversible Whiteboard / Cork Bulletin Board with Aluminum Frame, 4'H x 3'W discounted at TrophyCentral.armk43Mobile, Reversiblecustom-pageghent-new-mobile-boards1Bulletin Boards4512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Reversible Whiteboard with Aluminum Frame, 3'H x 4'W discounted at TrophyCentral.armm34Mobile, Reversiblecustom-pageghent-new-mobile-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Reversible Whiteboard with Aluminum Frame, 4'H x 3'W discounted at TrophyCentral.armm34Mobile, Reversiblecustom-pageghent-new-mobile-boards1Bulletin Boards4512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Reversible Whiteboard with Aluminum Frame, 4'H x 6'W discounted at TrophyCentral.Mobile, Reversiblecustom-pageghent-new-mobile-boards1Bulletin Boards4512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Reversible Whiteboard with Wood Frame, 3'H x 4'W discounted at TrophyCentral.Mobile, Reversiblecustom-pageghent-new-mobile-boards1Bulletin Boards4512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Reversible Whiteboard with Wood Frame, 4'H x 6'W discounted at TrophyCentral.Mobile, Reversible11TrophyCentral is a leading provider of trophies, awards and display cases. Guided by customer service, TrophyCentral has over 2000 5-star reviews!custom-pageribbons1-tiaras1"1-3 business days" "Topeka, Indiana" "UPS (Post Office Priority Mail also available)"465711-21 260.8104.4Tower RibbonSashes / Crowns / TiarasTiaras1:22%Find This Sleek And Slim Rhinestone Tiara Discounted At TrophyCentral. Typically Ship In Just 1-2 Business Days!custom-pagehigh-end-awards1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"general410187-1010.45444.45JcharlesCrystal Awards1:22%,25:24%"crystal awards"Find this Rhombus Award discounted at TrophyCentral. Includes free engraving.Leadershipcustom-pageawri1woyoulipr15"3-5 business days wo/imprinting, 5-7 days w/imprinting (Rush service may be available)" "Topeka, Indiana" "UPS (FedEx available on request)"ribbons465715-71 260.3650020.36Tower RibbonRibbons1:22%,50:29%:100:36%,500:45%"Quick-Ship Items"custom-pagetrophies-marksman-shooting-rifle12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Rifle 3 Position Inserts (Litho) at TrophyCentral. Each Rifle 3 Position Insert can be used to create a unique plaque, medal or trophy.504921
custom-pagetrophies-marksman-shooting-rifle12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Rifle 4 Position Inserts (Litho) at TrophyCentral. Each Rifle 4 Position Insert can be used to create a unique plaque, medal or trophy.504891
custom-pagetrophies-marksman-shooting-rifle12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "Sports Medals"These inexpensive 1 1/4 inch Rifle Shooter Medals offer a high quality, but low price for those on a tight budget.e907011-15-2013
custom-pagetrophies-marksman-shooting-rifle20medals498552-40.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful Rifle 2" Epoxy-covered insert decal discounted at TrophyCentral. Fast 1-2 day shipping.custom-pagetrophies-marksman-shooting-rifle1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Rifle Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.custom-pagetrophies-marksman-shooting-rifle1trophies498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Rifle / Hunting insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-Rifle-Insertcustom-pagetrophies-marksman-shooting-rifle1trophies498551-311821.06TrophyCentraltrophies1custom-pagetrophies-marksman-shooting-rifle1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Rifle Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.custom-pagetrophies-marksman-shooting-rifle1medals498552-30.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this colorful Rifle insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.custom-pagetrophies-marksman-shooting-rifle1medals498552-30.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Rifle insert medal with a personalized front rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.custom-pagecherry-insert-plaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these rifle insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.custom-pagetrophies-marksman-shooting-rifle1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Rifle Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.custom-pagetrophies-marksman-shooting-rifle12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Rifle Standing Inserts (Litho) at TrophyCentral. Each Rifle Standing Insert can be used to create a unique plaque, medal or trophy.50169112-05-2014
custom-pageawri11ribbons465715-71 260.4620016.46Tower RibbonRibbonsAwareness Ribbons1:22%,50:36%Buy White Right to Life Ribbons at TrophyCentral. Each Right To Life Awareness Ribbon Features A Tape Or Pin Back And Is Available With Optional Imprinting.ritoliriShop for Right to Life Ribbons with Ease at TrophyCentral TrophyCentral has a wonderful selection, discounted and bulk pricing and great customer service. Each white right to life awareness ribbon comes with a tape or pin back and is available with optional imprinting.]]>Right to Lifecustom-pagestar-trophies20medals498551-30.5100021TrophyCentralInsertsSports, Hobby, Org, Livestock1Find this colorful Rising Star 2" Epoxy-covered insert discounted at TrophyCentral. Fast 1-2 day shipping.Starcustom-pagestar-trophies1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Rising Star Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Starcustom-pagestar-trophies1trophies498551-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Rising Star insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Starcustom-pagestar-trophies1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Rising Star single column insert trophy features a choice of column color, a marble base and free trophy engraving.Starcustom-pagesports-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsGeneral1:22%,50:30%,100:33%,500:47%"Star Awards" "Star Award"RISING STAR Pin Letter Pins: EC Series RISING STAR Pin Lapel Pins feature a high-quality enameled finish and ship in just 1-2 business days!ec7008-10-2007Star, Generalcustom-pagestar-trophies1trophies498551-310.71217.38trophies1Starcustom-pagestar-pinsplastic-pinbox-t10Lapel pins498551-30.5200040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find this Rising Star Gold Enamel lapel pin discounted at TrophyCentral. Features a clutch-pin back for easy attachment to clothing.. Fast 1-2 day shipping.rising-star-u-pbStarcustom-pagestar-trophies1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Rising Star Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Starcustom-pagestar-trophies1medals498551-30.525035.5TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find this colorful Rising Star insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Starcustom-pagestar-trophies1medals498551-30.525035.5TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find this Rising Star insert medal with a personalized front rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Starcustom-pagestar-trophies1plaques498551-311.11623.5TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these rising star insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Starcustom-pagestar-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsBusiness1:30%,50:32%,100:35%,500:39%"Star Award" "Star Awards" "Meeting or Exceeding Goals" "Employee Lapel Pins" "Corporate Lapel Pins"Find these Rising Star pins discounted at TrophyCentral. Each Rising Star lapel pin features a gold finish and clutch-back.br36903-15-2011Star, Generalcustom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsGeneral1:22%Buy these high-quality Rising Star Inserts at TrophyCentral. Each Rising Star Insert can be used to create a unique plaque, medal or trophy.51816012-20-2040General, Star, Drama
custom-pagestar-trophies1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our rising-star insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Starcustom-pageschool-pinsplastic-pinbox-t5lapel pins498551-20.525040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find this Rising Star Gold Enamel lapel pin discounted at TrophyCentral. Features a clutch-pin back for easy attachment to clothing.. Fast 1-2 day shipping.rising-star-u-pbStarcustom-pageglass-crystal-awards1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"general410187-1010.45424.45JcharlesCrystal Awards1:22%,25:24%"crystal awards" "sales awards" "service awards" "corporate sales awards" "corporate service awards" "sales award" "service award" "corporate sales award" "corporate service award"Precisely cut from optic crystal, the facets of this impressive award promise to shine like a star in the night. A most fitting presentation for your stellar performers. Available in 3 sizes.Leadershipcustom-pagestar-trophies1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Rising Star Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Starcustom-pageghent-new-mobile-boards1Bulletin Boards4512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Roam Rolling Whiteboard 45"H x 36"W discounted at TrophyCentral.Mobilecustom-pagetrophies-baseball1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.45169.5Tower RibbonTrophies1:14%Rock N Jox Baseball Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.wrj651Baseball / T-Ball, Sportscustom-pagetrophies-cheerleading-spirit1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.45169.5Tower RibbonTrophies1:14%This Fun Rock N Jox Style Cheerleader with Star Trophy Measures 6.5 Inches In Height. Price Of Rock N Jox Cheerleader with Star Trophy Includes Engraving.wrj660Cheerleading, Sportscustom-pagetrophies-football1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.45169.5Tower RibbonTrophies1:14%Rock N Jox Trophy - Football. Ideal for leagues, schools, and tournaments. Fast shipping.wrj659Football, Sportscustom-pagetrophies1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"465713-4169.51This fun Rock-N-Sox participation trophy measures 6.5 inches in height. Price includes engraving. Available in many popular sports!rock-n-jox-allcustom-pageaward-medalsqtrollerncqtrollerscqtrollerdmqtrolleryrqtrollerplqtrollerttqtrollerttwqtroller3cmqtrollerscbcup-roller-pcup-roller-scb1trophies1See our great selection of roller hockey trophies. Each roller hockey trophy includes free engraving! Fast 1-2 day shipping!Custom Roller Hockey Recognition Trophies TrophyCentral has a great selection of roller hockey awards and trophies. Be sure to see our Roller Hockey Trim Trophies, available with the current year trim, ideal for any event. Our Two-Tier Trophies are also popular for tournament winners. All of our roller hockey awards include up to three lines of FREE ENGRAVING (larger awards include additional lines). ]]>custom-pagetrophies-roller-hockey1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular roller hockey figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!qtrollerplRoller Hockey, 1st / 2nd / 3rd / Etc., Sportscustom-pagetrophies-roller-hockey1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%This popular Roller Hockey Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!qtrolleryrRoller Hockey, Sportscustom-pagetrophies-roller-hockey1trophies498852-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with roller hockey figure discounted at TrophyCentral. Includes free text engraving!cup-roller-pRoller Hockey, Sportscustom-pagetrophies-roller-hockey1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these roller hockey budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtrollerscbRoller Hockey, Sportscustom-pagetrophies-roller-hockey1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous two-tier Roller Hockey Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtrollerttRoller Hockey, Sportscustom-pagetrophies-roller-hockey1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-411.215Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%Find this awesome Roller Hockey two tier championship trophy discounted at TrophyCentral. Add up to 3 lines of Free Personalization!qtrollerttwRoller Hockey, Sportscustom-pagetrophies-roller-hockey1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%This popular Roller Hockey Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtrollerscRoller Hockey, Sportscustom-pagetrophies-roller-hockey1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.451623.65Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%These quick-ship trophies from TrophyCentral feature a Roller Hockey figure, real marble base and marble trophy figure platform, choice of column size and color.qtrollerdmRoller Hockey, Sportscustom-pagetrophies-roller-hockey1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Roller Hockey figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-roller-scbRoller Hockey, Sportscustom-pagetrophies-roller-hockey1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-411.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous two-tier, 3-column champion Roller Hockey Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtroller3cRoller Hockey, Sportscustom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Roller Hockey Inserts (Litho) at TrophyCentral. Each Roller Hockey Insert can be used to create a unique plaque, medal or trophy.507411Hockey, Sports
custom-pageeawardmedals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "Sports Medals"These inexpensive 1 1/4 inch Roller Hockey Medals offer a high quality, but low price for those on a tight budget.e908212-20-2020Roller Hockey, Sports
custom-pagetrophies-roller-hockey1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%,25:23%,50:29%,100:34%Our popular Roller Hockey Participation Trophies feature a real slant-front white marble base and free personalization. Significant quantity discounts available.qtrollerncRoller Hockey, Sportscustom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Rollerblade Inserts (Litho) at TrophyCentral. Each Rollerblade Insert can be used to create a unique plaque, medal or trophy.507410Rollerblading
custom-pageeawardmedals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "Sports Medals"These inexpensive 1 1/4 inch Rollerblading Medals offer a high quality, but low price for those on a tight budget.e908112-20-2020Rollerblading
custom-pageglass-crystal-awards1"10-15 business days w/engraving" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"general105505-1010.451 2 3 4 5 6 7 8 91420.45Classic MedallicsCrystal Awards1:30%,25:29%"Minuteman" Shop for Roman Arch from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.Leadershipcustom-pagefirst-place-ribbonsstockrosetterosettecusminwfunbucustomrosetteblue-ribbonscusrossinstrstocminrosetteribbonch7rbsxrosecx1award-ribbons-rosettes1Shop rosette ribbons for awards, competitions and events. USA-made quality. Custom and stock options with fast shipping and great pricing from TrophyCentral.Elegant Designs & Premium Quality Materials

Our rosette ribbons showcase vibrant colors and professional layered construction using premium satin and acetate materials for lasting durability.

Each rosette award features a premium rosette ribbon design with carefully pleated centers with secure attachment points, and smooth-flowing streamers. The rich fabric textures and brilliant color combinations create impressive awards that recipients will proudly display.

Customization Options for Every Event

Transform standard ribbons into personalized recognition pieces with your custom text, logos, or ceremony details printed on center buttons or streamers. Choose from various ribbon lengths, streamer configurations, and specialized graphics to match your next event's theme.

Most custom rosette ribbon orders ship within 4-6 business days, with professional artwork assistance available. Our customization services ensure every ribbon award reflects your organization's unique character and prestige.

Why Choose Trophy Central for Your Rosette Ribbons

Since 1999, Trophy Central has delivered exceptional rosette ribbon awards with USA-based production and unmatched customer service expertise. Our commitment to producing superior rosette awards with quality materials, competitive pricing, and reliable shipping has earned thousands of positive reviews from satisfied customers.

Our extensive product selection includes both ready-to-ship stock options and fully customized designs at transparent price points for every budget. Trust our award specialists to help you select the perfect rosette ribbons for your recognition needs.

Order with Confidence

Browse our extensive rosette ribbon collection online and easily customize your awards with our user-friendly design tools and preview options. Take advantage of quantity discounts on larger orders and enjoy free shipping on purchases over $99. Place your order today to ensure timely delivery for your upcoming ceremony.

Frequently Asked Questions

What sizes are available for ribbon awards?

Our rosette ribbons come in multiple sizes, ranging from compact mini-rosette awards to large three-streamer designs. Each product page includes detailed sizing information to help you select the perfect dimensions for your needs.

What information can be printed on rosette awards?

Our customized rosette ribbons can feature text, logos, dates, or event names on the center buttons or streamers. The specific customization options and price vary by product, so check individual product descriptions for details.

Is there a minimum order quantity for custom rosette awards?

Minimum order requirements vary by product, so please check each individual product description for specific quantity details. Our competitive price structure makes customized ribbon awards affordable for both small ceremonies and large competitions.

How quickly do stock rosette ribbons ship?

Most stock rosette ribbons, including 1st-10th place and honorable mention ribbon awards, ship within 1-2 business days, ensuring quick delivery for urgent needs. You can view the exact availability and price for each custom product directly on its detail page.

]]>
award-ribbons-printed custom-ribbons
custom-pageclocks1"1-2 business days" "Marquette, MI" "UPS"personalized gifts498552-310.45510.45Quick TrophyGiftsClocks1:14%"New Products"Rosewood Awards Clock from TrophyCentral.Engraved Clockscustom-pageclocks11"5-10 business days w/engraving, 1-3 without" "Marquette, Michigan" "UPS (FedEx available on request)"personalized gifts498555-1010.45129.81JDS-S1:22%,5:23%custom-pageperplaq1"7-10 business days w/engraving" "Chicago, Illinois" "UPS (FedEx available on request)"perpetual plaques606307-101 3 230.6524.45RS Owensplaques1:22%Find these elegant Piano Finish Rosewood Perpetual Plaques in a variety of sizes. Each Rosewood Perpetual Plaque includes free engraving of header plate and one nameplate.custom-pagegavelplaques11"4-6 business days" "Mount Vernon, NY" "UPS"plaques105503-610.4513636.45Classic MedallicsPlaques, GiftsGavels1:22%Rosewood Gavel from TrophyCentral. Engrave your Gavel for Special Touch. Quick Shipping on Gavels and Awards.Gavelcustom-pagegifts-desk-general11personalized gifts105503-610.451810.05Classic MedallicsGiftsEngraved Gifts1:22%Shop for Rosewood Keepsake Boxes from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.Engraved Giftscustom-pagegifts-desk-general1"1-2 business days" "Marquette, MI" "UPS"personalized gifts498852-310.4520034.45Quick TrophyGiftsCustom Pens1:14%"New Products"Find these fabulous Rosewood Pen Cases discounted at TrophyCentral. TrophyCentral is known for its top-rated customer serviceCustom Penscustom-pageperplaq11perpetual plaques6063010-141 3 230.45511.45RS OwensPlaquesPerpetual Plaques1:22%Find this 12 name plate perpetual plaque discounted at TrophyCentral. Features a beautiful Rosewood finish and engraving and top and first name plate.custom-pageclocks11"7-10 business days w/engraving, 1-3 without" "Chicago, Illinois" "UPS (FedEx available on request)"personalized gifts606307-101 3 230.45129.81RS Owens1:22%custom-pagename-badges-tagswoyoulipr100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Round Badges Discounted At TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.namebadges-rndcustom-pagename-badges-tagswoyoulipr100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Round Nameplate Badges Discounted At TrophyCentral.namebadges-rndncustom-pagename-badges-tagswoyoulipr100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Round Pennant Badges Discounted At TrophyCentral.namebadges-pennantcustom-pageschool-pins1"1-2 business days" "Columbia, SC"lapel pins290631-31 2 3 230.4150030.4Certificate Sourcelapel-award-pinsAcademic1:22%,50:28%,100:32%,500:36%"School Pins"Round School Lapel Pins from TrophyCentral.Generalcustom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Rowing (503631) Inserts (Litho) at TrophyCentral. Each Rowing (503631) Insert can be used to create a unique plaque, medal or trophy.503631Boating / Sailing, Sports
custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Rowing (506041) Inserts (Litho) at TrophyCentral. Each Rowing (506041) Insert can be used to create a unique plaque, medal or trophy.506041Boating / Sailing, Sports
custom-pagecospwabo50"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745315125016.5PepcoPromotional ProductsSports / Water Bottles1:14%,250:21%,500:31%,1000:45%,2500:49%Royal Blue Custom Sports Bottles from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.sportsbottles-royalSports / Water Bottlescustom-pagerunning-trophies20medals498551-30.5100021TrophyCentralInsertsSports, Hobby, Org, Livestock1Find this colorful Running 2" Epoxy-covered insert discounted at TrophyCentral. Fast 1-2 day shipping.custom-pagerunning-trophies1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Running Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.custom-pagerunning-trophies1trophies498551-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Running insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.custom-pagerunning-trophies1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Running single column insert trophy features a choice of column color, a marble base and free trophy engraving.custom-pagerunning-trophies1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Running Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.custom-pagerunning-trophies1medals498551-30.525035.5TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find this colorful Running insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Running, Sportscustom-pagerunning-trophies1medals498551-30.525035.5TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find this Running insert medal with a personalized front rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Running, Sportscustom-pagerunning-trophies1plaques498551-311.11623.5TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these running insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.11Find running medals discounted at TrophyCentral. Each running medal features a free ribbon. custom-pagetrophies-track-field1105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Jogging Or Marathon Inserts (Litho) at TrophyCentral. Each Jogging Or Marathon Insert can be used to create a unique plaque, medal or trophy.506731custom-pagerunning-trophies1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our running insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.custom-pagerunning-trophies1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Running Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.custom-pageaward-medalsrunning-plaque-imarathon-eirunning-ei5067315070371trophies1Find running trophies discounted at TrophyCentral. Each running trophy includes up to 3 lines of personalization.

Custom Running Trophies & Awards - Honor Every Finish Line

Running awards celebrate the discipline, determination, and personal grit that make every race memorable - whether a child is crossing the finish line of their first fun run or a seasoned marathoner is breaking the tape after 26.2 grueling miles. From youth cross country programs building lifelong fitness habits to 5K charity races uniting communities around worthy causes, from age-group divisions honoring runners who compete decade after decade to overall winner awards crowning the fastest finishers on race day, our running and marathon awards recognize every milestone on roads, trails, and tracks. Our marathon and running trophies feature dynamic mid-stride runner figurines capturing the focus and form of competitive racing, sleek column designs with road and track motifs in gold, silver, and bronze finishes, and premium resin sculptures depicting finish-line moments worthy of any mantle or trophy case. Our running and marathon medals - the signature award of road racing culture - arrive in custom die-cast and stamped designs with vibrant color fills and event-specific artwork, available in 2-inch to 4-inch diameters and sized perfectly for finisher medals, age-group recognition, and overall winner honors, each with a free ribbon included.

Frequently Asked Questions About Running Trophies and Medals

What running awards work best for different race and event categories?

Finisher medals are the cornerstone of mass participation road racing - 5Ks, 10Ks, half marathons, and marathons all benefit from a quality custom medal every participant can wear across the finish line, turning a personal achievement into a lasting keepsake. Overall winners and top-three podium finishers deserve a commanding trophy in the 12-inch to 18-inch range that reflects the competitive prestige of winning outright. Age-group awards - the lifeblood of recreational road racing - are best served by medals or 8-inch to 12-inch trophies that recognize each division without overshadowing the overall podium. Youth fun runs and charity races prioritize universal recognition, where participation medals ensure every runner feels celebrated regardless of finish time or placement. Cross country team awards call for traditional column trophies in the 15-inch to 20-inch range for team champions, with individual medals for varsity letter earners and all-conference honorees. Multi-race series and running clubs benefit from perpetual plaques or traveling trophies updated season over season to build program tradition and long-term recognition.

What details should running and marathon award engraving include?

Engraving transforms a generic award into a permanent race-day record worth displaying for decades. Essential elements include runner name, race or event name, finish placement or age-group division, and race year. Finish time elevates an engraving from a memento to a personal achievement marker - examples like Sarah Chen, Female Overall Winner, Harbor Marathon 2025, 3:08:42 or Michael Torres, M40-44 Age Group Champion, Riverside 10K, 47:23 tell the complete story at a glance. Team cross country awards should include school or club name, meet name, and season year, with conference or state championship designations adding long-term significance. Charity and fun run awards can embrace mission-driven language like Proudly Ran for a Reason alongside the runner's name and event. For coaches and race directors receiving recognition awards, include years of service or number of events organized alongside the individual's name. Keep text concise and readable, prioritizing the most meaningful details when space limitations require choices.

Should road races award finisher medals to all participants or only top finishers?

The finisher medal has become a defining tradition of road racing culture - marathon and half marathon participants in particular expect a medal at the finish line regardless of placement, and many runners cite the finisher medal as a primary motivation for signing up. For events of any distance drawing large participation fields, universal finisher medals drive registration, generate social media sharing at the finish line, and create word-of-mouth that grows the race year over year. This doesn't mean all recognition looks the same: layer your award structure with distinctively designed medals or trophies for overall winners, top-three podium finishers, and age-group champions to preserve competitive prestige within a participation-friendly event. Youth fun runs and school fundraiser runs benefit most from universal recognition, where a simple participation medal builds the positive association with running that turns young participants into lifelong athletes. Competitive cross country invitationals and track meets appropriately reserve awards for genuine achievement - varsity finishers, all-conference selections, and team champions - where the trophy signals earned excellence rather than participation.

If you need more information before deciding, see our expert resource section:
]]>
trophies marathon-medals
custom-pageletter-shaped-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find these popular S-shaped custom mascot badges at TrophyCentral. Great for fundraising! TrophyCentral is a top-rated Yahoo merchant.letterbadges-scustom-pageaward-medalsqtwingedwheelncqtwingedwheelscqtwingedwheeldmqtwingedwheelplqtwingedwheelyrqtwingedwheelttqtwingedwheelttwqtwingedwheel3cmqtwingedwheelscbcup-wingedwheel-scbcup-wingedwheel-pbdg-wheel1trophies1Find safe driver trophies discounted at TrophyCentral. Each wheel and safe driving trophy features free personalization. Fast 1-2 day shipping. Perfect for racing and drivers ed classes.wheel trophies, wheel trophy, wheel awards, wheel trophies and awardsShop For Custom Driving Trophies and Awards With Confidence at TrophyCentral

TrophyCentral has been supplying driving schools, trucking companies, corporate safety programs, and recognition events with quality awards since 1999. All driving trophies include up to three lines of free engraving. Need awards in a hurry? Orders without engraving typically ship in 1-2 business days and sometimes the same day, depending on time of year and when the order is placed. Browse our complete trophies collection for additional styles and designs.

Driving Trophy FAQ

What types of programs and events use driving trophies?

Driving trophies are used across a wide range of programs and occasions. The most common include safe driver recognition programs for corporate fleets and transportation companies, driving school graduations and completions, driver of the year awards, years of accident-free service recognition, and trucking and logistics industry milestones. Whether you are recognizing a teen driver who completed their first course or a commercial driver with a flawless safety record, our wheel-design trophies are a meaningful way to acknowledge the achievement.

Can I personalize a driving trophy with the recipient's name and program information?

Yes. Every driving trophy includes up to three lines of free engraving. Popular examples include "2026 Safe Driver of the Year - Michael Torres" or "Acme Logistics - 10 Years Accident Free." For driving school programs recognizing a full graduating class, engraved medals are a cost-effective option that still delivers a professional presentation.

How quickly will my driving trophies ship?

Orders typically ship in 1-2 business days and sometimes the same day, depending on time of year and when the order is placed, making it straightforward to plan ahead for recognition events and graduation ceremonies.

Are driving trophies appropriate for corporate safety programs?

Yes. Many of our driving trophies are well suited for corporate and workplace safety recognition, including fleet driver programs, transportation company milestones, and insurance-sponsored safe driving incentives. Engraved plaques are also a popular choice for workplace settings where a wall-mounted award is preferred over a traditional trophy.

Do you offer bulk pricing for fleet and corporate driving programs?

Yes. TrophyCentral offers quantity discounts on trophy and medal orders, which is particularly useful for corporate programs recognizing multiple drivers or departments at the same event. The more you order, the lower the per-unit price. Discounted pricing is shown on each product page.

]]>
custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these high-quality Safe Driver Award Inserts at TrophyCentral. Each Safe Driver Award Insert can be used to create a unique plaque, medal or trophy.518571General
custom-pagequickshiptrophies-wheel1trophies498551-310.453633.4trophies1Find this budget wheel / safe driver award trophy discounted at TrophyCentral. Features a real marble base and plastic winged steering wheel figure. Engraving is free. Fast 1-2 day shipping.Drivingcustom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these high-quality Safe Driver Inserts at TrophyCentral. Each Safe Driver Insert can be used to create a unique plaque, medal or trophy.517653General
custom-pagequickshiptrophies-wheelplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"Find these Safe Driver pins discounted at TrophyCentral. Each Safe Driver Award pin features a quality finish and clutch back.br554Generalcustom-pagefreeawardcertificates1"Download Only"certificates49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Safety template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Safety-Certificatesafety-freeSafety, Employee, Academiccustom-pagecorporatepinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsBusiness1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"Find Safety First pins discounted at TrophyCentral. Each Safety First Lapel Pin features a quality clutch-back.br356Generalcustom-pagemedallion-inserts-occupational-subjects12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsGeneral1:22%Buy these quality Safety Inserts (Litho) at TrophyCentral. Each Safety Insert can be used to create a unique plaque, medal or trophy.491509General
custom-pageachievement-certificates-awards1"Download Only"free-academic49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Safety Patrol template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Safety-Patrol-Certificatesafety-patrol-freeSafety, Employee, Academiccustom-pageawardcertificates11certificates290631-31 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,25:24%,100:40%,500:50%Find These Printed Safety Patrol certificates discounted at TrophyCentral. Each Safety Patrol certificate is beautifully printed and template measures 8 1/2 x 11.984Academiccustom-pageschool-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"Find these Safety Patrol Pins discounted at TrophyCentral. Each pin features a quality clutch back. Be sure to browse all of our student lapel pins.br43612-20-2020Safety Patrolcustom-pagecorporatepinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsBusiness1:30%,50:32%,100:35%,500:39%Find this Safety Through Teamwork Pin at TrophyCentral. Safety Through Teamwork and other pins ship in just 1-2 business days!br529Businesscustom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these high-quality Safety Through Teamwork Inserts at TrophyCentral. Each Safety Through Teamwork Insert can be used to create a unique plaque, medal or trophy.518356General, Business
custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Sail 1 Design Inserts (Litho) at TrophyCentral. Each Sail 1 Design Insert can be used to create a unique plaque, medal or trophy.50443109-17-2016Boating / Sailing, Sports
custom-pageaward-medalsqtsailboatncqtsailboatscqtsailboatdmqtsailboatplqtsailboatyrqtsailboatttqtsailboatttwqtsailboat3cmqtsailboatscbcup-sailboat-scbcup-sailboat-pbdg-sailingsailing-cup-place-column-trophysailing-cup-place-trophy1trophies1Reward top sailors and regatta winners with beautiful custom sailing trophies and awards. Find the perfect boat trophy at TrophyCentral today. Shop for Custom Sailing Trophies with Ease at TrophyCentral TrophyCentral has a great online selection to meet your needs. Be sure to see our popular Single Column Sailing Trophy, available in several sizes and with several different color columns. Our place trophies with a sail boat figure and choice of 1st, 2nd or 3rd place trim is also a popular choice. These sailing awards are perfect for a race or club event. Recognizing your sailors is a breeze at TrophyCentral!

Frequently Asked Questions (FAQ)

Can sailing awards be personalized?

Yes! All trophies in the sailing section include free engraving, allowing you to add winner names, event details, or a special message. Personalization makes each award more meaningful and unique.

How long does it take to receive a sailing trophy?

Most of our sailing trophies and awards ship within a fast 1-2 business days. If you need an award quickly, we also offer expedited shipping options to ensure it arrives on time for your event.

Do you offer bulk discounts?

Yes! We offer special pricing for bulk orders. If you are purchasing multiple trophies for a sailing club, regatta, or league, contact us for a custom quote.

]]>
silver-cup-trophies crystalcups
custom-pagetrophies-sailing-boat1trophies498551-310.452429Trophies1Find this popular Sailing trophy discounted at TrophyCentral. Features a real marble base, free engraving and fast shipping.sailing-cup-place-trophy-tccustom-pagetrophies-sailing-boat1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Fabulous Sailboat Figure trophy with choice of 1st, 2nd or 3rd place trim.qtsailboatplBoating / Sailing, 1st / 2nd / 3rd / Etc., Sportscustom-pagetrophies-sailing-boat1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular Sailboat trophy with year trim discounted at trophyCentral. Available in multiple sizes and includes free personalization.qtsailboatyrBoating / Sailing, Sportscustom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Sailing 6 Meter Inserts (Litho) at TrophyCentral. Each Sailing 6 Meter Insert can be used to create a unique plaque, medal or trophy.503861Boating / Sailing, Sports
custom-pagetrophies-sailing-boat1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with sailboat figure discounted at TrophyCentral. Includes free text engraving!cup-sailboat-pBoating / Sailing, Sportscustom-pagefree-sports-templates1"Download Only"free-sports4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Sailing template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Sailing-Certificatesailing-freeBoating / Sailing, Sportscustom-pagetrophies-sailing-boat1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these sailboat budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtsailboatscbBoating / Sailing, Sportscustom-pagetrophies-sailing-boat1trophies498551-310.453633.4trophies1Find this budget sailing award trophy discounted at TrophyCentral. Features a real marble base and plastic sailboat figure. Engraving is free. Fast 1-2 day shipping.Boating / Sailing, Sportscustom-pagetrophies-sailing-boat1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous two-tier Sailboat Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtsailboatttBoating / Sailing, Sportscustom-pagetrophies-sailing-boat1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:28%Find These Awesome Sailing Two Tier Championship Trophies Discounted At TrophyCentral. Add Up To 3 Lines Of Free Personalization!qtsailboatttwBoating / Sailing, Sportscustom-pagetrophies-sailing-boat1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%Find these popular Sailboat Single Column Elite Series Trophies discounted and with free personalization at TrophyCentral.qtsailboatscBoating / Sailing, Sportscustom-pagetrophies-sailing-boat1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.05Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%Find This Popular Sailing Deluxe Platform Series Trophies Discounted at TrophyCentral. Real Marble Base; Free Personalization!qtsailboatdmBoating / Sailing, Sportscustom-pagetrophies-sailing-boat1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Sailboat figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-sailboat-scbBoating / Sailing, Sportscustom-pagetrophies-sailing-boat1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.4226Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous Champions Line 3-Column Sailboat Trophies discounted at TrophyCentral. Free personalization and fast 1-2 day shipping!qtsailboat3cBoating / Sailing, Sportscustom-pagetrophies-sailing-boat1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:38%Our popular Sailboat participation trophies feature a real slant-front marble base and free engraving.qtsailboatncBoating / Sailing, Sportscustom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these high-quality Sales - Inserts at TrophyCentral. Each Sales - Insert can be used to create a unique plaque, medal or trophy.51332112-20-2020Occupations
custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these high-quality Sales Achievement Award Inserts at TrophyCentral. Each Sales Achievement Award Insert can be used to create a unique plaque, medal or trophy.517787Occupations
custom-pagefreeawardcertificates1"Download Only"certificates49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Sales Award template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Sales-Award-Certificatesales-award-freeSales, Employeecustom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these high-quality Sales Excellence Inserts at TrophyCentral. Each Sales Excellence Insert can be used to create a unique plaque, medal or trophy.518499Occupations, Business
custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these quality Sales Lady Inserts (Litho) at TrophyCentral. Each Sales Lady Insert can be used to create a unique plaque, medal or trophy.501411Occupations
custom-pagecorporatepinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsBusiness1:30%,50:32%,100:35%,500:39%"Meeting or Exceeding Goals"Find this Sales Leader pin discounted at TrophyCentral. Each Sales Leader lapel pin features a clutch-back. Large quantity discounts.br37004-07-2006Business, Leadershipcustom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these high-quality Sales Leader Award Inserts at TrophyCentral. Each Sales Leader Award Insert can be used to create a unique plaque, medal or trophy.518184Occupations, Leadership
custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these high-quality Sales Person Of The Month Inserts at TrophyCentral. Each Sales Person Of The Month Insert can be used to create a unique plaque, medal or trophy.518174Occupations
custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these quality Salesman Inserts (Litho) at TrophyCentral. Each Salesman Insert can be used to create a unique plaque, medal or trophy.504511Occupations
custom-pagestar-trophies1"4-6 business days " "Mount Vernon, NY" "UPS"trophies105503-610.4511234.05Classic MedallicsTrophiesGeneral1:22%,20:31%Find This 8" Sandstone Star Resin Trophy Discounted At TrophyCentral. Price Includes 3 Lines Of Engraving!03-30-2017Generalcustom-pagetrophies-beauty-queensashessacsiribbons1-tiarasribbons1-crownspacofbacnumconnumraffleticketssorufologomegaphoneshafarasimascot-badgesletter-shaped-badgesseatcushionscustom-pom-poms1award-ribbons-rosettes2-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
498555-8.52"Awards" "Purchase Trophies" "Purchase Trophies Online" "Buy Trophies Online" "Trophy Store" "Trophy Stores"Shop sashes, tiaras, crowns, and event accessories for competitions, pageants, and school events. Perfect for recognizing achievements in style.banners-spirit
custom-pagemusicartpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsMusic, Drama, Art, Dance1:22%,50:30%,100:33%,500:45%"Music Lapel Pins" "Band Lapel Pins" "Music Pins"Find These Saxophone Lapel Pins Discounted at TrophyCentral. Each Saxophone Pin Features a Clutch-Pin Back and Fast 1-2 Day Shipping!mp6Music / Band / Choruscustom-pagefree-sports-templates1"Download Only"free-sports free-academic49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Scholar Athlete template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Scholar-Athlete-Certificatescholar-athlete-freeAcademic, Sportscustom-pageschool-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins"br43506-14-2010General, Academic (General)custom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these high-quality Scholar Athlete Inserts at TrophyCentral. Each Scholar Athlete Insert can be used to create a unique plaque, medal or trophy.51839906-15-2012Sports
custom-pageschool-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins"Find this Scholar Athlete Pin at TrophyCentral. Scholar Athlete and other pins ship in just 1-2 business days!br43006-14-2010Academic (General)custom-pagescholarship-award11custom-pagescholarship-award11Thank you page for TrophyCentral's Scholarship Award application submission.1custom-pagescholarship-resource-hub11See real winning scholarship essays with annotations explaining what works. Includes 4 fill-in-the-blank templates for sportsmanship and character essays.custom-pagescholarship-resource-hub11Comprehensive scholarship interview preparation guide for students. Includes 20 common questions with answer strategies.custom-pagescholarship-resource-hub11Master scholarship season with this teacher timeline guide. Learn when requests peak, how to plan ahead, and manage deadlines without overwhelm. Practical monthly planning strategies.custom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these quality Scholastic Achievement (493641) Inserts (Litho) at TrophyCentral. Each 2"nsert can be used to create a unique plaque, medal or trophy.493641General, Academic
custom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these quality Scholastic Achievement (506721) Inserts (Litho) at TrophyCentral. Each Scholastic Achievement (506721) Insert can be used to create a unique plaque, medal or trophy.506721General
custom-pagemedals-ir-series12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic Medallicsaward-medalsAcademic1:22%,10:27%,100:36%"School Medals" "School Awards"These 1 1/2 Inch Scholastic Achievement medals come in gold, silver and bronze finishes and are perfect for recognizing different place winners.ir32Academic
custom-pagemedals-diamond-cut-edge12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic Medallicsaward-medalsAcademic1:22%,25:29%,100:38%"School Awards" "School Award Medals"See Our Scholastic Achievement Medals With A Diamond-Cut Edge. Also See Our Other High-Quality Scholastic Achievement Awards At TrophyCentral!z9003General, Academic
custom-pageeawardmedals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsAcademic1:22%,100:28%,500:34%,1000:45%These inexpensive 1 1/4 inch Scholastic Achievement Medals offer a high quality, but low price for those on a tight budget.e9003General, Academic
custom-pagemedallion-inserts-academic-medallion-inserts1105502-40.3713003.37Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Find these fabulous Scholastic Awards With Imprint Inserts and Medals discounted at TrophyCentral. TrophyCentral is known for its top-rated customer serviceGeneralcustom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these quality Scholastic Lamp And Books Inserts (Litho) at TrophyCentral. Each Scholastic Lamp And Books Insert can be used to create a unique plaque, medal or trophy.507393General, Academic
custom-pagetrophies-honor-roll-society125medals105502-50.751 2 3 4 5 6 7 8 9130042.75Classic Medallicsaward-medals1:22%,500:41%Find School Subject Award Medals at TrophyCentral. All Academic Award Medals include Neck Ribbons and Optional Engraving.Academiccustom-pagefree-school-certificate-templatescitizenship-awardsscience-award-certificatesreading-certificateshonor-roll-certificatesmusic-award-certificates7002700770127003700470107020702170307027703570507036artawce9039069099139049079189059089129209299329219309339319359409439619649419629659429509639669699719849681certificates0.31"School Awards" "Quick-Ship Items" "Gold School Medals" "Award Certificates and Diploma Covers" "Award Certificates and Diploma Holders" "Award Certificates and Diploma Frames" "Award Certificate and Diploma Holders" "Certificate and Diploma Holders" "Certificates and Frames" "Certificates and Diploma Holders" "Diploma Covers and Certificates" "Diploma Covers and Award Certificates" "Diploma Covers, Frames and Holders" "Diploma Covers, Frames, Holders and Certificates"Find school certificates discounted at TrophyCentral. Each school certificate and template measures 8 1/2 x 11. Fast 1-2 day shipping.

Printed School Certificates & Templates with Photo Images

This section includes a fabulous selection of high-quality, academic certificates featuring colorful photographs. Each school certificate measures a standard 11" x 8 1/2", is printed on 60 lb. paper and includes a place to write or print the student's name, event, date and more. There are a large variety of school subjects, including: honor roll, art, attendance, science, math, reading, student council and many more. We also have several other related sections: printed certificates (colorful certificates in a variety of school subjects), sports certificates and custom certificates.

Shop with Confidence at TrophyCentral!

If you are looking to buy school certificates online, look no further! TrophyCentral has a great selection that will fit any budget. Our top-rated representatives are happy to assist you with all of your sports and school certificate and award needs. Our experts in New York and Michigan have been providing suggestions and guidance since 1999! To find the perfect school certificate, click on an image above, or for personal service, call us toll-free at 1-888-809-8800.

]]>
custom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these high-quality School Bus Inserts at TrophyCentral. Each School Bus Insert can be used to create a unique plaque, medal or trophy.518218Academic, Occupations, School Bus
custom-pageschool-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"Find this School Bus Pin at TrophyCentral. School Bus and other pins ship in just 1-2 business days!br30612-20-2020Academic, Occupations50"28 business days"4020128-350.83030.8CentennialDiploma Covers11:22%,2500:47%"Diploma Covers" "Padded Diploma Covers" "Diploma Holders" "School Diploma Covers" "Award Certificates and Diploma Covers" "Award Certificates and Diploma Holders" "Award Certificates and Diploma Frames" "Award Certificate and Diploma Holders" "Certificate and Diploma Holders" "Certificates and Frames" "Certificates and Diploma Holders" "Diploma Covers and Certificates" "Diploma Covers and Award Certificates" "Diploma Covers, Frames and Holders" "Diploma Covers, Frames, Holders and Certificates"Find these School Diploma Covers and Holders at TrophyCentral. These high-quality school covers are available in a variety of styles and colors.12-20-2020custom-pagefree-school-certificate-templateshonorrollpinsreadingpinsmath-lapel-pinsperfect-attendance-pinsscience-lapel-pinsspelling-pins-medals3d-2026student-council-pins3d8-academic1xxxec835004xal82rising-star-u-pbec16academic-u-pbec35academic-pbhp07hp20hp19hp22hp24hp25hp02hp06ap72ap77ap80ap68ap118ap04ap09br304br363br319br601hp13br314br134br306br634br567br357br358br436br405br411br395br540br436br430br471br377br2218br241br43511xxbr2119111x3d-yearbook1lapel-award-pins1School pins are more than just accessories. These academic pins are cherished tokens of recognition and pride. From commemorating academic milestones to promoting school spirit, our custom pins offer a versatile solution for any occasion.

With options for personalization, bulk ordering, and fast shipping, we make it easy to honor your students' achievements. Explore our collection today and find the perfect pin to celebrate your school's unique community.

Why Choose Trophy Central for Your Award Pins?

Trophy Central has been a trusted leader in recognition products since 1999, serving over 100,000 customers, including 370+ Fortune 500 companies and 9,600+ educational institutions.

Our commitment to excellence encompasses expert design assistance, fast production turnaround, and competitive bulk pricing, all backed by secure online ordering and multiple payment options.

Our U.S.-based production facilities ensure superior quality control, while our dedicated team works closely with educators to create meaningful awards that inspire achievement. We understand that each recognition moment matters, which is why schools across the nation trust us to deliver exceptional quality and personalized service for their recognition needs.

Order School Lapel Pins Today

Getting your custom school pins is made simple with our user-friendly online ordering system and expert support team. Order today or contact our knowledgeable staff for any assistance.

Frequently Asked Questions

Is there a minimum order quantity for school pins?

Yes, our minimum order is 10 lapel pins per design. This ensures cost-effective pricing while maintaining our high-quality standards.

Can I mix different lapel pin designs in the same order?

Yes, you can combine different styles, such as honor roll pins and attendance pins, in a single order. Many schools order a variety of lapel pins to recognize different achievements.

]]>
custom-pagemascotpins1"1-2 business days" "Columbia, SC"lapel pins292121-31 2 3 230.4150030.4Certificate Sourcelapel-award-pinsAcademic1:22%,50:28%,100:32%,500:36%Find School Mascot Pins at TrophyCentral. Mascot Pins Ship in Just 1-2 Business Days.Mascot11See our school medals and awards in a large number or styles and subjects. Each school medal below includes a neck ribbon.academic medals, school medals, scholastic medals, school medal, academic medal1

School Medals and Awards

TrophyCentral has an industry-leading selection of medals to meet all of your academic needs. If you are looking for a quality school medallion or medal, you have come to the right place! Medals are available in several sizes, starting from 1 1/4" in diameter for our inexpensive budget medals up to over 2". Depending on type, they may be available in a gold, silver or bronze finish, a color finish, or both. Each recognition school medal features a FREE NECK RIBBON - we have a huge selection to choose from, so you should be able to easily match your school colors! We also offer large quantity discounts.

Insert Medals - School Subjects

If you have a hard-to-find school subject, be sure to see our large selection of academic Inserts. Inserts are 2" discs that are available in a huge number of titles. Inserts can be used to create a unique medal, plaque or even a trophy and are available in gold / silver /bronze or full color! We have many generic inserts as well, for example, star performer and rising star. We also have a large selection of mascot medals and award ribbons.
]]>
custom-pageachievement-certificates-awards1"Download Only"free-academic4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our School Newspaper template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-School-Newspaper-Certificateschool-newspaper-freeSchool Newspaper, Academiccustom-pagetrophies-music1award-ribbons-printed"1-2 business days" "Topeka, Indiana" "UPS (Post Office Priority Mail may also be available)"ribbons465711-21 2618024.36Tower RibbonRibbons1:22%,50:45%Shop for school award ribbons at TrophyCentral.com. These fun school ribbons are available in several titles, including science, honor roll, reading, spelling and more!school ribbons, school award ribbons, fun school ribbons, spelling ribbons, honor roll ribbons, science ribbons, award ribbons, fun award ribbonsBirthday, Honor Roll, Music / Band / Chorus, Reading, Science, Super Speller, Student of the Month, Math, Academiccustom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these high-quality School Safety Patrol Inserts at TrophyCentral. Each School Safety Patrol Insert can be used to create a unique plaque, medal or trophy.51843206-30-2012Academic
custom-pageschool-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"Find these Safety Patrol pins discounted at TrophyCentral. Each School Safety Patrol pin features a quality clutch-back. Fast 1-2 day shipping.br30408-12-2010Safety Patrolcustom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsAcademic1:22%Buy these quality Mylar School Spirit Cheerleader Decal Inserts at TrophyCentral. Each decal can be used to create a unique plaque, medal or trophy.489824Cheerleading, Sports
custom-pagerooterpoms11"PC10=10-1411 2 3 4 5 6 7 8 9PepcoPromotional ProductsSpirit1Use this setup option for printing more than one color on your school spirit item. The setup charge is based on the number of colors and imprints required.1Spiritcustom-pagecl29100"1-3 business days" "Columbia, South Carolina" "UPS (FedEx available on request)"290631-31 2 3 230.45200020.45Certificate Source1:22%,200:27%,500:35%"Quick-Ship Items" "Award Certificates and Diploma Covers" "Award Certificates and Diploma Holders" "Award Certificates and Diploma Frames" "Award Certificate and Diploma Holders" "Certificate and Diploma Holders" "Certificates and Frames" "Certificates and Diploma Holders" "Diploma Covers and Certificates" "Diploma Covers and Award Certificates" "Diploma Covers, Frames and Holders" "Diploma Covers, Frames, Holders and Certificates"Find School Certificate Awards Discounted at TrophyCentral. Choose From A Large Variety of School Certificates.custom-pageacademic-lamp-general504015177855074214897814933115054915181564897335181634897204898294898284897795074855182085182344897784929514976465047915140525017315044214897905181804898865184824897005181624897895181865183014897555182044897485072314899015183994897464936415067214899055073935182185184325184105045015044814897574959014899034899044960905181614898124897115181724896675178065178255178055183884898971inserts11Find for academic inserts and school insert medals discounted at TrophyCentral. Each 2" inserts can be used in a medal frame, plaque or trophy.2" Academic Inserts The above inserts measure 2" in diameter and can be used to create your own medal, trophy or plaque. The inserts (discs) are perfect for recognizing an outstanding student or special teacher. TrophyCentral's top-rated customer service experts have been assisting customers since 1999! If you have any questions, please do not hesitate to call us at 1-888-809-8800.]]>custom-pageachievement-certificates-awards1"Download Only"free-academic4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our School Yearbook template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-School-Yearbook-Certificateschool-yearbook-freeSchool Yearbook, Academiccustom-pageschool-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:30%,100:35%,500:48%"School Pins"Find these fabulous Yearbook Pins discounted at TrophyCentral. Each School Yearbook Lapel Pin features a quality finish and clutch back. Fast 1-2 day shipping.hp2506-15-2024Yearbook, Academiccustom-pagemath-medalsscience-ribbonsbstick6science-award-plaquescience-plaque-i1trophies-academic1

Custom Science Trophies & Awards - Honor Every Experiment, Discovery, and Champion

Science trophies recognize the curiosity, critical thinking, and rigorous effort that define academic achievement in science at every level. From elementary classroom science fairs where young students present their first experiments, to middle school regional competitions where projects are judged on methodology and originality, from high school STEM olympiads and science bowl events where advanced students compete under pressure, to district and state competitions where the most exceptional research earns lasting recognition, quality science awards give tangible form to achievement that otherwise lives only in lab notebooks and project boards. Our versatile selection includes participation insert trophies and economy series awards ideal for recognizing every student who completed a project, single column and cup trophies for category first through third place finishers, champion's trophies for overall and grand champion honors, insert plaques suitable for permanent display in school science halls and trophy cases, medals in multiple finishes ideal for large fairs recognizing dozens of participants across multiple categories, and lapel pins providing affordable everyday recognition for classroom science achievement and STEM program milestones.

Frequently Asked Questions About Science Trophies

What science fair and STEM programs are these awards suitable for?

Our science trophies and awards are suitable for a wide range of programs including elementary, middle, and high school science fairs, science bowls, STEM olympiads, robotics competitions, engineering design challenges, and district and regional science competitions. Medals and lapel pins work especially well for classroom-wide recognition and large fairs where every participant deserves acknowledgment, while trophies and plaques suit category winners, grand champions, and special award recipients such as best research methodology, outstanding experimental design, and judge's choice honors.

What details should science trophy engraving include?

Essential elements include student name, award title, school or organization name, competition name, and year. For competitive fairs, adding the category, grade division, and place finish creates a more complete record of the achievement. Special awards gain clarity from descriptive titles like Outstanding Experimental Design or Best of Fair. For team projects, include all collaborators when space allows. Keep text concise and readable, prioritizing the most meaningful details when space on smaller awards requires choices.

Do you offer bulk discounts for science fairs and STEM programs?

Yes, Trophy Central offers significant bulk discounts on science trophies and medals that scale with order quantity, keeping award budgets manageable for fairs and programs of any size. Teachers ordering medals or pins for an entire classroom, fair coordinators purchasing awards across multiple grade divisions and categories, and districts buying awards for school-wide STEM recognition all benefit from bulk pricing. Browse our science medals and pins above for the most budget-friendly options when recognizing large groups.

If you need more information before deciding, see our expert resource section:
]]>
trophies
custom-pagescienceawards1trophies498551-310.452429Trophies1Find this popular Science trophy discounted at TrophyCentral. Features a real marble base, free engraving and fast shipping.science-cup-place-trophy-icustom-pagescience-medal-inserts20498552-40.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful Science 2" Epoxy-covered insert decal discounted at TrophyCentral. Fast 1-2 day shipping.Sciencecustom-pagescience-lapel-pinsplastic-pinbox-t5498551-30.550040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find our 3D Series gold science pin discounted at TrophyCentral. Fast 1-2 day shipping.5282024Sciencecustom-pagescienceawards1medals498552-30.525033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Science Atom 2 1/4" Antique Gold Medal Discounted at TrophyCentral. Each medal features a free ribbon. Fast shipping!Sciencecustom-pageachievement-certificates-awards1"Download Only"free-academic49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our science award certificate template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Science-Award-Certificatescience-freeSciencecustom-pageachievement-certificates-awards1"Download Only"free-academic49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"See this Science Certificate designed exclusively for TrophyCentral! Science Certificates can be downloaded for free! Each Science Certificate measures 11 x 8 1/2 inches.scienceSciencecustom-pagescience-medal-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects" "Science Awards"Buy these high-quality Science Award Inserts at TrophyCentral. Each Science Award Insert can be used to create a unique plaque, medal or trophy.518410Science
custom-pagebr584plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"Science Awards" "School Pins"Find this Science Subject Award Lapel Pin at TrophyCentral. Science Lapel Pins and other School Subject Pins Ship in Just 1-2 Business Days!br43204-08-2007Sciencecustom-pagescienceawards1"1-2 business days" "Topeka, Indiana" "UPS (Post Office Priority Mail may also be available)"465711-21 260.3620030.36Tower RibbonRibbons11:22%,50:46%Find science ribbons discounted at Trophy Central. Choose from 1st - 6th place, participant and more!Sciencecustom-pagescienceawards1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Science Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Sciencecustom-pageawardcertificates11certificates290631-31 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,25:24%,100:40%,500:50%Find this science certificate award discounted at TrophyCentral. Each science award is beautifully printed and measures 8 1/2 x 11.science-award-certificates02-01-2008Sciencecustom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceCertificates / CoversEmbosser Seals1:22%,3:28%,5:31%Find these Science Certificate Seals discounted at TrophyCentral. Embossed science seals are easy to apply with a pressure-sensitive backing.803sciSciencecustom-pagescienceawards70267029906803sci1awardcertificates11Find science certificates and science fair certificates discounted at TrophyCentral. Each certificate measures 8 1/2" x 11" and is beautifully printed.Shop with Ease at TrophyCentral TrophyCentral has a wonderful selection of high quality products, discounted prices and top-rated customer service. We have been helping customers since 1999 and we would be happy to help you, too!

Frequently Asked Questions (FAQ)

What types of science award certificates do you offer?

We offer a wide range of **science award certificates**, including those for **science fairs, STEM achievements, classroom excellence, and innovation awards**. Our certificates come in different designs and can be customized for students, schools, and competitions.

Can I personalize my science certificates?

Yes! You can add a school name, student name, date and more.

Do you offer printable science award certificates?

Yes! We offer **both printed and digital** science award certificates. Digital certificates allow you to print awards on-demand, perfect for last-minute recognition.

How quickly can I receive my science award certificates?

Most of our **science award certificates ship within 1-2 business days**. If you need them sooner, we offer rush processing and expedited shipping options at checkout.

Do you offer bulk discounts for schools and science competitions?

Yes! We offer **discounts on bulk orders** for schools, science fairs, and competitions. The more you order, the more you save. Contact us for a **custom quote on large orders**.

Do you have other science-related awards?

Absolutely! In addition to science certificates, we offer **science medals, trophies, and plaques** for students and competitions. Check out our full selection on our Science Awards page.

]]>
scienceawards trophies
custom-pagescienceawards1498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Science insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-Science-InsertSciencecustom-pagescienceawards1498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Science single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - ScienceSciencecustom-pagescienceawards1498551-311821.06TrophyCentraltrophies1Sciencecustom-pagescience-medal-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects" "Science Awards"Buy these quality Science Einstein Inserts (Litho) at TrophyCentral. Each Science Einstein Insert can be used to create a unique plaque, medal or trophy.504501Science
custom-pageachievement-certificates-awards1"Download Only"free-academic49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates" "Science Awards"See this Science Fair Certificate designed exclusively for TrophyCentral! Science Fair Certificates can be downloaded for free!sciencefairScience11Discover inspiring science fair award ideas! From budding researchers to STEM champions, find creative trophies and recognition that celebrates scientific curiosity and innovation across all grade levels.custom-pagescienceawards11Creative science fair award ideas with engraving examples for competitions and STEM programs. From Mad Scientist to Future Nobel Prize Winner, discover 15+ unique ways to recognize young scientists with actual trophy wording templates.custom-pagescience-medal-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects" "Science Awards"Buy these quality Science Fair Inserts (Litho) at TrophyCentral. Each Science Fair Insert can be used to create a unique plaque, medal or trophy.504481Science
custom-pagescienceawards102-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.5115014Classic Medallicsaward-medalsAcademic1:22%,25:24%,50:30%,100:36%,500:42%"School Medals" "School Award Medals" "Scholastic Medals" "Scholastic Award Medals" "Academic Medals" "Academic Award Medals" "Medals, School" "Science Awards" "Science Medals"Your students will love these colorful Mylar Science Fair Medals from TrophyCentral. Each Science Fair medal includes a neck ribbon!tm9757Science
custom-pagescience-medal-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsAcademic1:22%"Science Medals" "Award Medals" "School Medals" "Award Medals - All Subjects" "Science Awards"Buy these quality Mylar Science Fair Decal Inserts at TrophyCentral. Each decal can be used to create a unique plaque, medal or trophy.489757Science
custom-pagescience-award-certificates15"1-3 business days" "Columbia, South Carolina; Marquette, Michigan" "UPS (FedEx and Post Office Priority Mail may be available on request)"certificates290631-21 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,50:38%,100:42%"Science Awards"Find these Science Fair Participation certificates discounted at TrophyCentral. Each Science Fair Participation certificate measures 8 1/2 x 11 inches and typically ships in 1-2 days.702611-16-2006Sciencecustom-pagebr584plasticpinboxvelapinbox10br584 ap78 br432 hp18 e9005"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:34%,100:39%,500:43%"Science Awards" "School Pins"Find this Science Fair Award Pin at TrophyCentral. Science Fair Award and other pins ship in just 1-2 business days!br584Science11Most science fair programs only recognize first place. Build an award structure that celebrates every participant, strengthens school science culture, and gives students a reason to return next year.custom-pagescience-medal-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects" "Science Awards"Buy these quality Science GENERAL Inserts (Litho) at TrophyCentral. Each 2" insert can be used to create a unique plaque, medal or trophy.495901Science
custom-pagescienceawards1498551-310.71217.38trophies1Sciencecustom-pagescienceawards1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Science Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Sciencecustom-pagescienceawards1medals498552-30.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Colorful Science insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Sciencecustom-pagescienceawards1medals498552-40.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Science insert medal With A Personalized Front Rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Sciencecustom-pagecherry-insert-plaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these science insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Sciencecustom-pagesciencemedalsscience-ei48975749590150448150450151841011Find science medal inserts discounted at TrophyCentral. Each 2" science insert can be used to make medals, trophies and plaques.science-mcscience-mc-prscience-mge9901e9005tm9757ir22science-jigfscience-jibfscience-jisf11Find a great selection of Science Medals at TrophyCentral. Each Science Medal includes a neck ribbon. Science trophies include personalization. Fast 1-2 shipping!science medals,science trophies, science fair medals, science trophies and medals

Science Medals & STEM Awards - Celebrate Scientific Discovery

Science medals honor student curiosity and achievement across biology, chemistry, physics, earth science, engineering, and STEM competitions celebrating young innovators exploring scientific principles. As meaningful recognition for intellectual dedication, quality science fair medals provide affordable, wearable awards that participants treasure as keepsakes commemorating their research journey. These budget-friendly medals feature scientific imagery including microscopes, atoms, DNA helixes, and laboratory equipment, durable metal construction in gold, silver, and bronze finishes, free neck ribbons in school or competition colors, and complimentary back engraving for student names, project titles, placement, and event dates. Available in economical 1.25-inch participation sizes ideal for large-scale fairs to impressive 2.75-inch premium designs for grand champions, science medals accommodate programs from elementary classroom experiments to national STEM championships. Perfect for recognizing science fair participants, category winners, research excellence, innovation awards, or engineering design achievements, these medals inspire continued exploration while making recognition accessible for schools managing hundreds of young scientists annually.

Expand your recognition program: Explore Science Trophies and Explore Academic Medals for comprehensive STEM recognition options. Learn more: Science Fair History and Educational Impact.

Frequently Asked Questions About Science Medals

What medal sizes work best for different science fair levels?

For elementary classroom experiments and large school-wide fairs, 1.25-inch economy medals provide maximum affordability while delivering tangible recognition that young scientists proudly wear home. Middle school regional fairs and STEM competitions benefit from 2-inch insert medals featuring detailed scientific designs and customizable ribbons, balancing visual impact with budget management when recognizing dozens of category placements. High school championship events, state science olympiads, and prestigious competitions deserve 2.5-inch to 2.75-inch premium medals with substantial weight and elegant presentation worthy of months-long research investments. Many organizers use medal hierarchies with gold for first place, silver for second, and bronze for third within each category, while reserving larger premium medals for overall grand champions and special innovation awards.

What information should science fair medal engraving include?

Essential engraving elements include student name, specific category or placement, competition name, and event date. Examples: Emma Chen, First Place Biology, District Science Fair 2025 or Marcus Williams, Engineering Innovation Award, STEM Championship April 2025. Project-focused fairs benefit from abbreviated project titles like Solar Cell Efficiency or Water Filtration Design. Category-specific medals gain clarity through discipline identification such as Chemistry Excellence or Physics Research. Team projects should acknowledge all participants like Chen & Martinez Team. Special recognition medals become more meaningful with descriptive titles including Best Experimental Design, Outstanding Research Methodology, or Judge's Choice Innovation Award.

When should science fairs use medals versus trophies for student recognition?

Science medals excel for immediate ceremony presentations where students wear recognition home, multi-tiered category systems acknowledging numerous placements across diverse disciplines, traveling regional competitions requiring portable awards, and budget-conscious programs where affordability enables recognizing every participant plus multiple winners per category. Their wearable nature creates visible pride as students showcase medals immediately following judging. Science trophies better suit overall grand champion recognition, perpetual awards displayed permanently in school trophy cases, and small elite competitions where substantial display pieces reflect months of intensive research. Successful programs often combine both by presenting medals for all category placements and participant recognition, while reserving impressive trophies exclusively for overall grand champions, best of fair, and distinguished research excellence.


If you need more information before deciding, see our expert resource section: ]]>
scienceawards science-award-certificates
custom-pagescienceawards1498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our science insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - ScienceSciencecustom-pagereadingpinsbr584br432ap78hp183d-science1school-pins1Find science pins discounted at TrophyCentral. Each high quality science pin features a clutch back for easy attachment to clothing. Shop with Ease at TrophyCentral Science lapel pins are an excellent and inexpensive way to recognize your top students. Whether you need a pin for students that excel in science or who participated in a science fair, we have a fabulous selection in a variety of styles and finishes. Our pins typically ship in a fast 1-2 days. We also offer excellent customer service. Our experts in New York and Michigan have been providing suggestions and guidance since 1999. They would be thrilled to help you, too!

Frequently Asked Questions (FAQ)

🔬 What types of science pins do you offer?

We offer a variety of science lapel pins featuring designs like atoms, microscopes, DNA strands, and chemistry symbols. These pins are great for recognizing students, teachers, and science fair participants.

🏆 Who can wear science lapel pins?

Our science award pins are perfect for students excelling in STEM subjects, teachers inspiring future scientists, and professionals in scientific fields. They are also great for science clubs and academic competitions.

🧪 Can I customize my science pins?

Some of our science lapel pins can be customized with engraving or color choices. If you need a custom design for a school or organization, contact us for details on bulk orders and personalization.

📦 Do you offer bulk discounts for science club orders?

Yes! We offer discounts on bulk orders for schools, science fairs, and academic organizations. Contact us for special pricing on large orders of science award pins.

🚚 How fast can I receive my science pins?

Most science lapel pins ship within 1-2 business days. If you need them quickly, choose expedited shipping at checkout to ensure timely delivery for your event or ceremony.

]]>
scienceawards science-lapel-pins
custom-pagescienceawards1plaques498554-Feb1JDSPlaques1Find this science plaque discounted at TrophyCentral. Our science plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Sciencecustom-pagescienceawards1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Science Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Sciencecustom-pagegeneral-corporate-awards1606307-101 3 234222RS Owens1Find this beautiful and unique art glass sculpture award with free engraving at TrophyCentral. Choose from three popular colors.custom-pageschool-pinsplasticpinboxvelapinbox20"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,500:37%"School Pins" "School Lapel Pins"Find these scroll pins discounted at TrophyCentral. Each gold scroll pin features a clutch-back for easy and safe attachment to clothing.br134Academic, Leadershipcustom-pageplaques11"4-6 business days with engraving" "Mt. Vernon, NY" "UPS (FedEx available on request)"plaques105503-610.451813.25Classic MedallicsPlaquesBlank Plaques1:22%Find this scroll plaque discounted at TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.Blank, Generalcustom-pagestar-trophies1"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"trophies458221510.45416.45Vision AwardsTrophies1:22%,51:34%Find the Sculpted Star Award discounted at TrophyCentral. Jade crystal is carved and sculpted depicting a shooting star as it emerges from a green marble base.custom-pagemedallion-inserts-government-agencies-and-logos12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%"Award Medals" "Award Medals - All Subjects" "Medals - All Others"Buy these high-quality Seal Of The United States Inserts at TrophyCentral. Each Seal Of The United States Insert can be used to create a unique plaque, medal or trophy.515524General
custom-page12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
498555-8.521
custom-page11Our search results may be filtered by price, brand, reviews, processing time and more. Check out TrophyCentral's industry-leading selection of awards and personalized gifts!1custom-pagemedallion-inserts-general-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these high-quality Second Place Inserts at TrophyCentral. Each Second Place Insert can be used to create a unique plaque, medal or trophy.5134511st / 2nd / 3rd / Etc., Sports
custom-pagemedals-ir-series12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
"PT1=Medals" "PC11=105503-60.7530036.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,10:27%,100:36%"School Medals" "School Awards"These 1 1/2 Inch Second Place Medals come in gold, silver and bronze finishes and are perfect for recognizing different place winners.ir28Return to our:section.award-medals02-01-2017General, Torch, Achievement, 1st / 2nd / 3rd Place
custom-page1st-place-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.751 2 3 4 5 6 7 8 9130042.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%Shop for Second Place Torch Medals at TrophyCentral. Fast 1-2 Day Shipping!tm9916sReturn to oursection.place-medalsSports, Academic, General, Torch, Achievement, 1st / 2nd / 3rd / Etc.
custom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceCertificates / CoversEmbosser Seals1:22%,3:28%,5:31%Find these Second Semester Embossed Certificate Seals discounted at TrophyCentral.803ssGeneralcustom-pageenclosed-bulletin-boards1Bulletin Boards4512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Sentry Enclosed Letter Boards with Satin or Bronze Aluminum Frame and Gothic Letter Set, 36"H x 30"W discounted at TrophyCentral.Enclosed - 1 Door, Indoor111custom-pageservicepins11plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"105502-30.31150030.3Classic Medallicslapel-award-pins1:30%,100:45%Find Service Anniversary Award Pins with a torch design discounted at TrophyCentral. Available in 5 year increments. Each Service Anniversary Pin features a clutch-pin back.custom-pageplaques1plaques498552-41JDSPlaques1Find this Service Plaque discounted at TrophyCentral. Our service plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Servicecustom-pageappreciation-templates1"Download Only"free-appreciation4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Service Award template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Service-Award-Certificateservice-award-freeSciencecustom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these high-quality Service Award Inserts at TrophyCentral. Each Service Award Insert can be used to create a unique plaque, medal or trophy.51779802-28-2015Service / Retirement
custom-pagecorporatepins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsBusiness1:30%,50:32%,100:35%,500:39%Find this Crystal Rhinestone Service Pin at TrophyCentral. Crystal Rhinestone Service and other pins ship in just 1-2 business days!seisourpa07-21-2011Businesscustom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsGeneral1:22%Buy these high-quality Service Is Our Passion Inserts at TrophyCentral. Each Service Is Our Passion Insert can be used to create a unique plaque, medal or trophy.518534General, Business
custom-pageschool-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:28%,100:32%,500:42%"School Pins" "School Lapel Pins"Find these popular Service AP Series Lapel Pins discounted at TrophyCentral. Fast 1-2 day shipping!ap118Service / Retirement11"PC10=10-1411 2 3 4 5 6 7 8 9Saratoga PenSetupSetup1Setup (Required For Any New Pen Imprinting) from TrophyCentral.11110-1411 2 3 4 5 6 7 8 9Saratoga PenSetupSetup1Imprinting Setup Charge for Awards and Plaques1custom-pagebaseballdisplay11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231112Perfect CaseDisplay Cases11:14%,5:15%Seven Baseball Glass Display Case. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.basedisplay-7Baseball / T-Ball, Sportscustom-pagebest-moment-captured11Submit your photo to the TrophyCentral Best Moment Captured contest. One image, any subject. The community votes, a panel of judges scores, and the winner receives a real engraved trophy. Round One submissions close March 18.1custom-pagestandout-awards111custom-pagenew-trophies-21trophies498551-310.452429Trophies1Find this popular Sheep trophy discounted at TrophyCentral. Features a real marble base, free engraving and fast shipping.sheep-cup-place-trophy-tccustom-pagequickshiptrophies-sheep1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Fabulous Sheep Figure Place Trophy with 1st, 2nd or 3rd Place Trim, Marble Base and Free Engraving. Ships in a fast 1-2 days!qtsheepplcustom-pagequickshiptrophies-sheep1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%This popular Sheep Figure Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!qtsheepyrcustom-pagequickshiptrophies-sheep1trophies498852-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with sheep figure discounted at TrophyCentral. Includes free text engraving!cup-sheep-pcustom-pagequickshiptrophies-sheep1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these sheep budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtsheepscbcustom-pagequickshiptrophies-sheep1498852-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Find this budget sheep award trophy discounted at Trophy Central. Features a real marble base and plastic sheep figure. Engraving is free. Fast 1-2 day shipping.quickshiptrophies-sheepcustom-pagequickshiptrophies-sheep1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:26%Find these fabulous two-tier Sheep Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtsheepttcustom-pagequickshiptrophies-sheep1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:28%Find this awesome Sheep Figure two-tier championship trophy discounted, and with free engraving, at TrophyCentral!qtsheepttwcustom-pagequickshiptrophies-sheep1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:21%,100:24%This popular Sheep Figure Single Column Trophy features a choice of column size and color, a marble base and free trophy engraving!qtsheepsccustom-pagequickshiptrophies-sheep1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.05Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%Find These Popular Sheep Figure Deluxe Platform Series Trophies Discounted at TrophyCentral. Real Marble Base. Free Personalization!custom-pagequickshiptrophies-sheepqtsheepncqtsheepscqtsheepplqtsheepyrqtsheepttqtsheepttwqtsheep3cqtsheepdmmqtsheepscbcup-sheep-scbcup-sheep-pbdg-sheep11Find Sheep Trophies discounted at TrophyCentral. Each Sheep Trophy includes free engraving. Fast 1-2 day shipping.

Shop With Confidence at TrophyCentral

We offer a huge selection, discounted prices and great customer service. Do you need help with some ideas or with ordering? Yes, we sell online, but we have real people who would love to help you! Feel free to call our customer service experts in Michigan, New York and online. TrophyCentral - delivering smiles since 1999!


]]>
quickshiptrophies-bull quickshiptrophies-chicken quickshiptrophies-tractor
custom-pagequickshiptrophies-sheep1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Sheep figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-sheep-scbcustom-pagequickshiptrophies-sheep1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.4226Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:18%,10:23%Find these fabulous Sheep Figure Champions Line 3-Column Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qtsheep3ccustom-pagequickshiptrophies-sheep1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:27%,100:32%Our popular Sheep Figure Participation Trophies feature a real slant-front marble base and free personalization. Significant quantity discounts available.qtsheepnccustom-pagequickshiptrophies-fireman11plaques105503-610.4512032.45Classic MedallicsPlaquesBlank Plaques1:22%Buy Shield Plaques and other Police and Hero Awards at TrophyCentral.Firefightercustom-pagestar-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:34%,100:39%,500:43%"Star Pins" "Star Lapel Pins" "Star Award Pins"Find this Shining Star - 1 Inch Gold Pin (BR Series) Discounted at TrophyCentral. Fast 1-2 Day Shipping.br557Starcustom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsGeneral1:22%Buy these high-quality Shining Star Inserts at TrophyCentral. Each Shining Star Insert can be used to create a unique plaque, medal or trophy.518671General, Star
custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsGeneral1:22%Buy these quality Mylar Shining Star Decal Inserts at TrophyCentral. Each Shining Star Decal can be used to create a unique plaque, medal or trophy.489875Star
noindexed-items11ShipPinsg Countdown from TrophyCentral. Discounted Trophies, Awards and Promotional Products.1custom-page11TrophyCentral's shipping information page. Here find information about ship times, carriers and more.custom-pageflaglapelpinsplasticpinboxvelapinbox1"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsMilitary1:30%,50:34%,100:39%,500:43%Find this shooting star American Flag lapel pin discounted at TrophyCentral. Pin features a clutch back. Shops in just 1 day!Shooting Star PinStarnoindexed-items10.31TrophyCentral Offers A Huge Selection At Discounted Prices And Top-Rated Customer Service. Shop With Confidence At TrophyCentral!1custom-pagegavelplaques12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
plaques105503-610.451828.45ClassicPlaquesKey Plaques1:22%This shovel plaque is a perfect gift for ground breaking and building ceremonies. Each shovel plaque includes free engraving!shovel plaqueShovel
show-multis11custom-pagemedallion-inserts-fraternal-organizational-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "Clubs, Organizations, Charities"Buy these quality Shriner Inserts (Litho) at TrophyCentral. Each Shriner Insert can be used to create a unique plaque, medal or trophy.491510
custom-pagebottles-st72"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14142013.6Glass AmericaPromotional ProductsSports / Water Bottles1:14%,576:40%Find These Black Stainless Steel Sidekick Water Bottles Discounted at TrophyCentral. Price Includes Color Imprint!23077Sports / Water Bottlescustom-pagebottles-st72"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14142013.6Glass AmericaPromotional ProductsSports / Water Bottles1:14%,576:40%Stainless Steel Sidekick Bottle - Blue from TrophyCentral.23084Sports / Water Bottlescustom-pagebottles-st72"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14142013.6Glass AmericaPromotional ProductsSports / Water Bottles1:14%,576:40%Stainless Steel Sidekick Bottle - Orange from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.23085Sports / Water Bottlescustom-pagebottles-st72"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14142013.6Glass AmericaPromotional ProductsSports / Water Bottles1:14%,576:40%Stainless Steel Sidekick Bottle - Purple from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.23032Sports / Water Bottlescustom-pagebottles-st72"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14142013.6Glass AmericaPromotional ProductsSports / Water Bottles1:14%,576:40%Stainless Steel Sidekick Bottle - Lime from TrophyCentral.23088Sports / Water Bottlescustom-pagecrystalgifts6"7-10 business days" "Kentucky" "UPS (FedEx available on request)"personalized gifts410187-1010.4569.45JcharlesGiftsCrystal Gifts1:22%,100:22%"personalized gifts"This Optic crystal paperweight represents quality and value. At 3/4 inches thick, this crystal clear gem is a gift of distinction. Pleasingly gift boxed.Crystal Giftscustom-pageindoor-enclosed-bulletin-boards14512310-171 3 5 6 7 8 9 10 22 2301Bulletin Boards11Find the Ghent Silhouette 1 Door Enclosed Chocolate Cork Bulletin Board with Black Frame, 4'H x 2'W discounted at TrophyCentral.silh20494Enclosed - 1 Door, Indoorcustom-pageindoor-enclosed-bulletin-boards1Bulletin Boards4512310-171 3 5 6 7 8 9 10 22 2301Bulletin Boards11Find the Ghent Silhouette 1 Door Enclosed Chocolate Cork Bulletin Board with Satin Frame, 4'H x 2'W discounted at TrophyCentral.silh20494Enclosed - 1 Door, Indoorcustom-pageindoor-enclosed-bulletin-boards14512310-171 3 5 6 7 8 9 10 22 2301Bulletin Boards11Find the Ghent Silhouette 1 Door Enclosed Vinyl Bulletin Board with Black Frame, 4'H x 2'W, Caramel discounted at TrophyCentral.silh20476Enclosed - 1 Door, Indoorcustom-pageindoor-enclosed-bulletin-boards14512310-171 3 5 6 7 8 9 10 22 2301Bulletin Boards11Find the Ghent Silhouette 1 Door Enclosed Vinyl Bulletin Board with Black Frame, 4'H x 2'W, Ebony discounted at TrophyCentral.silh20476Enclosed - 1 Door, Indoorcustom-pageindoor-enclosed-bulletin-boards14512310-171 3 5 6 7 8 9 10 22 2301Bulletin Boards11Find the Ghent Silhouette 1 Door Enclosed Vinyl Bulletin Board with Black Frame, 4'H x 2'W, Ivory discounted at TrophyCentral.silh20476Enclosed - 1 Door, Indoorcustom-pageindoor-enclosed-bulletin-boards14512310-171 3 5 6 7 8 9 10 22 2301Bulletin Boards11Find the Ghent Silhouette 1 Door Enclosed Vinyl Bulletin Board with Black Frame, 4'H x 2'W, Navy discounted at TrophyCentral.silh20476Enclosed - 1 Door, Indoorcustom-pageindoor-enclosed-bulletin-boards14512310-171 3 5 6 7 8 9 10 22 2301Bulletin Boards11Find the Ghent Silhouette 1 Door Enclosed Vinyl Bulletin Board with Black Frame, 4'H x 2'W, Ocean discounted at TrophyCentral.silh20476Enclosed - 1 Door, Indoorcustom-pageindoor-enclosed-bulletin-boards1Bulletin Boards4512310-171 3 5 6 7 8 9 10 22 2301Bulletin Boards11Find the Ghent Silhouette 1 Door Enclosed Vinyl Bulletin Board with Black Frame, 4'H x 2'W, Silver discounted at TrophyCentral.silh20476Enclosed - 1 Door, Indoorcustom-pageindoor-enclosed-bulletin-boards14512310-171 3 5 6 7 8 9 10 22 2301Bulletin Boards11Find the Ghent Silhouette 1 Door Enclosed Vinyl Bulletin Board with Black Frame, 4'H x 2'W, Stone discounted at TrophyCentral.silh20476Enclosed - 1 Door, Indoorcustom-pageindoor-enclosed-bulletin-boards14512310-171 3 5 6 7 8 9 10 22 2301Bulletin Boards11Find the Ghent Silhouette 1 Door Enclosed Vinyl Bulletin Board with Satin Frame, 4'H x 2'W, Caramel discounted at TrophyCentral.silh20476Enclosed - 1 Door, Indoorcustom-pageindoor-enclosed-bulletin-boards14512310-171 3 5 6 7 8 9 10 22 2301Bulletin Boards11Find the Ghent Silhouette 1 Door Enclosed Vinyl Bulletin Board with Satin Frame, 4'H x 2'W, Ebony discounted at TrophyCentral.silh20476Enclosed - 1 Door, Indoorcustom-pageindoor-enclosed-bulletin-boards14512310-171 3 5 6 7 8 9 10 22 2301Bulletin Boards11Find the Ghent Silhouette 1 Door Enclosed Vinyl Bulletin Board with Satin Frame, 4'H x 2'W, Ivory discounted at TrophyCentral.silh20476Enclosed - 1 Door, Indoorcustom-pageindoor-enclosed-bulletin-boards14512310-171 3 5 6 7 8 9 10 22 2301Bulletin Boards11Find the Ghent Silhouette 1 Door Enclosed Vinyl Bulletin Board with Satin Frame, 4'H x 2'W, Navy discounted at TrophyCentral.silh20476Enclosed - 1 Door, Indoorcustom-pageindoor-enclosed-bulletin-boards14512310-171 3 5 6 7 8 9 10 22 2301Bulletin Boards11Find the Ghent Silhouette 1 Door Enclosed Vinyl Bulletin Board with Satin Frame, 4'H x 2'W, Ocean discounted at TrophyCentral.silh20476Enclosed - 1 Door, Indoorcustom-pageindoor-enclosed-bulletin-boards14512310-171 3 5 6 7 8 9 10 22 2301Bulletin Boards11Find the Ghent Silhouette 1 Door Enclosed Vinyl Bulletin Board with Satin Frame, 4'H x 2'W, Silver discounted at TrophyCentral.silh20476Enclosed - 1 Door, Indoorcustom-pageindoor-enclosed-bulletin-boards14512310-171 3 5 6 7 8 9 10 22 2301Bulletin Boards11Find the Ghent Silhouette 1 Door Enclosed Vinyl Bulletin Board with Satin Frame, 4'H x 2'W, Stone discounted at TrophyCentral.silh20476Enclosed - 1 Door, Indoorcustom-pagepickleball-trophiestr7220wincooltrop1silplatsteeltr7219tr7218trsaawcu1silvertraynoname271cup-trophies-large-and-small1Elegant Designs & Premium Craftsmanship

Each silver cup in our collection showcases meticulous craftsmanship and superior quality that stand the test of time. Our range includes classic perpetual trophy cup styles, sophisticated championship trays, and distinctive wine cooler designs that suit any recognition ceremony.

Every piece is constructed with durable materials and finished to create a lasting impression that recipients will treasure for years to come. These premium trophy cup designs make ideal awards for golf tournaments, corporate milestones, employee recognition programs, and championship celebrations.

Customization & Engraving Options

Transform your silver cup trophy into a personalized masterpiece with our complimentary engraving services included with every purchase. Our skilled craftsmen can add names, dates, achievement types, and custom messages to create meaningful awards that tell your unique story.

All engraving details are handled with precision, ensuring crisp, professional results that enhance the overall presentation of your recognition piece.

Why Choose Trophy Central?

With decades of experience in creating memorable awards, Trophy Central combines competitive pricing with exceptional quality and outstanding customer service.

We offer free engraving on every cup trophy, fast turnaround times, and expert guidance to help you select the perfect piece for your event. Our commitment to excellence ensures that every trophy cup meets the highest standards and exceeds your expectations.

Order Your Silver Cup Trophy Today

Browse our extensive collection of silver cup trophies and discover the perfect piece to commemorate your special achievement or event. Our user-friendly ordering process makes it easy to customize your selection and complete your purchase with confidence.

Start creating lasting memories with a premium silver cup that truly reflects the significance of the moment being celebrated.

Frequently Asked Questions

Is engraving included with every silver cup trophy purchase?

Yes, engraving is included free of charge with every trophy cup order, allowing you to add names, dates, and custom messages at no extra cost. However, certain advanced personalization options such as logo reproduction may incur additional charges. Please check individual product descriptions for specific pricing information.

Can I add my company logo to trophy cups and awards?

Yes, customers can add custom logos to most trophy cup styles. Our engraving team can reproduce your company or organization logo on trophies at an affordable price. Contact us for pricing and logo artwork requirements. These personalized awards create impressive display pieces that showcase your brand.

Do you offer bulk pricing for multiple trophy orders?

Yes, we provide volume discounts and competitive pricing for bulk orders of trophy cups and awards, making it cost-effective to recognize multiple winners or participants. Many customers order multiple trophies at reduced prices for tournaments, corporate recognition programs, and team awards.

What materials are used in your trophy cup collection?

Our trophy cups and awards are crafted from high-quality materials including silver-plated metal, pewter, and polished aluminum. Each piece features a sturdy base and quality construction designed to maintain its appearance for years. Material specifications are available on individual product pages.
]]>
champion-perpetual-trophies crystalcups
custom-pageglass-crystal-awards1"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"458221510.45629.25Vision AwardsTrophies1:22%,26:33%The Silver Mountain Award combines metal, stone and glass in this spectacular freestanding award honoring those who have made the long, hard climb to reach their goals.custom-pageflstpi3siandplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsGeneral1:30%,50:34%,100:38%"Star Pins" "Star Lapel Pins" "Star Award Pins"Find silver star pins discounted at TrophyCentral. Each silver star pin features a smooth finish, a clutch back and measures 1 inch. Ships in just 1-2 days.br298sStar, Generalcustom-pageflstpi3siandplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsGeneral1:30%,50:34%,100:38%"Star Pins" "Star Lapel Pins" "Star Award Pins"Find these silver star pins discounted at TrophyCentral. Each silver star pin features a smooth finish, a clutch back and measures 3/4 inch. Ships in just 1-2 days.br464sStar, Generalcustom-pagesilver-cup-trophies1trophies105503-6121626Classic Medallics1:22%custom-pagechampion-perpetual-trophies1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"perpetual trophies105503-610.451 2 3 4 5 6 7 8 9110.85Classic MedallicsTrophies1:30%"Minuteman"Shop for Silver Revere Bowl Perpetual Trophies from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.See more greatcup-trophies-large-and-small09-03-2012Cupcustom-pagehigh-end-awards11"7-10 business days w/engraving" "Kentucky" "UPS (FedEx available on request)"general410187-1010.45417.25JcharlesGeneral Awards1:22%,25:25%"Corporate Awards"Silver Ribbon Jade from TrophyCentral. Also see our great selection of engraved and personalized gifts!custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsGeneral1:22%Buy these high-quality Silver Star Award Inserts at TrophyCentral. Each Silver Star Award Insert can be used to create a unique plaque, medal or trophy.518593General, Star
custom-pagegold-starsplastic-pinbox-t10star-pinslapel pins498552-30.3102300031TClapel-award-pins11:22%,100:38%,250:42%,500:52%,1000:59%Find These Silver Stars Discounted At TrophyCentral! Each Silver Star Includes A Clutch-Back For Easy Attachment to Clothing. Large Quantity Discounts.Silver Stars | Silver Star Pins|TrophyCentralSilver Stars | TrophyCentralSee our entiresection for other styles and finishes.star-pinsStarcustom-pagestars-wreathplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsGeneral1:30%,50:34%,100:38%"Star Pins" "Star Lapel Pins" "Star Award Pins"Find these silver stars with a wreath design discounted at TrophyCentral! Each silver star and wreath measures 7/8".br476s02-15-2014Star, Generalcustom-page3-4-stars-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsGeneral1:22%,50:25%,100:29%,500:32%"Star Pins" "Star Lapel Pins" "Star Award Pins"Find this Silver Stars - 3/4 Inch Pin at TrophyCentral. Silver Stars - 3/4 Inch and other pins ship in just 1-2 business days!br199sStar, Generalcustom-page1st-place-medals11-2 business days
With engraving:
1-3 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals498552-30.371 3 4 5 6 7 8 930042.37Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,25:24%Find these silver torch medals discounted at Trophy Central. Optional engraving. Fast 1-2 day shipping.Torch, 1st / 2nd / 3rd / Etc.
custom-pagechampion-perpetual-trophies1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.451 2 3 4 5 6 7 8 9110.85Classic MedallicsTrophies1:30%"Minuteman"Shop for Silver Wine Cooler Perpetual Trophies from TrophyCentral. Fast Shipping on Wine Cooler Trophies.Return to thecategory for additional styles and sizes.champion-perpetual-trophies06-20-2011Cupcustom-pagesilver-cup-trophies11trophies105503-6121222.8Classic Medallicstrophies1:22%1:20%1:20%Find this steal bowl championship trophy discounted at TrophyCentral. Features silver-plating and includes free engraving!Generalcustom-pagesilver-cup-trophies11trophies105503-610.61410.6Classic Medallics1:22%Cupcustom-pageclocks1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"410187-1010.45654.45JcharlesCrystal Awards1:22%,25:25%"crystal awards" "sales awards" "service awards" "corporate sales awards" "corporate service awards" "sales award" "service award" "corporate sales award" "corporate service award" "Desk Clocks"Silvertone Clock from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.custom-pagetrophies-cornhole1trophies498552-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1This popular cornhole award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.Single Column Trophy - CornholeCornholecustom-pagetrophies-chess1trophies498552-312421.33TrophiesSchool1This popular chess award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.mqt-chess-p-scChesscustom-pagetrophies-dance1trophies498552-312421.33TrophiesMusic, Drama, Art, Dance1This popular Dance Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.mqt-dancer-scDancecustom-pagetrophies-drama1trophies498552-312421.33TrophiesSchool1This popular drama award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.mqt-drama-p-scDramacustom-pagegeneral-corporate-awards1498552-312421.33TrophiesCorporate1This popular corporate leadership award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.mqt-leadership-p-scCoach, Leadership, Sportscustom-pagestar-trophies1trophies498552-312421.33TrophiesMusic, Drama, Art, Dance1This popular Star Performer Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.mqt-star-p-scDrama, Dance, Schoolcustom-pagetrophies-coach1trophies498552-312421.33TrophiesSchool1This popular coach / judge / referee award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.mqt-whistle-p-scCoach, Whistle, Sportscustom-pagehockeypuckdisplays1"7-10 business days w/Logo, 4-6 without" "Apopka, FL 32712" "UPS (FedEx available on request)"327765-101 3 22 2311619Perfect CaseDisplay Cases1:14%,10:21%Single Hockey Puck Glass Display Cases from TrophyCentral.hockeydisplay-sHockey, Sportscustom-pageaward-ribbons-printed10"1-2 business days" "Topeka, Indiana" "UPS (Post Office Priority Mail may also be available)"ribbons465711-21 260.363636.36Tower RibbonRibbons1:22%,100:26%Shop for single streamer rosette award ribbons, both stock and custom, in a variety of colors at TrophyCentral. Fast Shipping on all awards and rosettes.rosette ribbons, award ribbons, rosettes, rosette award ribbons, ribbons and rosettes, rosette ribbon, ribbons and medals, awardsBlue Ribbon, Red Ribbon, Exhibitor, 1st / 2nd / 3rd / Etc., 4th Place, 5th Place, 6th Place, 7th Place, 8th Place, 9th Place, 10th Place, Honorable Mention, Participant, Achievement, Assistant, Chairman, Board Member, Best of Show, Chairperson, Co-Chairman, Co-Chairperson, Committee, Contestant, Director, Excellent, Exhibitor, Facilitator, Finalist, Grand Price, Good, Grand Champion, Hostess, Hospitality, Guest, Speaker, Host, Judge, Participation, Past President, Perfect Attendance, Official, Presenter, President, Press, Reserve Champion, Secretary, Treasurer, Staff, Steward, Sponsor, Usher, Vice President, Visitor, Volunteer, Winner, Merit12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
498555-8.52This is the site map for the TrophyCentral.com website. Use the Site Map as a Table of Contents for TrophyCentral's Key Sections.
custom-pagebaseballdisplay11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 23119Perfect CaseDisplay Cases11:14%,5:18%Six Baseball Glass Display Case. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.basedisplay-6Baseball / T-Ball, Sportscustom-pageaward-medalsqtskateboardncqtskateboardscqtskateboarddmqtskateboardplqtskateboardyrqtskateboardttqtskateboardttwqtskateboard3cmqtskateboardscbcup-skateboard-pcup-skateboard-scb1trophies1See a fabulous selection of Skateboarding Trophies at TrophyCentral. Free engraving on Skateboard Trophies!

Skateboarding Recognition Trophies

Do you have your own Tony Hawk to recognize? TrophyCentral has a great online selection of discounted skateboarding trophies. Be sure to see our Skateboarding Participation Trophies, popular with younger children. Our Single Column Trophies with a skateboarding figure is also a customer favorite. All of our trophies include up to three lines of free personalization (larger awards include additional lines). ]]>
custom-pagetrophies-skateboarding1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular skateboarding figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!qtskateboardplSkateboarding, 1st / 2nd / 3rd / Etc.custom-pagetrophies-skateboarding1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%This popular Skateboarding Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!qtskateboardyrSkateboardingcustom-pagetrophies-skateboarding1trophies498852-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with skateboarding figure discounted at TrophyCentral. Includes free text engraving!cup-skateboard-pSkateboardingcustom-pagetrophies-skateboarding1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these skateboarding budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtskateboardscbSkateboardingcustom-pagetrophies-skateboarding1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous Skateboarding Figure Winners Line Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qtskateboardttSkateboardingcustom-pagetrophies-skateboarding1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:28%See this championship trophy with a Skateboarding figure at TrophyCentral. Be sure to see all of our Skateboarding figure awards.qtskateboardttwSkateboardingcustom-pagetrophies-skateboarding1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%Find these popular Skateboarding Single Column Elite Series trophies discounted and with free personalization at TrophyCentral.qtskateboardscSkateboardingcustom-pagetrophies-skateboarding1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.05Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%Find These Popular Skateboarding Deluxe Platform Trophies Discounted at TrophyCentral. Real Marble; Free Engraving!qtskateboarddmSkateboardingcustom-pagetrophies-skateboarding1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Skateboarding figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-skateboard-scbSkateboardingcustom-pagetrophies-skateboarding1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.4226Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous two-tier, 3-column champion Skateboarding Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtskateboard3cSkateboardingcustom-pagetrophies-skateboarding1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:38%Our popular Skateboarding participation trophies feature a real slant-front marble base and free engraving.qtskateboardncSkateboardingcustom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%501431
custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%502041
custom-pagenew-trophies-21trophies498551-310.452429Trophies1Find this popular Skeet Shooting trophy discounted at TrophyCentral. Features a real marble base, free engraving and fast shipping.skeet-shooting-cup-place-trophy-tccustom-pagetrophies-trap-skeet-shooting1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%This popular Skeet Shooting trophy features a real marble base, column, figure and trim indicating year of award. Includes up to three lines of free engraving!qtshootyrcustom-pagetrophies-trap-skeet-shooting1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%,25:23%,50:29%,100:34%Our popular Skeet Shooting Participation Trophies feature a real slant-front White Marble base and free personalization. Significant quantity discounts available.qtshootnccustom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Ski Racing (Female) Inserts (Litho) at TrophyCentral. Each Ski Racing (Female) Insert can be used to create a unique plaque, medal or trophy.507401Skiing (Downhill), Sports
custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Skiing and Snow Sports Medals"Buy these quality Ski Racing (Male) Inserts (Litho) at TrophyCentral. Each Ski Racing (Male) Insert can be used to create a unique plaque, medal or trophy.507400Skiing (Downhill), Sports
custom-pagetrophies-snowmobileqtskiccncqtskiccscqtskiccyrqtskiccplqtskiccttqtskiccttwqtskicc3cacrylic-triangle-allqtskiccdmmqtskiccscbcup-skicc-pcup-skicc-scbbdg-skicccross-country-skiing-cup-place-column-trophycross-country-skiing-cup-place-trophy1trophies1Shop for Cross Country Skiing Trophies at TrophyCentral. Skiing Trophies Include Free Engraving!Cross Country Skiing Awards

TrophyCentral has a great selection of cross country skiing trophies and awards for races, club events, and team recognition. Our popular single column cross country skiing trophies are available in several sizes and column colors, and our place trophies come with a choice of 1st, 2nd, or 3rd place trim. Every cross country skiing trophy includes free personalized engraving with up to three lines of text, with larger trophies accommodating additional lines at no extra cost.

Shop Cross Country Skiing Awards with Confidence at TrophyCentral

With over 2,300 five-star reviews and trusted by leagues and clubs since 1999, TrophyCentral delivers quality awards at guaranteed lowest prices. Most orders ship in just 1-2 business days and free economy shipping is available on orders over $99. Explore our full collection of trophies and awards for even more designs and styles.

]]>
trophies skiingmedals trophies-downhill-skiing
custom-pagetrophies-snowmobileqtskidownncqtskidownscqtskidowndmqtskidownyrqtskidownplqtskidownttqtskidownttwqtskidown3cqtdowntrmqtskidownscbcup-skidown-pcup-skidown-scbbdg-skidownd-skiing-part-id-skiing-single-id-skiing-champ-id-skiing-e-part-id-skiing-e-single-id-skiing-plaque-idownhill-skiing-cup-place-column-trophydownhill-skiing-cup-place-trophy1trophies1Downhill Skiing Trophies from TrophyCentral. Most Skiing Trophies Ship in 1-2 Days and Include Engraving!Downhill Skiing Trophies TrophyCentral carries a large variety of skiing trophies and awards for all of your needs. The section above includes our selection of downhill skiing medals and trophies in a variety of sizes and styles to meet your recognition needs. Whether you want to recognize the ski race winner or participation in ski school, you have come to the right place!
We also have sections for cross country skiing and snowboarding.]]>
skiingmedals trophies-cross-country-skiing
custom-pageaward-medalsd-skiing-jigfd-skiing-jisfd-skiing-jibfd-skiing-mcd-skiing-mc-pre9266e927411Find downhill skiing medals discounted at TrophyCentral. Each medal features a free neck ribbon. Shop For Custom Skiing Medals With Ease TrophyCentral has a great selection of high quality ski medals, low prices and top-rated customer service. We have been helping customers since 1999 and we would be happy to serve you, too.

Frequently Asked Questions (FAQ)

What types of skiing medals do you offer?

We offer a variety of skiing medals, including designs for alpine skiing, cross-country skiing, and freestyle events. Choose from gold, silver, and bronze finishes.

Can I customize my skiing medals?

Yes! Our skiing medals can be customized with engraving, personalized ribbons, and even event logos to make them unique to your competition.

How fast do skiing medals ship?

Most in-stock skiing medals ship within 1-2 business days. Custom engraved medals may take slightly longer depending on the design.

Do you offer bulk discounts for ski competitions?

Yes! We provide special pricing for bulk orders, making it easy to award medals at large ski events. Contact us for details.

Are your skiing medals suitable for youth and adult competitions?

Absolutely! Our skiing medals are perfect for youth ski leagues, school competitions, and professional events.

Do you offer other winter sports awards?

Yes! In addition to skiing medals, we offer a wide selection of award medals and skiing trophies for various winter sports, including snowboarding and hockey.

]]>
custom-pageeagle-trophies1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"trophies410187-1010.45428.45JcharlesCrystal Awards1:22%,25:25%"crystal awards" "sales awards" "service awards" "corporate sales awards" "corporate service awards" "sales award" "service award" "corporate sales award" "corporate service award"Sky Master Awards from TrophyCentral. Discounted Trophies, Awards and Promotional Products.241custom-pagegeneral-corporate-awards1"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"458221513219Vision AwardsTrophies1:22%,26:40%"New Products" "Award for Business" "Awards for Business" "Achievement Awards" "Achievement Award" "Awards for Achievement"Find this Slate Ace Recognition Awards from TrophyCentral. Also see our great selection of engraved and personalized gifts!custom-pagefloating-plaques1"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"plaques458221510.45315.45Vision AwardsTrophies1:22%,6:28%,26:37%,51:43%Buy this Slate Star Plaque and other Star Plaques at Discounted Prices from TrophyCentral.Business, General, Starcustom-pagegold-pins-lapelplasticpinboxvelapinbox151-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsGeneral1:30%,50:36%,100:39%,500:42%,1000:48%Find this fabulous Small Gold Service Bar letter pin at TrophyCentralcl53Service / Retirement Bar
custom-pagegold-pins-lapelplasticpinboxvelapinbox151-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsGeneral1:30%,50:36%,100:39%,500:42%,1000:48%Find this fabulous Small Textured Service Bar letter pin at TrophyCentralcl105Service / Retirement Bar
custom-pagepersonalized-gifts11personalized gifts105503-610.4511813.05Classic MedallicsGiftsEngraved Frames1:22%"Father's Day Gifts"Small Pewter Golf Frame. Ideal for leagues, schools, and tournaments. Fast shipping.Engraved Framescustom-pageaward-medalsqtsnowboardncqtsnowboardscqtsnowboarddmqtsnowboardplqtsnowboardyrqtsnowboardttqtsnowboardttwqtsnowboard3cqtsnowboperpmqtsnowboardscbcup-snowboard-scbcup-snowboard-psnowboarding-cup-place-column-trophysnowboarding-cup-place-trophy1trophies1See a fabulous selection of Snowboarding Trophies at TrophyCentral. Each snowboarding trophy includes free engraving! Fast 1-2 day shipping!Custom Snowboarding Trophies & Awards TrophyCentral has a great selection of snowboarding awards and medals. Be sure to see our popular Single Column Snowboarding Trophies, available in several sizes and with several different color columns, and our place trophies with a choice of 1st, 2nd or 3rd place trim. These awards are perfect for a race or club event. All of our snowboarding awards include up to three lines of FREE ENGRAVING (larger trophies include additional lines). We also offer FREE GROUND SHIPPING on orders over $100 shipping to the continental U.S. ]]>custom-pagetrophies-snowboarding1trophies498551-310.452429Trophies1Find this popular Snowboarding trophy discounted at TrophyCentral. Features a real marble base, free engraving and fast shipping.snowboarding-cup-place-trophy-tccustom-pagetrophies-snowboarding1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Fabulous Snowboarding Place Trophy with 1st, 2nd or 3rd Place Trim, Marble Base and Free personalization. Ships in a fast 1-2 days!qtsnowboardplSnowboarding, 1st / 2nd / 3rd / Etc., Sportscustom-pagetrophies-snowboarding1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%This popular Snowboarding Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!qtsnowboardyrSnowboarding, Sportscustom-pagetrophies-snowboarding1trophies498852-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with snowboarder figure discounted at TrophyCentral. Includes free text engraving!cup-snowboard-pSnowboarding, Sportscustom-pagefree-sports-templates1"Download Only"free-sports49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Snowboarding template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Snowboarding-Certificatesnowboarding-freeSnowboarding, Sportscustom-pagetrophies-snowboarding1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these snowboarder budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtsnowboardscbSnowboarding, Sportscustom-pagetrophies-snowboarding1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:27%Find these fabulous two-tier Snowboarding Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtsnowboardttSnowboarding, Sportscustom-pagetrophies-snowboarding1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:28%Find this awesome Snowboarding two-tier championship trophy discounted, and with free engraving, at TrophyCentral!qtsnowboardttwSnowboarding, Sportscustom-pagetrophies-snowboarding1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:26%Find these popular Snowboarding Single Column Elite Series Trophies discounted and with free personalization at TrophyCentral.qtsnowboardscSnowboarding, Sportscustom-pagetrophies-snowboarding1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.05Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%Find This Popular Snowboarding Deluxe Platform Series Trophies Discounted at TrophyCentral. Real Marble Base; Free Personalization!qtsnowboarddmSnowboarding, Sportscustom-pagetrophies-snowboarding1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Snowboarder figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-snowboard-scbSnowboarding, Sportscustom-pagetrophies-snowboarding1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.4226Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:18%,10:23%Find these fabulous two-tier, 3-column champion Snowboarding Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtsnowboard3cSnowboarding, Sportscustom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Skiing and Snow Sports Medals"Buy these quality Snowboarding Inserts (Litho) at TrophyCentral. Each Snowboarding Insert can be used to create a unique plaque, medal or trophy.507557Snowboarding, Sports
custom-pageeawardmedals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "Sports Medals"These inexpensive 1 1/4 inch Snowboarding Medals offer a high quality, but low price for those on a tight budget.e9813Snowboarding, Sports
custom-pagetrophies-snowboarding1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:35%Our Snowboarding Participation Trophies feature a real slant-front white marble base and free personalization. Significant quantity discounts available.qtsnowboardncSnowboarding, Sportscustom-pagetrophies-snowboarding1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498852-311.4234Quick TrophyTrophies1:14%,3:15%,10:16%Find this Perpetual Series Trophy - SnowboardingDiscounted at TrophyCentral. Each Trophy has enough room for 32 names. Ships in just 1-2 days.qtsnowboperpReturn to thesection for more details and choices.trophies-snowboardingSnowboarding, Sportscustom-pageaward-medalsqtsnowncqtsnowscqtsnowdmqtsnowyrqtsnowplqtsnowttqtsnowttwqtsnow3cqtsnowmobperpmqtsnowscbcup-snow-pcup-snow-scb1trophies1Find Snowmobile Trophies Discounted At TrophyCentral. Each Snowmobile Trophy Includes Free Personalization. Fast 1-2 Day Shipping!

Custom Snowmobile Recognition Trophies

TrophyCentral has a great online selection of discounted snowmobile trophies. Be sure to see our snowmobile participation trophies, popular with younger children. Our single column trophy with a snowmobile figure is also a customer favorite. All of our trophies include up to three lines of free personalization (larger awards include additional lines). ]]>
trophies-downhill-skiing trophies-cross-country-skiing
custom-pagetrophies-snowmobile1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:16%Fabulous Snowmobile Place trophy with 1st, 2nd or 3rd Place Trim, Marble Base and Free Engraving!qtsnowplSnowmobile, 1st / 2nd / 3rd / Etc.custom-pagetrophies-snowmobile1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:16%This popular Snowmobile trophy features a real marble base, column, figure and trim indicating year of award. Includes up to three lines of free engraving!qtsnowyrSnowmobilecustom-pagetrophies-snowmobile1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with snowmobile figure discounted at TrophyCentral. Includes free text engraving!cup-snow-pSnowmobilecustom-pagetrophies-snowmobile1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these snowmobile figure budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtsnowscbSnowmobilecustom-pagetrophies-snowmobile1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:26%Find these fabulous Snowmobile Figure Winners Line Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qtsnowttSnowmobilecustom-pagetrophies-snowmobile1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-411.215Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:28%See this championship trophy with a Snowmobiling figure at TrophyCentral. Be sure to see all of our Snowmobiling figure awards.qtsnowttwSnowmobilecustom-pagetrophies-snowmobile1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:22%These popular Snowmobile Figure Elite Series Trophies feature a choice of column size and color, a white marble base and free trophy personalization!Snowmobilecustom-pagetrophies-snowmobile1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.05Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:16%Find These Popular Snowmobile Figure Deluxe Platform Trophies Discounted at TrophyCentral. Real Marble; Free Engraving!qtsnowdmSnowmobilecustom-pagetrophies-snowmobile1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Snowmobile Figure figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-snow-scbSnowmobilecustom-pagetrophies-snowmobile1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-411.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:18%,10:23%Find these fabulous two-tier, 3-column champion Snowmobile Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtsnow3cSnowmobilecustom-pagetrophies-snowmobile1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:25%Our popular Snowmobile Figure participation trophies feature a real slant-front marble base and free engraving.qtsnowncSnowmobilecustom-pagetrophies-snowmobile1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.4234Quick TrophyTrophies1:14%,3:15%,10:16%Find this Perpetual Snowmobile Trophy Discounted at TrophyCentral. Each Trophy has enough room for 32 names. Ships in just 1-2 days.qtsnowmobperpReturn to oursection for additional choices and styles.trophies-snowmobileSnowmobilecustom-pagefree-sports-templates1"Download Only"free-sports4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Snowmobiling template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Snowmobiling-Certificatesnowmobiling-freeSnowmobilingcustom-pagemedallion-inserts-general-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these quality Soaring Eagle Inserts (Litho) at TrophyCentral. Each Soaring Eagle Insert can be used to create a unique plaque, medal or trophy.507439Eagle
custom-pagetrophies-basketball1037soccer-plaque-iqsinplaq3dsoccerqsinplaqsoccerqtdogsocrsoccer-ei10631trophies1Shop soccer trophies, medals and plaques for every level of play. Hundreds of styles for players, leagues and schools. Free engraving. Fast shipping.trophies-soccer

Custom Soccer Trophies & Awards — Celebrate Every Goal, Every Season

Soccer is the most widely played youth sport in the United States, and the recognition programs that serve it span every level of competition. From six-year-olds playing their first AYSO game on a Saturday morning to high school strikers chasing a state title, our soccer trophies are built to match the moment. Youth recreational and AYSO leagues rely on participation trophies that make every player feel valued alongside tiered placement awards for division winners and tournament finalists. Club and travel programs demand premium resin sculptures and multi-tier championship trophies that reflect the year-round commitment players and families invest. High school programs call for a full roster of individual honors — Golden Boot for the team's top scorer, Golden Glove for the goalkeeper who recorded the most shutouts, Best Midfielder, Best Defender, Most Improved Player, and MVP — each deserving a trophy or plaque that stands apart from a standard participation piece. Tournament directors ordering across multiple divisions and age groups find our consistent figurine styles and tiered pricing make it practical to build a complete recognition program from one place. Every soccer trophy includes free engraving personalized with player names, team names, award titles, and season details.

Frequently Asked Questions About Soccer Trophies

What trophy sizes work best for different soccer award categories?

Recreational and AYSO leagues serving players ages 5 to 8 benefit from 6-inch to 8-inch participation trophies that every player receives, building confidence and creating positive associations with organized sports. Youth leagues for ages 9 to 12 typically step up to 8-inch to 12-inch trophies for placement finishers, with the size difference signaling achievement without significantly increasing cost across large rosters. Club and travel program tournaments call for 14-inch to 20-inch trophies for champions and finalists, with premium resin sculptures popular at this level for their detail and display value. High school individual honors like Golden Boot, Golden Glove, and MVP warrant 12-inch to 16-inch column trophies or plaques that stand apart from standard participation pieces. League and tournament grand champions deserve 20-inch to 24-inch multi-column championship trophies whose size and weight match the significance of the achievement.

What details should soccer trophy engraving include?

The most meaningful trophies are engraved with more than just a name. For team awards, include the league or tournament name, team name, division, finishing position, and season year. For individual player awards, add the player name, award title, and season. Keep text concise and readable, prioritizing the most meaningful details when space is limited.

Should youth soccer programs give trophies to every player or only award winners?

Youth programs serving players under 12 benefit significantly from universal participation trophies that acknowledge every athlete who completed the season, building confidence and encouraging return the following year. Even participation-focused programs should maintain competitive recognition with larger trophies for MVP, Most Improved, Best Sportsmanship, and Coach awards, teaching young athletes that exceptional effort earns special recognition. Middle school and high school programs appropriately shift toward merit-based awards recognizing championships, individual excellence, and statistical achievement, preparing athletes for increasingly competitive environments.

If you need more information before deciding, see our expert resource section:
]]>
custom-pagemedals-j-series12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
"PT1=Medals" "PC12=105503-60.515014Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,50:28%,100:34%,500:41%"Soccer Medals" "Soccer Awards" "Award Medals - All Subjects" "Sports Medals" "Purchase Soccer Trophies" "Discount Soccer Trophies" "Soccer Medals and Trophies" "Soccer Trophies and Medals"Find our Soccer (General) 2" Olympic-Style J-Series Medals at a super price point at TrophyCentral. Large quantity discounts available!j956612-20-2040Soccer, Sports
custom-pagetrophies-soccer11"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"medals498852-30.3716021.6Quick Trophyaward-medalsSports, Hobby, Org, Livestock1:14%,10:25%,100:36%"Soccer Medals" "Soccer Awards" "Most Popular Items" "Award Medals - All Subjects" "Sports Medals" "Soccer Medals and Trophies" "Soccer Trophies and Medals"Soccer - 2 Inch Antique Series Medals. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.soccer1Soccer, Sportscustom-pagetrophies-soccer1trophies498551-310.452429Trophies1Find this popular Soccer trophy discounted at TrophyCentral. Features a real marble base, free engraving and fast shipping.soccer-cup-place-trophy-tccustom-pagetrophies-soccer1"PT1=Trophies" "PC12=498552-310.451622.85Trophy CentralTrophiesSports, Hobby, Org, Livestock1"Soccer Trophies" "Cheap Soccer Trophies" "Buy Soccer Trophies" "Purchase Soccer Trophies" "Discount Soccer Trophies"Soccer Place (1st, 2nd, 3rd) trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.soccer-trip-trophiesSoccer, 1st / 2nd / 3rd / Etc., Sportscustom-pagetrophies-soccer20498552-40.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Soccer Epoxy Decal (2 Inch). Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagetrophies-soccer1trophies498552-310.451622.85Trophy CentralTrophiesSports, Hobby, Org, Livestock1"Soccer Trophies" "Cheap Soccer Trophies" "Buy Soccer Trophies" "Purchase Soccer Trophies" "Discount Soccer Trophies"Year Indicator Trim Soccer Trophy - Custom Engraved League Award. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagetrophies-soccer1"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"medals498552-30.3716021.6Trophy Centralaward-medalsSports, Hobby, Org, Livestock1:14%,10:19%,50:28%,100:34%,500:42%"Soccer Medals"Soccer 3D Relief Medals (2 Inch). Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.qush3dsoccermeSoccer, Sportscustom-pagetrophies-soccersoccerfr1soccerfrcertificates290631-31 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,25:27%,100:40%,500:50%Achievement Soccer Certificate. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.1037Soccer, Sportscustom-pagetrophies-soccer1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Achievement Cup Soccer Trophy. Ideal for leagues, schools, and tournaments. Free engraving. Fast shipping.cup-soccer-pSoccer, Sportscustom-pagetrophies-soccer1medals498552-30.525033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Soccer Ball 2 1/4" Antique Gold Medal Discounted at TrophyCentral. Each medal features a free ribbon. Fast shipping!Soccer, Sportscustom-pagetrophies-soccer1trophies-soccer1Creative soccer award ideas with engraving examples for end of season celebrations. Discover unique ways to recognize soccer teams and players with actual trophy wording templates.custom-pagefree-sports-templates1"Download Only"free-sports49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Free printable soccer certificate template to recognize players, teams, and coaches. Download and customize for leagues, schools, and clubs at no cost.soccerfrSoccer, Sportscustom-pageaward-ribbons-printed1"1-2 business days" "Topeka, Indiana" "UPS (Post Office Priority Mail may also be available)"ribbons465711-21 26120030.36Tower RibbonRibbons11:22%,50:46%Soccer Award Ribbons. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagenoname111"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.5116.5Perfect CaseDisplay Cases11:14%,5:16%Soccer Ball Display Case (Glass, Octagon). Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagesports-inserts1105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Soccer Ball Litho Medal Insert. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.492691Soccer, Sportscustom-pagesoccerpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsSports, Hobby, Org, Livestock1:22%,50:30%,100:33%,500:47%Soccer Ball-Shaped Letter Pin. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.ec01Soccer, Sports111037 wvl455"3-4 business days + shipping time" "Marquette, MI" "UPS (FedEx available on request)""PT1=Trophies" "PC12=498552-310.451224.5JDS-STrophiesSports, Hobby, Org, Livestock1:22%,12:32%"Soccer Medals and Trophies" "Soccer Trophies and Medals"Kids love our engraved soccer bank trophy! Soccer bank trophies are made of resin and the baseball figure is hand-painted.1soccerbank12-20-2020Soccer, Sportscustom-pagetrophies-soccer1trophies-soccertrophies498552-310.453631.05JDS-STrophiesSports, Hobby, Org, Livestock1"Soccer Awards" "Soccer Medals and Trophies" "Soccer Trophies and Medals"Soccer Bobble Head Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.soccer-bobble-head-trophySoccer, Sportscustom-pagetrophies-soccer1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%2 3/4" T-Series Medal with Bronze Frame: Soccer. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagetrophies-soccer1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Single Column Budget Soccer Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.mqtsoccerscbSoccer, Sportscustom-pagetrophies-soccer1498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Budget-Friendly Soccer Participation Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.bdg-soccerSoccer, Sportscustom-pagetrophies-soccer1trophies105503-610.4511230.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1"Soccer Awards"Soccer Cast Stone Series Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagetrophies-soccer1trophies498552-411229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Champion's Cup Soccer Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Champion's Cup - SoccerSoccer, Sportscustom-pagetrophies-soccer1trophies498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Champion's Soccer Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Champion's-Trophy-with-Soccer-InsertSoccer, Sportscustom-pagetrophies-soccer1trophies498552-310.75219Trophy CentralTrophiesSports, Hobby, Org, Livestock1"Soccer Trophies" "Cheap Soccer Trophies" "Buy Soccer Trophies" "Purchase Soccer Trophies" "Discount Soccer Trophies"Quick-Ship Two-Tier Soccer Trophy with Figure - Style 2. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagetrophies-soccer1trophies498552-311.215Trophy CentralTrophiesSports, Hobby, Org, Livestock1"Soccer Trophies" "Cheap Soccer Trophies" "Buy Soccer Trophies" "Purchase Soccer Trophies" "Discount Soccer Trophies"Two-Tier Championship Soccer Trophy with Wood Base - 26-28 Inches. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagetrophies-soccer1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Single Soccer Column Insert Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Single Column Insert Trophy - SoccerSoccer, Sportscustom-pagetrophies-soccer1soccer-participation-trophies double-platform-trophies-soccer year-indicator-trophies-soccer soccer-trip-trophiestrophies498552-310.452421.33Trophy CentralTrophiesSports, Hobby, Org, Livestock1"Soccer Trophies" "Cheap Soccer Trophies" "Buy Soccer Trophies" "Purchase Soccer Trophies" "Discount Soccer Trophies"Single Column Soccer Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagetrophies-soccer1trophies498551-311821.06TrophyCentraltrophies1Soccer, Sportscustom-pagecustommedals50"Standard Service: 8 Business Days from Receipt of Artwork, Rush Service (Extra Charge): 3 Business Days from Receipt of Artwork" "Oxnard, CA" "UPS (FedEx available on request)"medals930335-1010.630033.6Simba Calaward-medalsSports, Hobby, Org, Livestock1:22%,300:40%,500:51%,1000:54%"Soccer Medals" "Soccer Awards"Soccer Medal with Personalized School, Team or Event Name. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.qcm-28Soccer, Sportscustom-pagetrophies-soccer1trophies498552-310.451623.65Trophy CentralTrophiesSports, Hobby, Org, Livestock1"Soccer Trophies" "Cheap Soccer Trophies" "Buy Soccer Trophies" "Purchase Soccer Trophies" "Discount Soccer Trophies"Double Platform Soccer Award in 3 Sizes. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagenoname111"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.5116.5Perfect CaseDisplay Cases11:14%,5:15%Soccer Display Case (Glass, Wall-Mounted). Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagetrophies-soccer1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"498852-30.38150030Quick TrophyDog TagsSports, Hobby, Org, Livestock1:14%,10:15%Soccer Dog Tag. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.qtdogsocrSoccer, Sportscustom-pagetrophies-soccer1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Single Column Soccer Cup Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.cup-soccer-scbSoccer, Sportscustom-pagetrophies-soccer1trophies498551-310.71217.38trophies1Soccer, Sportscustom-pagesoccerpinsplastic-pinbox-t10lapel pins498551-30.5200040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Soccer Gold Enamel lapel pin. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagetrophies-soccer1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%2 3/4" T-Series Medal with Gold Frame: Soccer. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagetrophies-soccer1trophies498552-311.418Trophy CentralTrophiesSports, Hobby, Org, Livestock1"Soccer Trophies" "Cheap Soccer Trophies" "Buy Soccer Trophies" "Purchase Soccer Trophies" "Discount Soccer Trophies" "Soccer Awards"Quick-Ship Two-Tier 3-Column Trophies - Soccer. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagetrophies-soccer1"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498852-310.45811.6Quick TrophyPlaquesInsert1:14%,3:14%"Soccer Awards"Soccer Holographic Decal Plaque. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagetrophies-soccer1medals498552-30.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Soccer Insert Medal. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagetrophies-soccer1medals498552-40.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Soccer Insert Medal with Personalized Rim. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagetrophies-soccer1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Soccer Insert Plaque (Multiple Styles). Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagetrophies-soccer12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,100:28%,500:34%,1000:45%"Soccer Medals" "Soccer Awards" "Award Medals - All Subjects" "Sports Medals" "Soccer Medals and Trophies" "Soccer Trophies and Medals"Soccer Medal (1 1/4 Inch). Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.e902306-15-2013Soccer, Sports
1sports-medals1Find soccer medals your players will love discounted at TrophyCentral. Each soccer medal features a free neck ribbon.Shop for Soccer Award Medals with Ease at TrophyCentral! TrophyCentral has an industry-leading selection that will fit any budget, low prices and bulk discounts. Our top-rated customer service team will be happy to assist you with all of your needs.

Frequently Asked Questions (FAQ)

🏆 Who typically receives soccer medals?

Soccer medals are awarded to players for outstanding performance, teamwork, and participation. They are commonly given for MVP, Best Offense, Best Defense, Most Improved, and for championship teams at the end of the season.

🎨 Can I customize soccer medals with engraving?

Yes! Our custom soccer medals can be personalized with player names, team names, tournament details, and special achievements. Many of our medals come with free engraving options.

📦 Do you offer bulk discounts for teams and leagues?

Absolutely! We provide bulk pricing for teams, schools, and leagues. Contact us for special discounts on large orders of soccer team medals and awards.

🥇 What are the best soccer medals for youth leagues?

For youth soccer, we recommend lightweight and durable medals with colorful designs. Options like full-color soccer medals or those with bright, customizable ribbons are great for young players.

🚚 How fast can I receive my soccer medals?

Most of our soccer medals ship within 1-2 business days. Custom-engraved medals may take a little longer, so we recommend ordering early to ensure they arrive before your award ceremony or tournament.

]]>
soccerinsertmedals soccerpins
custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Soccer Mylar Decal Medal Insert. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.489612Soccer, Sports
custom-pagetrophies-soccer1"10 business days" "Aliquippa, PA" "UPS"trophies1500110-1410.45424.45Glass AmericaCrystal Awards1:22%,10:25%"Soccer Awards" "Soccer Medals and Trophies" "Soccer Trophies and Medals"Soccer Optical Crystal Award. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.8988Soccer, Sportscustom-pagetrophies-soccer1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Participation Insert Trophy - Soccer. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Participation Insert Trophy - SoccerSoccer, Sportscustom-pagetrophies-soccer1trophies498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1"Most Popular Items" "Soccer Trophies" "Cheap Soccer Trophies" "Buy Soccer Trophies" "Purchase Soccer Trophies" "Discount Soccer Trophies" "Soccer Medals and Trophies" "Soccer Trophies and Medals"Participation Trophy with Marble Platform - Soccer (Boy or Girl Figure). Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagetrophies-soccer1"PC10=498552-311.4234Trophy CentralTrophies1"Soccer Awards" "Soccer Trophies" "Soccer Trophies and Medals"Find this Perpetual Soccer Trophy Discounted at TrophyCentral. Each Trophy has enough room for 32 names. Ships in just 1-2 days.1Soccer, Sportscustom-pagekeychains21105502-40.39125035.39Classic MedallicsGiftsKeychains1:22%,10:25%,25:32%,50:39%,100:47%"Soccer Awards"Soccer Pewter Keychains. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.pk68-cmKeychainscustom-pagetrophies-soccercl08ec01soccer-pb11Soccer pins in a variety of styles, finishes and sizes. Each soccer pin features a clutch back for easy attachment to clothing.Lapel Pins: Soccer TrophyCentral has a great selection of stock and custom soccer pins. Our soccer letter pins are available with a color or chenille gold finish and are available in several styles. Each soccer pin features a clutch-pin back for safe and easy attachment to clothing.

Shop with Confidence at TrophyCentral!

TrophyCentral has a great online selection that will fit any budget. Our top-rated representatives are happy to assist you. Our experts in New York and Michigan have been providing suggestions and guidance since 1999!]]>
11Discover fun and creative soccer recognition ideas for kids, teens, and adults. Learn about different styles, how to choose the right award, and tips for unforgettable end of season ceremonies.custom-pagetrophies-soccer1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%2 3/4" Silver Frame Medal: Soccer. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagetrophies-soccer1trophies498552-310.452417.25Trophy CentralTrophiesSports, Hobby, Org, Livestock1Spinner Participation Trophy - Soccer. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.spinner-participation-trophies-soccer09-15-2022Soccer, Sportscustom-pageawardcertificates11certificates290631-31 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,25:24%,100:40%,500:50%Find these Social Studies certificates discounted at TrophyCentral. Each Social Studies certificate is beautifully printed and measures 11 x 8 1/2 inches.929Social Studiescustom-pageschool-pinsplasticpinboxvelapinbox1"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:30%,100:35%,500:48%"School Pins"Find these popular Social Studies HP Series Pins Discounted at TrophyCentral. Fast 1-2 Days Shipping! Large Quantity Discounts Are Available.hp1906-15-2013Social Studiescustom-pageschool-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:28%,100:32%,500:42%"School Pins"Find these popular Social Studies AP Series Lapel Pins discounted at TrophyCentral. Fast 1-2 day shipping!al82Social Studiescustom-pagemvp-trophiessoftball-eiqtdogsoftsoftball-plaque-i1trophies1"Softball Awards" "Sports Trophies" "Trophies" "Softball Trophies"Find a great selection of softball trophies at TrophyCentral. Each softball trophy and award includes free engraving. Softball medals include a ribbon.

Custom Softball Trophies and Awards - Honor Every Hit, Catch, and Championship Season

Softball trophies celebrate the teamwork, hustle, and competitive spirit that define one of America's most widely played recreational and competitive sports. From youth rec leagues where girls and boys learn the fundamentals of the game, to competitive travel ball programs where talented players chase tournament titles across the region, from adult coed leagues where teammates celebrate every season together, to high school varsity programs where championship seasons become lifelong memories, quality softball awards recognize players, coaches, and teams across every level of the game. Our versatile selection includes budget participation trophies and economy series awards ideal for youth league end-of-season banquets, single column and double platform trophies with softball batter and golden glove figurines for individual and team recognition, place trim trophies in 1st, 2nd, and 3rd for tournament podium finishers, two-tier and three-column championship trophies for league and tournament champions, a perpetual softball trophy for leagues that crown a new champion each season, star series resin trophies for premium individual recognition, acrylic triangle awards for a modern alternative, insert plaques for wall display, and medals in gold, silver, and bronze with free ribbons for large tournaments recognizing multiple divisions. Every award includes free engraving personalized with player name, team, and season.

Softball Medals

In addition to trophies, we offer a wide selection of softball medals ideal for participation awards, tournaments, and team recognition. Choose from gold, silver, and bronze finishes, with options for youth leagues as well as adult and competitive teams. Softball medals provide a practical and budget-friendly way to recognize every player, from recreational leagues to travel and school programs.

Frequently Asked Questions About Softball Trophies

What trophy sizes work best for different softball award categories?

Youth rec league participation and end-of-season team awards benefit from 6-inch to 9-inch economy trophies ensuring every player receives recognition for completing the season, building confidence and encouraging return participation the following year. Individual category awards such as MVP, most improved, and best batting average deserve 10-inch to 14-inch single column trophies with softball figurines that distinguish individual achievement from participation awards. Tournament division winners and league runners-up warrant 15-inch to 18-inch premium trophies with substantial presence reflecting strong competitive performance across a full season or bracket. League champions and travel ball tournament overall winners demand 20-inch to 24-inch two-tier or three-column trophies whose height and weight convey the prestige of the title. Medals in gold, silver, and bronze work especially well for large tournaments recognizing multiple age divisions where awarding every placer a trophy is impractical.

What details should softball trophy engraving include?

Essential elements include player name, award title, team name, league or tournament name, and season year. For individual awards, adding a position or specific achievement such as Golden Glove Award or Team MVP creates a more meaningful keepsake. Team championship trophies benefit from including the final record or division name. Keep text concise and readable, prioritizing the most meaningful details when space on smaller trophies requires choices.

Do you offer bulk discounts for softball leagues and tournaments?

Yes, Trophy Central offers significant bulk discounts on softball trophies and medals that scale with order quantity, keeping award budgets manageable for leagues and tournaments of any size. League coordinators ordering participation trophies for an entire season roster, tournament directors purchasing place trophies across multiple age divisions, and travel ball programs buying year-end awards for a full team all benefit from bulk pricing. Browse our softball medals above for the most budget-friendly option when recognizing large fields.

If you need more information before deciding, see our expert resource section:
]]>
trophies 1st-place-medals mvp-trophies
custom-pagetrophies-softball1trophies498551-310.452429Trophies1Find this popular Softball trophy discounted at TrophyCentral. Features a real marble base, free engraving and fast shipping.softball-cup-place-trophy-tccustom-pagetrophies-softball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%"Softball Trophies" "Softball Trophy" "Trophies, Softball"Find this popular softball figure trophy with gold 1st, 2nd or 3rd place trim, marble base and free personalization, discounted at trophyCentral. Ships in a fast 1-2 days!qtsoftplSoftball, 1st / 2nd / 3rd / Etc., Sportscustom-pagetrophies-softball1498554-Feb0.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful Softball 2" Epoxy-covered insert decal discounted at TrophyCentral. Fast 1-2 day shipping.Softball, Sportscustom-pagetrophies-softball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%"Softball Trophies" "Softball Trophy" "Trophies, Softball"This popular Softball trophy features a real marble base, column, figure and trim indicating year of award. Free engraving!qtsoftyrReturn to oursection.trophies-softballSoftball, Sportscustom-pagetrophies-softball1"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"medals498552-30.3716021.6Trophy Centralaward-medalsSports, Hobby, Org, Livestock1:14%,10:19%,50:28%,100:34%,500:42%"Softball Medals"Find These Softball 3D Relief Medals At A Great Low Price And With Fast Shipping At TrophyCentral. Large Quantity Discounts Available.qush3dsoftmeSoftball, Sportscustom-pagetrophies-softball1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with softball figure discounted at TrophyCentral. Includes free text engraving!cup-soft-pSoftball, Sportscustom-pagetrophies-softball11Creative softball award categories for banquets. Fun ideas like Dugout Energy and Home Run Queen, plus exact engraving examples. Perfect planning guide.custom-pagefree-sports-templates1"Download Only"free-sports4985501Trophy CentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Softball template is free and designed exclusively for Trophy Central. Softball certificate templates measure 11" x 8 1/2" and can be easily downloaded and printed.softball-certificatesoftball-frSoftball, Sportscustom-pagefree-sports-templates1"Download Only"free-sports49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Softball template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Softball-Certificatesoftball-freeSoftball, Sportscustom-pagetrophies-softball1"2-4 business days + shipping time" "Marquette, MI" "UPS (FedEx available on request)"trophies498552-310.452419.65JDS-STrophiesSports, Hobby, Org, Livestock1:22%,100:38%"Softball Awards" "Softball Trophies" "Softball Awards"Shop for Classic Economy Trophies with Softball figures at TrophyCentral. We offer quick shipping and free trophy engraving!iasofmSoftball, Sportscustom-pagetrophies-softball1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Softball Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Softball, Sportscustom-pagetrophies-softball1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these softball budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtsoftscbSoftball, Sportscustom-pagetrophies-softball1498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Find this budget softball award trophy discounted at Trophy Central. Features a real marble base and plastic softball figure. Engraving is free. Fast 1-2 day shipping.bdg-softballSoftball, Sportscustom-pagesporcer1certificates290631-31 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,25:27%,100:40%,500:50%"Softball Awards"Give your softball players the recognition they deserve with softball certificates from Trophy Central. Shop our discounted softball certificates today!1038Softball, Sportscustom-pagetrophies-softball1trophies498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Softball insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-Softball-InsertSoftball, Sportscustom-pagetrophies-softball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%"Softball Trophies" "Softball Trophy" "Trophies, Softball"Find these fabulous two-tier Softball Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtsoftttSoftball, Sportscustom-pagetrophies-softball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.215Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%"Softball Trophies" "Softball Trophy" "Trophies, Softball"See this championship trophy with a Softball figure at TrophyCentral. Be sure to see all of our Softball figure awards.qtsoftttwSoftball, Sportscustom-pagetrophies-softball1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Softball single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - SoftballSoftball, Sportscustom-pagetrophies-softball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%"Softball Trophies" "Softball Trophy" "Trophies, Softball"This popular Softball Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtsoftscReturn to oursection for more great choices.trophies-softballSoftball, Sportscustom-pagetrophies-softball1trophies498551-311821.06TrophyCentraltrophies1Softball, Sportscustom-pagetrophies-softball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451623.65Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%"Softball Trophies" "Softball Trophy" "Trophies, Softball"These quick-ship trophies from TrophyCentral feature a Softball figure, real marble base and marble trophy figure platform, choice of column size and color.qtsoftdmReturn to section for additional choices.trophies-softballSoftball, Sportscustom-pagetrophies-softball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-30.38150030Quick TrophyDog TagsSports, Hobby, Org, Livestock1:14%,10:15%Find these popular softball dog tags discounted at TrophyCentral. The price of each softball dog tag includes chain and custom engraving!qtdogsoftSoftball, Sportscustom-pagebaseballdisplay11"7-10 business days w/Logo, 4-6 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 2311413Perfect CaseDisplay Cases1:14%,5:21%Softball Glass Display Cases from TrophyCentral. Discounted Trophies, Awards and Promotional Products.Softball, Sportscustom-pagetrophies-softball1trophies498551-310.452429Trophies1Find this popular Softball Glove trophy discounted at TrophyCentral. Features a real marble base, free engraving and fast shipping.softball-glove-cup-place-trophy-tccustom-pagetrophies-softball1trophies498552-310.45TrophiesSports, Hobby, Org, Livestock1Find this popular softball glove trophy with 1st, 2nd or 3rd place trim, marble base and free personalization, discounted at trophyCentral. Ships in a fast 1-2 days!1st / 2nd / 3rd / Etc., Softball, Golden Glovecustom-pagetrophies-softball1trophies498552-310.45TrophiesSports, Hobby, Org, Livestock1This popular Softball Glove trophy features a real marble base, column, figure and trim indicating year of award. Includes up to three lines of free engraving!See more great league, team and individualin other popular styles.trophies-softballSoftball, Golden Glovecustom-pagetrophies-softball1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with softball glove figure discounted at TrophyCentral. Includes free text engraving!cup-softbgl-pSoftball, Golden Glovecustom-pagetrophies-softball1trophies498552-310.75TrophiesSports, Hobby, Org, Livestock1Find these fabulous two-tier Softball Glove Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!Softball, Golden Glovecustom-pagetrophies-softball1trophies498552-311.2TrophiesSports, Hobby, Org, Livestock1Find this awesome Softball Glove two tier championship trophy discounted at TrophyCentral. Add up to 3 lines of Free Personalization!Softball, Golden Glovecustom-pagetrophies-softball1trophies498552-310.45TrophiesSports, Hobby, Org, Livestock1This popular Softball Glove Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.Softball, Golden Glovecustom-pagetrophies-softball1trophies498552-310.45TrophiesSports, Hobby, Org, Livestock1These quick-ship trophies from TrophyCentral feature a Softball Glove figure, real marble base and marble trophy figure platform, choice of column size and color.Softball, Golden Glovecustom-pagetrophies-softball1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Softball Glove figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-softbgl-scbSoftball, Golden Glovecustom-pagetrophies-softball1trophies498552-311.4TrophiesSports, Hobby, Org, Livestock1Find these fabulous two-tier, 3-column champion Softball Glove Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!Softball, Golden Glovecustom-pagetrophies-softball1trophies498552-310.45TrophiesSports, Hobby, Org, Livestock1Our popular Softball Glove participation trophies feature a real slant-front marble base and free engraving.Return to oursection for more great choices!trophies-softballSoftball, Golden Glove11Find a Great Selection of Softball Glove Trophies Discounted at TrophyCentral. Each Softball Glove Trophy Includes Free Personalization! Fast 1-2 Day Shipping!1Softball, Golden Glovecustom-pagetrophies-softball1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Softball figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-soft-scbSoftball, Sportscustom-pagetrophies-softball1trophies498551-310.71217.38trophies1Softball, Sportscustom-pagetrophies-softball1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Softball Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Softball, Sportscustom-pagetrophies-softball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%"Softball Trophies" "Softball Trophy" "Trophies, Softball" "Softball Awards"Find these fabulous Softball Line 3-column Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qtsoft3cSee other championshipin a variety of sizes.trophies-softballSoftball, Sportscustom-pageholographic-insert-plaques1"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498852-310.45811.6Quick TrophyPlaquesInsert1:14%,3:14%"Softball Awards"See this stunning Softball plaque and other Holographic Plaques at TrophyCentral.qsinplaq3dsoftballSoftball, Sportscustom-pagetrophies-softball1medals498553-Feb0.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this colorful Softball insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Softball, Sportscustom-pagetrophies-softball1medals498553-Feb0.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Softball insert medal with a personalized front rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Softball, Sportscustom-pagecherry-insert-plaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these softball insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Softball, Sportscustom-pagetrophies-softball489634497659507391504531softball-ei1trophies-softball1"Softball Medals"See these Softball Inserts discounted at TrophyCentral. Each Softball Insert measures 2" and can be used in medals, trophies and plaques.Softball Medal Insert Awards If you are looking for a budget-friendly alternative to trophies, our softball insert medals are the perfect solution. Many softball medals come in gold, silver and bronze finishes and offer optional engraving to keep the price as low as possible. Be sure to check out our 1 1/4 Inch Medals and our Custom Ring Medals. All of our medals include a neck ribbon, and many offer a choice of ribbon color. Without engraving, your order will typically ship in just 1-2 business days, so no need to worry if you have waited for the last minute.]]>custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these high-quality Softball Inserts (497659) at TrophyCentral. Each Softball Inserts (497659) can be used to create a unique plaque, medal or trophy.497659Softball, Sports
custom-pagetrophies-softball1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our softball insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - SoftballSoftball, Sportscustom-pagetrophies-softball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%,25:23%,50:29%,100:34%"Softball Trophies" "Softball Trophy" "Trophies, Softball" "Softball Awards"Our Softball Player Participation Trophies feature a real slant-front white marble base and free personalization. Significant quantity discounts available.qtsoftncLooking for something a bit different? See morehere.trophies-softballSoftball, Sportscustom-pagetrophies-softball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.4234Quick TrophyTrophies11:14%,3:15%,10:16%"Softball Awards" "Softball Trophies"Find this Perpetual Softball Trophy Discounted at TrophyCentral. Each Trophy has enough room for 32 names. Ships in just 1-2 days.qtsoftperpSoftball, Sportscustom-pagekeychains21105502-40.39125035.39Classic MedallicsGiftsKeychains1:22%,10:25%,25:32%,50:39%,100:47%"Softball Awards"Find these popular Pewter Softball Key Chains at TrophyCentral; discounted prices!pk87-cm12-20-2020Keychainscustom-pagesports-pinsec04cl09cpx11Find softball pins discounted at TrophyCentral. Each softball pin features a clutch-pin back for easy and safe attachment to clothing and letters.trophies-softball softball-pinscustom-pagetrophies-softball1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Softball Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Softball, Sportscustom-pagecustom-pom-poms1muimse1100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Texas" "UPS (FedEx available on request)"7745310-1410.454811.97PepcoPromotional ProductsSpirit1Find These Solid Handle Advertising Poms and other Custom Poms at TrophyCentral.Spiritcustom-pagecolor-wall-plaques1"1-2 business days" "Marquette, MI" "UPS"plaques498852-310.51022.50Quick TrophyPlaquesColor Plaques1:14%,3:17%"New Products"Solid walnut wall-mount engraved plaque with choice of engraving plate. Price includes up to 13 lines of engraving. Horizontal, measures 10"x8". Shop today!10x8walnutsolidBlank, Generalcustom-pagecolor-wall-plaques1"1-2 business days" "Marquette, MI" "UPS"plaques498852-310.51034.50Quick TrophyPlaquesColor Plaques1:14%,3:17%"New Products"These beautiful 12 x 9 horizontal oriented plaques feature a fabulous walnut finish. Price includes free engraving. Fast 1-2 day shipping!12x9walnutsolidBlank, Generalcustom-pagecolor-wall-plaques1"1-2 business days" "Marquette, MI" "UPS"plaques498852-310.51013.50Quick TrophyPlaquesColor Plaques1:14%,3:17%"New Products"These beautiful 7 x 9 vertical plaques feature a fabulous walnut finish. Price includes personalization! Fast 1-2 day shipping!7x9walnutsolidBlank, Generalcustom-pagecolor-wall-plaques1"1-2 business days" "Marquette, MI" "UPS"plaques498852-310.51022.50Quick TrophyPlaquesColor Plaques1:14%,3:17%"New Products"Find these 8" x 10" solid walnut plaques discounted at TrophyCentral. Price includes free engraving! Optional full color logo.Blank, Generalcustom-pagecolor-wall-plaques1"1-2 business days" "Marquette, MI" "UPS"plaques498852-310.51034.50Quick TrophyPlaquesColor Plaques1:14%,3:17%"New Products"Find these beautiful 9 x 12 solid Walnut vertical oriented plaques discounted at TrophyCentral. Price includes free engraving!9x12walnutsolidBlank, Generalcustom-pagecolor-wall-plaques1"1-2 business days" "Marquette, MI" "UPS"plaques498852-310.51013.50Quick TrophyPlaquesColor Plaques1:14%,3:17%"New Products"These beautiful 9 x 7 (horizontal) plaques feature a fabulous walnut finish. Price includes free engraving! Fast 1-2 day shipping9x7walnutsolidBlank, Generalcustom-pagemusicartpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsMusic, Drama, Art, Dance1:22%,50:30%,100:33%,500:45%"Music Lapel Pins" "Band Lapel Pins" "Music Pins"Find These Sousaphone Lapel Pins Discounted at TrophyCentral. Features a Clutch-Pin Back and Fast 1-2 Day Shipping!mp910-13-2017Music / Band / Choruscustom-pagecrystalgifts6"7-10 business days" "Kentucky" "UPS (FedEx available on request)"personalized gifts410187-1010.45515.45JcharlesGiftsCrystal Gifts1:22%,100:22%"personalized gifts"A series of sparkling prism cuts encircling the perimeter creates a feeling of richness and depth with our Illuminate Paperweight. Made of optical crystal.54Crystal Giftscustom-pageachievement-pins1"1-2 business days" "Columbia, SC"lapel pins292121-31 2 3 230.4150030.4Certificate Sourcelapel-award-pinsGeneral1:22%,50:28%,100:32%,500:36%"Achievement Award" "Achievement Awards"Find These Sparkling and Colorful Star-Shaped Achievement Pins at Discounted TrophyCentral.custom-pagemascot-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Spartan Mascot Badges Discounted At TrophyCentral.mascotbadges-spartancustom-pagecorporatepins1plasticpinboxvelapinbox5"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsBusiness1:30%,50:32%,100:35%,500:39%"Employee Lapel Pins" "Corporate Lapel Pins"Find this US Air Force Pin at TrophyCentral. US Air Force and other pins ship in just 1-2 business days!spawlapinBusinesscustom-pagedebate-medals-pins12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsGeneral1:22%Buy these high-quality Speaker's Award Inserts at TrophyCentral. Each Speaker's Award Insert can be used to create a unique plaque, medal or trophy.518760General
custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsGeneral1:22%Buy these high-quality Special Achievement Award at TrophyCentral. Each Special Achievement Award can be used to create a unique plaque, medal or trophy.518288General, Business, Leadership
custom-page10-unique-pickleball-awards1appreciation-templates"Download Only"free-appreciation49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"See this Special Achievement Certificate designed exclusively for TrophyCentral! Special Achievement Certificates can be downloaded for free! Each Achievement Certificate measures 11 x 8 1/2 inches.specialAchievementcustom-pagewalnut-insert-plaques1"3-6 business days with engraving, Without engraving: 1-3 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"plaques105503-610.4511219.65Classic MedallicsPlaquesInsert1:22%,3:24%,5:27%Genuine Walnut Special Achievement Award Plaque with 2 Inch Insert and Free Engraving.51-8288Volunteercustom-pageeawardmedals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsGeneral1:22%,100:28%,500:34%,1000:45%"Swimming Awards" "General Medals"These inexpensive 1 1/4 inch Special Achievement Medals with a torch design, offer a high quality, but low price for those on a tight budget.e903502-09-2012General, Academic
custom-pageeawardmedals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsGeneral1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "School Medals"These inexpensive 1 1/4 inch Special Achievement Medals, with a Handshake Design, offer a high quality, but low price for those on a tight budget.e942306-20-2019General
custom-pageappreciation-templates1"Download Only"free-appreciation4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Special Person template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Special-Person-Certificatespecial-person-freeAchievement, Thank Youcustom-pageschool-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins"Find this Special Person Pin at TrophyCentral. Special Person and other pins ship in just 1-2 business days!br40512-20-2040General11These awards have been especially selected for their price and style. Each award includes engraving!custom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these quality Mylar Special Recognition Award Decal Inserts at TrophyCentral. Each decal can be used to create a unique plaque, medal or trophy.489903Achievement
custom-pageawardcertificates11certificates290631-31 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,25:24%,100:40%,500:50%Find these Printed Special Recognition certificates at TrophyCentral. Each Special Recognition certificate measures 11 x 8 1/2 inches.918Generalcustom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceCertificates / CoversEmbosser Seals1:22%,3:28%,5:31%Find these Special Recognition of Excellence Embossed Certificate Seals discounted at TrophyCentral. Seals are easy to apply with a pressure-sensitive backing.803sreGeneralcustom-pageawardcertificates11certificates290631-31 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,25:24%,100:40%,500:50%Find these Special Recognition Cow Certificates discounted at TrophyCentral. Each Special Recognition Cow Certificate measures 8 1/2" x 11".966Academiccustom-pageachievement-medals102-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.5115014Classic Medallicsaward-medalsAcademic1:22%,25:24%,50:30%,100:36%,500:42%"School Medals" "School Award Medals" "Scholastic Medals" "Scholastic Award Medals" "Academic Medals" "Academic Award Medals" "Medals, School"Your students will love these colorful Mylar Special Recognition Medals from TrophyCentral. Each Special Recognition medal includes a neck ribbon!tm990307-22-2015General, Academic
custom-pageachievement-certificates-awards1"Download Only"free-academic4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Special Student template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Special-Student-Certificatespecial-student-freeAchievement, Academiccustom-pageachievement-certificates-awards1"Download Only"free-academic49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our special teacher template (female) is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-female-special-teacher-certificatefemale-special-teacher-freeAcademic, Teacher Appreciation, Appreciationcustom-pageachievement-certificates-awards1"Download Only"free-academic49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our special teacher template (male) is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-male-special-teacher-certificatemale-special-teacher-freeTeacher, Appreciation, Academiccustom-pageteacher-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"Find Special Teacher pins discounted at TrophyCentral. Each Special Teacher lapel pin features a quality clutch-back. Fast 1-2 day shipping.br297Teacher's Award, Academiccustom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsGeneral1:22%Buy these high-quality Special Thanks Inserts at TrophyCentral. Each Special Thanks Insert can be used to create a unique plaque, medal or trophy.518726General, Volunteer, Thank You
custom-pagevolunteerpinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"Find these Special Thanks pins discounted at TrophyCentral. Each Special Thanks lapel pin features a gold finish and clutch-back. Fast 1-2 day shipping!br559Volunteer, Thank You, Generalcustom-pagemath-medalsspelling-plaque-ispelling1trophies-academic1"Spelling Awards"Spelling bee trophies, medals, and awards for classroom, school, and district competitions. Free engraving, fast 1–2 day production. Shop now at TrophyCentral. spelling bee trophies, spelling bee trophy, spelling bee awards, spelling bee trophies and awards

Custom Spelling Bee Trophies & Awards - Honor Academic Achievement

Trophy Central offers a huge selection across all categories, including medals, at discounted prices and with knowledgeable customer service. Our team of experts is always ready to help you find the right awards for your event. Browse our selection and add your favorite spelling awards to your cart today!

Frequently Asked Questions About Spelling Bee Trophies

What types of spelling bee trophies do you offer?

Our collection includes traditional column trophies, spelling-themed resin awards featuring designs like open books, stars, and alphabet motifs, and sleek modern styles suited for all age groups. Whether you need a compact 6-inch participation trophy for a classroom bee or an impressive 18-inch champion's column for a district-wide competition, we have options to fit every event and budget. Browse our trophy shop to compare styles and sizes.

How fast can I receive my spelling bee trophies and medals?

Most spelling bee trophies and medals ship within one to two business days after your order is placed. If you are working toward a specific competition date, check the estimated delivery time at checkout and reach out to our team if you need help planning your order timeline.

Can I personalize my spelling bee trophies?

Yes, all of our spelling bee trophies come with free engraving. You can add the recipient's name, placement, competition name, school name, and event date to create a truly personalized keepsake. For example: Emma Johnson, First Place, Lincoln Elementary Spelling Bee, March 2026. Our streamlined engraving process helps keep turnaround times low without any added cost.

Do you offer bulk discounts for schools and competitions?

Yes, we offer discounts on bulk orders to help schools and organizers save more. Whether you are running a single-school bee or a district-wide competition with dozens of participants, contact us by phone or email for special pricing on larger orders. Many programs order a mix of medals for all participants and trophies for top finishers to maximize recognition while staying within budget.

If you need more information before deciding, see our expert resource section:
]]>
trophies
custom-pagequickshiptrophies-spelling1trophies498551-310.452429Trophies1Find this popular spelling insert trophy discounted at TrophyCentral. Features a real marble base, free engraving and fast shipping.spelling-cup-place-trophy-icustom-pagequickshiptrophies-spelling1trophies498551-310.452429Trophies1Find this popular Spelling trophy discounted at TrophyCentral. Features a real marble base, free engraving and fast shipping.spelling-cup-place-trophy-tccustom-pagequickshiptrophies-spelling11Creative spelling bee award ideas with engraving templates for competitions and classroom champions. From Word Wizard to Spelling Superstar, celebrate your spellers with meaningful recognition and free engraving.custom-pageachievement-certificates-awards1"Download Only"free-academic49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates" "Spelling Awards"See this Spelling Certificate designed exclusively for TrophyCentral! Spelling Certificates can be downloaded for free! Each Spelling Certificate measures 11 x 8 1/2 inches.spellingSpelling, Academiccustom-pageachievement-certificates-awards1"Download Only"free-academic4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Spelling template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Spelling-Certificatespelling-freeSpelling, Academiccustom-pagequickshiptrophies-spelling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451014.85Quick TrophyTrophiesAcademic1:14%,10:18%,50:22%,100:25%Find this popular spelling bee figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at trophyCentral. Ships in a fast 1-2 days!qtspellplSpelling, 1st / 2nd / 3rd / Etc.custom-pagemedallion-inserts-academic-medallion-inserts20medals498552-40.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful Spelling 2" Epoxy-covered insert decal discounted at TrophyCentral. Fast 1-2 day shipping.Spellingcustom-pagequickshiptrophies-spelling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesAcademic1:14%,10:18%,50:22%,100:25%This popular Spelling Bee trophy features a real marble base, column, figure and trim indicating year of award. Includes up to three lines of free engraving!qtspellyrSpellingcustom-pagespelling-pins-medalsplastic-pinbox-t5medals498551-30.550040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find our 3D Series gold spelling pin discounted at TrophyCentral. Fast 1-2 day shipping.6072024Spellingcustom-pagequickshiptrophies-spelling1trophies498552-311821.06TrophiesAcademic1Find this achievement cup trophy with spelling bee figure discounted at TrophyCentral. Includes free text engraving!cup-spell-pSpellingcustom-pagenew-tc-gold-medals1quickshiptrophies-spellingmedals498551-30.525033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Spelling Bee 2 1/4" Antique Gold Medal Discounted at TrophyCentral. Each medal features a free ribbon. Fast shipping!Spellingcustom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-30.3713003.37Classic MedallicsInsertsAcademic1:22%"Spelling Pins and Medals" "Award Medals" "School Medals" "Award Medals - All Subjects" "Spelling Bee Award" "Spelling Bee Awards" "Awards, Spelling Bee" "Spelling Bee Trophies" "Spelling Bee Trophy" "Spelling Awards" "Spelling Award" "Spelling Trophies" "Spelling Bee Medals" "Spelling Medals"Buy these quality Mylar Spelling Bee Award Decal Inserts at TrophyCentral. Each Spelling Bee Award Decal can be used to create a unique plaque, medal or trophy.489904Spelling
custom-pagequickshiptrophies-spelling1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Spelling Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Spellingcustom-pagequickshiptrophies-spelling1trophies498552-312421.33TrophiesAcademic1Find these spelling bee budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtspellscbSpellingcustom-pagequickshiptrophies-spelling1trophies498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Spelling insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-Spelling-InsertSpellingcustom-pagequickshiptrophies-spelling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75219Quick TrophyTrophiesAcademic1:14%,3:19%,10:27%Find this fabulous two-tier Spelling Bee Trophy discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtspellttSpellingcustom-pagequickshiptrophies-spelling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.215Quick TrophyTrophiesAcademic1:14%,3:19%,10:28%See this championship trophy with Spelling Bee Figure at TrophyCentral. Be sure to see all of our Spelling Bee Awards.qtspellttwSpellingcustom-pagequickshiptrophies-spelling1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Spelling single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - SpellingSpellingcustom-pagequickshiptrophies-spelling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesAcademic1:14%,10:18%,50:24%,100:28%Find these popular Spelling Bee Elite Series trophies discounted and with free personalization at TrophyCentral.qtspellscSpellingcustom-pagequickshiptrophies-spelling1trophies498551-311821.06TrophyCentraltrophies1Spellingcustom-pagequickshiptrophies-spelling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.05Quick TrophyTrophiesAcademic1:14%,10:18%Find Our Spelling Deluxe Platform Series Trophies Discounted at TrophyCentral. Real Marble Base; Free Personalization!qtspelldmSpellingcustom-pagequickshiptrophies-spelling1trophies498552-311218.84TrophiesAcademic1Find this unique cup trophy with Spelling Bee figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-spell-scbSpellingcustom-pagequickshiptrophies-spelling1trophies498551-310.71217.38trophies1Spellingcustom-pagespelling-pins-medalsplastic-pinbox-t10498551-30.5200040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find this Spelling Gold Enamel lapel pin discounted at TrophyCentral. Features a clutch-pin back for easy attachment to clothing.. Fast 1-2 day shipping.spelling-u-pbSpellingcustom-pagequickshiptrophies-spelling1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Spelling Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Spellingcustom-pagequickshiptrophies-spelling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.418Quick TrophyTrophiesAcademic1:14%,3:19%,10:24%Find these fabulous two-tier, 3-column champion Spelling Bee Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtspell3cSpellingcustom-pagequickshiptrophies-spelling1medals498552-30.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Colorful Spelling insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Spellingcustom-pagequickshiptrophies-spelling1medals498552-40.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Spelling insert medal With A Personalized Front Rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Spellingcustom-pagequickshiptrophies-spelling1perpetual trophies498551-31434TrophyCentralTrophies1Find this Perpetual Spelling Trophy Discounted at TrophyCentral. Each Trophy has enough room for 32 names. Ships in just 1-2 days.custom-pagecherry-insert-plaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these spelling insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Spellingcustom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Spelling Pins and Medals" "Award Medals" "School Medals" "Award Medals - All Subjects" "Spelling Awards" "Spelling Medals"Buy these quality Spelling Bee Inserts (Litho) at TrophyCentral. Each Spelling Bee Insert can be used to create a unique plaque, medal or trophy.496090Spelling
custom-pagequickshiptrophies-spellingcomsoonecsch10br381 comsoonecsch scholmed2-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.5115014Classic Medallicsaward-medalsAcademic1:22%,25:24%,50:30%,100:36%,500:42%"Spelling Pins and Medals" "School Medals" "School Award Medals" "Scholastic Medals" "Scholastic Award Medals" "Academic Medals" "Academic Award Medals" "Medals, School" "Spelling Bee Award" "Spelling Bee Awards" "Awards, Spelling Bee" "Spelling Bee Trophies" "Spelling Bee Trophy" "Spelling Awards" "Spelling Award" "Spelling Trophies" "Spelling Bee Medals" "Spelling Medals"Your students will love these colorful Mylar Spelling Bee Medals from TrophyCentral. Each Spelling Bee medal includes a neck ribbon!quickshiptrophies-spellingSpelling
custom-pagequickshiptrophies-spelling1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our spelling insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - SpellingSpellingcustom-pagequickshiptrophies-spelling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453633.4Quick TrophyTrophiesSchool11:14%,10:17%,25:23%,50:29%,100:34%Our popular spelling bee participation trophies feature a real slant-front marble base and free engraving. Fast 1-2 day shipping.Spellingcustom-pagequickshiptrophies-spelling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.4234Quick TrophyTrophies1:14%,3:15%,10:16%Find this Perpetual Spelling Bee Trophy Discounted at TrophyCentral. Each Trophy has enough room for 32 names. Ships in just 1-2 days.qtspellperpSee more greatin other unique styles.quickshiptrophies-spellingSpellingcustom-pagespelling-pins-medalsplastic-pinbox-t5lapel pins498551-20.550040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find this Spelling Gold Enamel lapel pin discounted at TrophyCentral. Features a clutch-pin back for easy attachment to clothing.. Fast 1-2 day shipping.spelling-u-pbSpellingcustom-pagequickshiptrophies-spelling1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Spelling Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Spellingcustom-pagetm9904plasticpinboxvelapinbox10ap83 em17 tm9904"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"Spelling Pins and Medals" "Spelling Bee Award" "Spelling Bee Awards" "Awards, Spelling Bee" "Spelling Bee Trophies" "Spelling Bee Trophy" "Spelling Awards" "Spelling Award" "Spelling Trophies" "Spelling Bee Medals" "Spelling Medals" "School Pins"Find these Spelling Whiz Pins discounted at TrophyCentral. Spelling award pins feature a quality clutch back and ship in 1-2 days. Large quantity discounts.br38104-15-2020Spellingcustom-pagespelling-pins-medalsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:28%,100:32%,500:42%"School Pins" "Spelling Pins and Medals" "Spelling Medals and Pins"Find Spelling pins at TrophyCentral. Each AP Series Spelling pin includes a clutch back.ap83Spelling11Order custom spelling medals with free ribbon - ideal for spelling bees, academic awards, and schools. Fast processing and bulk pricing at TrophyCentral.

Honor Spelling Excellence with Custom Medals

At TrophyCentral, our spelling medals are designed to recognize hard work, knowledge, and academic achievement. Whether you're organizing a spelling bee, honoring classroom excellence, or celebrating reading milestones, our medals make every achievement memorable.

Available in timeless styles - from classic antique gold frames to vibrant epoxy dome inserts - each medal comes complete with a free red-white-blue ribbon and optional engraving on the back. Choose from budget-friendly options or standout designs, all available at volume pricing for schools and districts.

Be sure to also find see our Spelling Trophies section and our spelling resource guides:

Frequently Asked Questions (FAQ)

📖 What types of spelling medals do you offer?

Our spelling bee medals come in gold, silver, and bronze finishes, perfect for recognizing top performers in school and regional spelling competitions. Many designs feature books, letters, and bees to celebrate academic excellence.

🏆 Can I customize my spelling bee medals?

Yes! We offer custom engraving on most spelling medals, allowing you to add student names, competition dates, or school names. This makes them a perfect keepsake for spelling champions.

🚚 How fast can I receive my spelling medals?

Most spelling medals ship within 1-2 business days. If you need them quickly, select expedited shipping at checkout to ensure they arrive before your spelling bee event.

]]>
custom-pagereadingpinsap83br381spelling-pbspelling-u-pb3d-spelling1school-pins1Find a great selection of spelling pins discounted at TrophyCentral. Each spelling lapel pin features a clutch back for easy attachment to clothing.Shop for Spelling Pins with Confidence at TrophyCentral! If you are looking to buy spelling lapel pins online, look no further! TrophyCentral has a great selection of awards for your spelling bees that will fit any budget. Be sure see our spelling medals and spelling trophies. We have great customer service. Our experts in New York and Michigan have been providing suggestions and guidance since 1999!]]>quickshiptrophies-spelling spelling-medalscustom-pagetrophies-baseball1trophies498552-310.451614.05Trophy CentralTrophiesSports, Hobby, Org, Livestock1Baseball Spinner Trophy with Column. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Baseball / T-Ball, Sportscustom-pagetrophies-basketball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451614.05Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,50:28%Spinner Trophy with Column - Basketball. Ideal for leagues, schools, and tournaments. Fast shipping.qtbaskspscSee our other fabuloustrophies-basketballBasketball, Sportscustom-pagetrophies-football1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452417.25Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,50:31%Spinner Participation Trophies - Football. Ideal for leagues, schools, and tournaments. Fast shipping.qtfootspncFootball, Sportscustom-pagetrophies-football1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451614.05Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,50:28%Spinner Trophy with Column - Football. Ideal for leagues, schools, and tournaments. Fast shipping.qtfootspscFootball, Sportscustom-pagetrophies-baseball1trophies498552-310.552417.35Trophy CentralTrophiesSports, Hobby, Org, Livestock1Spinner Participation Baseball Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Baseball / T-Ball, Sportscustom-pagetrophies-basketball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.452417.25Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,50:31%Spinner Participation Trophy - Basketball. Ideal for leagues, schools, and tournaments. Fast shipping.qtbaskspncBasketball, Sportscustom-pagetrophies-soccer1trophies498552-310.451614.05Trophy CentralTrophiesSports, Hobby, Org, Livestock1Spinning Soccer Ball Trophy with Column - Unique Soccer Award. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.09-15-2022Soccer, Sportscustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-gd-bk.3174mb-gd-grFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-gd-bk.3175mb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-gd-bk.3176mb-bz-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-bz-bk.3174mb-bz-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-bz-bk.3175mb-bz-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-bz-bk.3176mb-bz-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-sn-bk.3174mb-sn-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-sn-bk.3175mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-sn-bk.3176mb-bz-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-gd-bk.3174pb-gd-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-gd-bk.3175pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-gd-bk.3176mb-bz-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-bz-bk.3174pb-bz-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-bz-bk.3175pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-bz-bk.3176mb-bz-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-sn-bk.3174pb-sn-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-sn-bk.3175pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-sn-bk.3176mb-bz-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-gd-bk.3174wb-gd-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-gd-bk.3175wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-gd-bk.3176mb-bz-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-bz-bk.3174wb-bz-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-bz-bk.3175wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-bz-bk.3176mb-bz-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-sn-bk.3174wb-sn-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-sn-bk.3175wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-sn-bk.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-gd-bk.374mb-bz-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-gd-bk.375mb-gd-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-gd-bk.376mb-gd-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-bz-bk.374mb-bz-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-bz-bk.375mb-bz-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-bz-bk.376mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-sn-bk.374mb-bz-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-sn-bk.375mb-sn-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-sn-bk.376mb-sn-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-gd-bk.374pb-gd-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-gd-bk.375pb-gd-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-gd-bk.376pb-gd-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-bz-bk.374pb-bz-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-bz-bk.375pb-bz-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-bz-bk.376pb-bz-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-sn-bk.374pb-sn-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-sn-bk.375pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-sn-bk.376pb-sn-grFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-gd-bk.374wb-gd-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-gd-bk.375wb-gd-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-gd-bk.376wb-gd-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-bz-bk.374wb-bz-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-bz-bk.375wb-bz-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-bz-bk.376wb-bz-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-sn-bk.374wb-sn-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-sn-bk.375wb-sn-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-sn-bk.376wb-sn-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-gd-gr.3174mb-gd-grFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-gd-gr.3175mb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-gd-gr.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-bz-gr.3174mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-bz-gr.3175mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-bz-gr.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-sn-gr.3174mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-sn-gr.3175mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-sn-gr.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-gd-gr.3174pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-gd-gr.3175pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-gd-gr.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-bz-gr.3174pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-bz-gr.3175pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-bz-gr.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-sn-gr.3174pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-sn-gr.3175pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-sn-gr.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-gd-gr.3174wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-gd-gr.3175wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-gd-gr.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-bz-gr.3174wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-bz-gr.3175wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-bz-gr.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-sn-gr.3174wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-sn-gr.3175wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-sn-gr.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-gd-gr.374mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-gd-gr.375mb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-gd-gr.376mb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-bz-gr.374mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-bz-gr.375mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-bz-gr.376mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-sn-gr.374mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-sn-gr.375mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-sn-gr.376mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-gd-gr.374pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-gd-gr.375pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-gd-gr.376pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-bz-gr.374pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-bz-gr.375pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-bz-gr.376pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-sn-gr.374pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-sn-gr.375pb-sn-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-sn-gr.376pb-sn-grFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-gd-gr.374wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-gd-gr.375wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-gd-gr.376wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-bz-gr.374wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-bz-gr.375wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-bz-gr.376wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-sn-gr.374wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-sn-gr.375wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-sn-gr.376wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-gd-kg.3174mb-gd-grFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-gd-kg.3175mb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-gd-kg.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-bz-kg.3174mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-bz-kg.3175mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-bz-kg.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-sn-kg.3174mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-sn-kg.3175mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-sn-kg.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-gd-kg.3174pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-gd-kg.3175pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-gd-kg.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-bz-kg.3174pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-bz-kg.3175pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-bz-kg.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-sn-kg.3174pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-sn-kg.3175pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-sn-kg.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-gd-kg.3174wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-gd-kg.3175wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-gd-kg.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-bz-kg.3174wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-bz-kg.3175wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-bz-kg.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-sn-kg.3174wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-sn-kg.3175wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-sn-kg.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-gd-kg.374mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-gd-kg.375mb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-gd-kg.376mb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-bz-kg.374mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-bz-kg.375mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-bz-kg.376mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-sn-kg.374mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-sn-kg.375mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-sn-kg.376mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-gd-kg.374pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-gd-kg.375pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-gd-kg.376pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-bz-kg.374pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-bz-kg.375pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-bz-kg.376pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-sn-kg.374pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-sn-kg.375pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-sn-kg.376pb-sn-grFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-gd-kg.374wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-gd-kg.375wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-gd-kg.376wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-bz-kg.374wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-bz-kg.375wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-bz-kg.376wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-sn-kg.374wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-sn-kg.375wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-sn-kg.376wb-sn-bkFloor-Standingcustom-pagegeneral-corporate-awards1606307-101 3 235233RS Owens1The exuberant spirit of these awards are a synthesis of metal and crystal. Choose from silver or 24k gold on a black nickel base.custom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-gd-mn.3174mb-gd-grFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-gd-mn.3175mb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-gd-mn.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-bz-mn.3174mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-bz-mn.3175mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-bz-mn.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-sn-mn.3174mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-sn-mn.3175mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-sn-mn.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-gd-mn.3174pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-gd-mn.3175pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-gd-mn.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-bz-mn.3174pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-bz-mn.3175pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-bz-mn.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-sn-mn.3174pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-sn-mn.3175pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-sn-mn.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-gd-mn.3174wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-gd-mn.3175wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-gd-mn.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-bz-mn.3174wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-bz-mn.3175wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-bz-mn.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-sn-mn.3174wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-sn-mn.3175wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-sn-mn.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-gd-mn.374mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-gd-mn.375mb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-gd-mn.376mb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-bz-mn.374mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-bz-mn.375mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-bz-mn.376mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-sn-mn.374mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-sn-mn.375mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-sn-mn.376mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-gd-mn.374pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-gd-mn.375pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-gd-mn.376pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-bz-mn.374pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-bz-mn.375pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-bz-mn.376pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-sn-mn.374pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-sn-mn.375pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-sn-mn.376pb-sn-grFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-gd-mn.374wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-gd-mn.375wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-gd-mn.376wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D . Model: 374wb-bz-mn.374wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-bz-mn.375wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-bz-mn.376wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-sn-mn.374wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-sn-mn.375wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-sn-mn.376wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-gd-ny.3174mb-gd-grFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-gd-ny.3175mb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-gd-ny.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-bz-ny.3174mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-bz-ny.3175mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-bz-ny.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-sn-ny.3174mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-sn-ny.3175mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-sn-ny.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-gd-ny.3174pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-gd-ny.3175pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-gd-ny.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-bz-ny.3174pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-bz-ny.3175pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-bz-ny.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-sn-ny.3174pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-sn-ny.3175pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-sn-ny.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-gd-ny.3174wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-gd-ny.3175wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-gd-ny.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-bz-ny.3174wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-bz-ny.3175wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-bz-ny.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-sn-ny.3174wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-sn-ny.3175wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-sn-ny.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-gd-ny.374mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-gd-ny.375mb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-gd-ny.376mb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-bz-ny.374mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-bz-ny.375mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-bz-ny.376mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-sn-ny.374mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-sn-ny.375mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-sn-ny.376mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-gd-ny.374pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-gd-ny.375pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-gd-ny.376pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-bz-ny.374pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-bz-ny.375pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-bz-ny.376pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-sn-ny.374pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-sn-ny.375pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-sn-ny.376pb-sn-grFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-gd-ny.374wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-gd-ny.375wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-gd-ny.376wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-bz-ny.374wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-bz-ny.375wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-bz-ny.376wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-sn-ny.374wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-sn-ny.375wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-sn-ny.376wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-gd-or.3174mb-gd-grFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-gd-or.3175mb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-gd-or.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-bz-or.3174mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-bz-or.3175mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-bz-or.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-sn-or.3174mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-sn-or.3175mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-sn-or.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-gd-or.3174pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-gd-or.3175pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-gd-or.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-bz-or.3174pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-bz-or.3175pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-bz-or.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-sn-or.3174pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-sn-or.3175pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-sn-or.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-gd-or.3174wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-gd-or.3175wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-gd-or.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-bz-or.3174wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-bz-or.3175wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-bz-or.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-sn-or.3174wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-sn-or.3175wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-sn-or.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-gd-or.374mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-gd-or.375mb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-gd-or.376mb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-bz-or.374mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-bz-or.375mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-bz-or.376mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-sn-or.374mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-sn-or.375mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-sn-or.376mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-gd-or.374pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-gd-or.375pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-gd-or.376pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-bz-or.374pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-bz-or.375pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-bz-or.376pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-sn-or.374pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-sn-or.375pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-sn-or.376pb-sn-grFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-gd-or.374wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-gd-or.375wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-gd-or.376wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-bz-or.374wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-bz-or.375wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-bz-or.376wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-sn-or.374wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-sn-or.375wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-sn-or.376wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-gd-pe.3174mb-gd-grFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-gd-pe.3175mb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-gd-pe.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-bz-pe.3174mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-bz-pe.3175mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-bz-pe.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-sn-pe.3174mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-sn-pe.3175mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-sn-pe.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-gd-pe.3174pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-gd-pe.3175pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-gd-pe.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-bz-pe.3174pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-bz-pe.3175pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-bz-pe.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-sn-pe.3174pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-sn-pe.3175pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-sn-pe.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-gd-pe.3174wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-gd-pe.3175wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-gd-pe.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-bz-pe.3174wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-bz-pe.3175wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-bz-pe.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-sn-pe.3174wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-sn-pe.3175wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-sn-pe.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-gd-pe.374mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-gd-pe.375mb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-gd-pe.376mb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-bz-pe.374mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-bz-pe.375mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-bz-pe.376mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-sn-pe.374mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-sn-pe.375mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-sn-pe.376mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-gd-pe.374pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-gd-pe.375pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-gd-pe.376pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-bz-pe.374pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-bz-pe.375pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-bz-pe.376pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-sn-pe.374pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-sn-pe.375pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-sn-pe.376pb-sn-grFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-gd-pe.374wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-gd-pe.375wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-gd-pe.376wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-bz-pe.374wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-bz-pe.375wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-bz-pe.376wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-sn-pe.374wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-sn-pe.375wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-sn-pe.376wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-gd-rd.3174mb-gd-grFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-gd-rd.3175mb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-gd-rd.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-bz-rd.3174mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-bz-rd.3175mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-bz-rd.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-sn-rd.3174mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-sn-rd.3175mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-sn-rd.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-gd-rd.3174pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-gd-rd.3175pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-gd-rd.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-bz-rd.3174pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-bz-rd.3175pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-bz-rd.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-sn-rd.3174pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-sn-rd.3175pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-sn-rd.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-gd-rd.3174wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-gd-rd.3175wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-gd-rd.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-bz-rd.3174wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-bz-rd.3175wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-bz-rd.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-sn-rd.3174wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-sn-rd.3175wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-sn-rd.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-gd-rd.374mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-gd-rd.375mb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-gd-rd.376mb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-bz-rd.374mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-bz-rd.375mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-bz-rd.376mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-sn-rd.374mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-sn-rd.375mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-sn-rd.376mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-gd-rd.374pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-gd-rd.375pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-gd-rd.376pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-bz-rd.374pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-bz-rd.375pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-bz-rd.376pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-sn-rd.374pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-sn-rd.375pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-sn-rd.376pb-sn-grFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-gd-rd.374wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-gd-rd.375wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-gd-rd.376wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-bz-rd.374wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-bz-rd.375wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-bz-rd.376wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-sn-rd.374wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-sn-rd.375wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-sn-rd.376wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-gd-ry.3174mb-gd-grFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-gd-ry.3175mb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-gd-ry.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-bz-ry.3174mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-bz-ry.3175mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-bz-ry.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-sn-ry.3174mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-sn-ry.3175mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-sn-ry.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-gd-ry.3174pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-gd-ry.3175pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-gd-ry.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-bz-ry.3174pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-bz-ry.3175pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-bz-ry.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-sn-ry.3174pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-sn-ry.3175pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-sn-ry.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-gd-ry.3174wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-gd-ry.3175wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-gd-ry.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-bz-ry.3174wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-bz-ry.3175wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-bz-ry.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-sn-ry.3174wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-sn-ry.3175wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-sn-ry.3176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-gd-ry.374mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-gd-ry.375mb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-gd-ry.376mb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-bz-ry.374mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-bz-ry.375mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-bz-ry.376mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-sn-ry.374mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-sn-ry.375mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-sn-ry.376mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-gd-ry.374pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-gd-ry.375pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-gd-ry.376pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-bz-ry.374pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-bz-ry.375pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-bz-ry.376pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-sn-ry.374pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-sn-ry.375pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-sn-ry.376pb-sn-grFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-gd-ry.374wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-gd-ry.375wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-gd-ry.376wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-bz-ry.374wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-bz-ry.375wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-bz-ry.376wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-sn-ry.374wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-sn-ry.375wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-sn-ry.376wb-sn-bkFloor-Standingcustom-pagedisplaycases13174mb-gd-rd3175mb-gd-rd3176mb-gd-rd374mb-gd-rd375mb-gd-rd376mb-gd-rd3174mb-gd-ny3175mb-gd-ny3176mb-gd-ny374mb-gd-ny375mb-gd-ny376mb-gd-ny3174mb-gd-bk3175mb-gd-bk3176mb-gd-bk374mb-gd-bk375mb-gd-bk376mb-gd-bk3174mb-gd-mn3174mb-gd-or3174mb-gd-pe3175mb-gd-mn3175mb-gd-or3175mb-gd-pe3176mb-gd-mn3176mb-gd-or3176mb-gd-pe374mb-gd-mn374mb-gd-or374mb-gd-pe375mb-gd-mn375mb-gd-or375mb-gd-pe376mb-gd-mn376mb-gd-or376mb-gd-pe3174mb-gd-gr3175mb-gd-gr3176mb-gd-gr374mb-gd-gr375mb-gd-gr376mb-gd-gr3174mb-gd-ry3175mb-gd-ry3176mb-gd-ry374mb-gd-ry375mb-gd-ry376mb-gd-ry3174mb-gd-kg3175mb-gd-kg3176mb-gd-kg374mb-gd-kg375mb-gd-kg376mb-gd-kg3174mb-bz-rd3175mb-bz-rd3176mb-bz-rd374mb-bz-rd375mb-bz-rd376mb-bz-rd3174mb-bz-ny3175mb-bz-ny3176mb-bz-ny374mb-bz-ny375mb-bz-ny376mb-bz-ny3174mb-bz-bk3175mb-bz-bk3176mb-bz-bk374mb-bz-bk375mb-bz-bk376mb-bz-bk3174mb-bz-mn3174mb-bz-or3174mb-bz-pe3175mb-bz-mn3175mb-bz-or3175mb-bz-pe3176mb-bz-mn3176mb-bz-or3176mb-bz-pe374mb-bz-mn374mb-bz-or374mb-bz-pe375mb-bz-mn375mb-bz-or375mb-bz-pe376mb-bz-mn376mb-bz-or376mb-bz-pe3174mb-bz-gr3175mb-bz-gr3176mb-bz-gr374mb-bz-gr375mb-bz-gr376mb-bz-gr3174mb-bz-ry3175mb-bz-ry3176mb-bz-ry374mb-bz-ry375mb-bz-ry376mb-bz-ry3174mb-bz-kg3175mb-bz-kg3176mb-bz-kg374mb-bz-kg375mb-bz-kg376mb-bz-kg3174mb-sn-rd3175mb-sn-rd3176mb-sn-rd374mb-sn-rd375mb-sn-rd376mb-sn-rd3174mb-sn-ny3175mb-sn-ny3176mb-sn-ny374mb-sn-ny375mb-sn-ny376mb-sn-ny3174mb-sn-bk3175mb-sn-bk3176mb-sn-bk374mb-sn-bk375mb-sn-bk376mb-sn-bk3174mb-sn-mn3174mb-sn-or3174mb-sn-pe3175mb-sn-mn3175mb-sn-or3175mb-sn-pe3176mb-sn-mn3176mb-sn-or3176mb-sn-pe374mb-sn-mn374mb-sn-or374mb-sn-pe375mb-sn-mn375mb-sn-or375mb-sn-pe376mb-sn-mn376mb-sn-or376mb-sn-pe3174mb-sn-gr3175mb-sn-gr3176mb-sn-gr374mb-sn-gr375mb-sn-gr376mb-sn-gr3174mb-sn-ry3175mb-sn-ry3176mb-sn-ry374mb-sn-ry375mb-sn-ry376mb-sn-ry3174mb-sn-kg3175mb-sn-kg3176mb-sn-kg374mb-sn-kg375mb-sn-kg376mb-sn-kg3174pb-gd-rd3175pb-gd-rd3176pb-gd-rd374pb-gd-rd375pb-gd-rd376pb-gd-rd3174pb-gd-ny3175pb-gd-ny3176pb-gd-ny374pb-gd-ny375pb-gd-ny376pb-gd-ny3174pb-gd-bk3175pb-gd-bk3176pb-gd-bk374pb-gd-bk375pb-gd-bk376pb-gd-bk3174pb-gd-mn3174pb-gd-or3174pb-gd-pe3175pb-gd-mn3175pb-gd-or3175pb-gd-pe3176pb-gd-mn3176pb-gd-or3176pb-gd-pe374pb-gd-mn374pb-gd-or374pb-gd-pe375pb-gd-mn375pb-gd-or375pb-gd-pe376pb-gd-mn376pb-gd-or376pb-gd-pe3174pb-gd-gr3175pb-gd-gr3176pb-gd-gr374pb-gd-gr375pb-gd-gr376pb-gd-gr3174pb-gd-ry3175pb-gd-ry3176pb-gd-ry374pb-gd-ry375pb-gd-ry376pb-gd-ry3174pb-gd-kg3175pb-gd-kg3176pb-gd-kg374pb-gd-kg375pb-gd-kg376pb-gd-kg3174pb-bz-rd3175pb-bz-rd3176pb-bz-rd374pb-bz-rd375pb-bz-rd376pb-bz-rd3174pb-bz-ny3175pb-bz-ny3176pb-bz-ny374pb-bz-ny375pb-bz-ny376pb-bz-ny3174pb-bz-bk3175pb-bz-bk3176pb-bz-bk374pb-bz-bk375pb-bz-bk376pb-bz-bk3174pb-bz-mn3174pb-bz-or3174pb-bz-pe3175pb-bz-mn3175pb-bz-or3175pb-bz-pe3176pb-bz-mn3176pb-bz-or3176pb-bz-pe374pb-bz-mn374pb-bz-or374pb-bz-pe375pb-bz-mn375pb-bz-or375pb-bz-pe376pb-bz-mn376pb-bz-or376pb-bz-pe3174pb-bz-gr3175pb-bz-gr3176pb-bz-gr374pb-bz-gr375pb-bz-gr376pb-bz-gr3174pb-bz-ry3175pb-bz-ry3176pb-bz-ry374pb-bz-ry375pb-bz-ry376pb-bz-ry3174pb-bz-kg3175pb-bz-kg3176pb-bz-kg374pb-bz-kg375pb-bz-kg376pb-bz-kg3174pb-sn-rd3175pb-sn-rd3176pb-sn-rd374pb-sn-rd375pb-sn-rd376pb-sn-rd3174pb-sn-ny3175pb-sn-ny3176pb-sn-ny374pb-sn-ny375pb-sn-ny376pb-sn-ny3174pb-sn-bk3175pb-sn-bk3176pb-sn-bk374pb-sn-bk375pb-sn-bk376pb-sn-bk3174pb-sn-mn3174pb-sn-or3174pb-sn-pe3175pb-sn-mn3175pb-sn-or3175pb-sn-pe3176pb-sn-mn3176pb-sn-or3176pb-sn-pe374pb-sn-mn374pb-sn-or374pb-sn-pe375pb-sn-mn375pb-sn-or375pb-sn-pe376pb-sn-mn376pb-sn-or376pb-sn-pe3174pb-sn-gr3175pb-sn-gr3176pb-sn-gr374pb-sn-gr375pb-sn-gr376pb-sn-gr3174pb-sn-ry3175pb-sn-ry3176pb-sn-ry374pb-sn-ry375pb-sn-ry376pb-sn-ry3174pb-sn-kg3175pb-sn-kg3176pb-sn-kg374pb-sn-kg375pb-sn-kg376pb-sn-kg3174wb-gd-rd3175wb-gd-rd3176wb-gd-rd374wb-gd-rd375wb-gd-rd376wb-gd-rd3174wb-gd-ny3175wb-gd-ny3176wb-gd-ny374wb-gd-ny375wb-gd-ny376wb-gd-ny3174wb-gd-bk3175wb-gd-bk3176wb-gd-bk374wb-gd-bk375wb-gd-bk376wb-gd-bk3174wb-gd-mn3174wb-gd-or3174wb-gd-pe3175wb-gd-mn3175wb-gd-or3175wb-gd-pe3176wb-gd-mn3176wb-gd-or3176wb-gd-pe374wb-gd-mn374wb-gd-or374wb-gd-pe375wb-gd-mn375wb-gd-or375wb-gd-pe376wb-gd-mn376wb-gd-or376wb-gd-pe3174wb-gd-gr3175wb-gd-gr3176wb-gd-gr374wb-gd-gr375wb-gd-gr376wb-gd-gr3174wb-gd-ry3175wb-gd-ry3176wb-gd-ry374wb-gd-ry375wb-gd-ry376wb-gd-ry3174wb-gd-kg3175wb-gd-kg3176wb-gd-kg374wb-gd-kg375wb-gd-kg376wb-gd-kg3174wb-bz-rd3175wb-bz-rd3176wb-bz-rd374wb-bz-rd375wb-bz-rd376wb-bz-rd3174wb-bz-ny3175wb-bz-ny3176wb-bz-ny374wb-bz-ny375wb-bz-ny376wb-bz-ny3174wb-bz-bk3175wb-bz-bk3176wb-bz-bk374wb-bz-bk375wb-bz-bk376wb-bz-bk3174wb-bz-mn3174wb-bz-or3174wb-bz-pe3175wb-bz-mn3175wb-bz-or3175wb-bz-pe3176wb-bz-mn3176wb-bz-or3176wb-bz-pe374wb-bz-mn374wb-bz-or374wb-bz-pe375wb-bz-mn375wb-bz-or375wb-bz-pe376wb-bz-mn376wb-bz-or376wb-bz-pe3174wb-bz-gr3175wb-bz-gr3176wb-bz-gr374wb-bz-gr375wb-bz-gr376wb-bz-gr3174wb-bz-ry3175wb-bz-ry3176wb-bz-ry374wb-bz-ry375wb-bz-ry376wb-bz-ry3174wb-bz-kg3175wb-bz-kg3176wb-bz-kg374wb-bz-kg375wb-bz-kg376wb-bz-kg3174wb-sn-rd3175wb-sn-rd3176wb-sn-rd374wb-sn-rd375wb-sn-rd376wb-sn-rd3174wb-sn-ny3175wb-sn-ny3176wb-sn-ny374wb-sn-ny375wb-sn-ny376wb-sn-ny3174wb-sn-bk3175wb-sn-bk3176wb-sn-bk374wb-sn-bk375wb-sn-bk376wb-sn-bk3174wb-sn-mn3174wb-sn-or3174wb-sn-pe3175wb-sn-mn3175wb-sn-or3175wb-sn-pe3176wb-sn-mn3176wb-sn-or3176wb-sn-pe374wb-sn-mn374wb-sn-or374wb-sn-pe375wb-sn-mn375wb-sn-or375wb-sn-pe376wb-sn-mn376wb-sn-or376wb-sn-pe3174wb-sn-gr3175wb-sn-gr3176wb-sn-gr374wb-sn-gr375wb-sn-gr376wb-sn-gr3174wb-sn-ry3175wb-sn-ry3176wb-sn-ry374wb-sn-ry375wb-sn-ry376wb-sn-ry3174wb-sn-kg3175wb-sn-kg3176wb-sn-kg374wb-sn-kg375wb-sn-kg376wb-sn-kg11 2 3 4 5 6 7 8 9 10 221Find Spirit Series Display Cases at TrophyCentral. Also see our great selection of engraved and personalized gifts!displaycases1floor-standing-edge floor-standing-colossuscustom-pagehigh-end-awards1"14 business days" "Erlanger, KY" "UPS"general410187-1010.451 2 3 4 5 6 7 8 9642.45JcharlesGeneral Awards1:22%,25:25%Find the Spiro Composition Award Discounted at TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.noindexed-items12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
498555-8.521
custom-pageappreciation-templates1"Download Only"free-academic49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Sponsorship Award template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Sponsorship-Award-Certificatesponsorship-award-freeSponsorship, Thank Youcustom-pageinsertplaquesqsinplaq1stqsinplaq2ndqsinplaq3dbaseballqsinplaq3dbasketballqsinplaq3dbowlingqsinplaq3dfootballqsinplaq3dsoccerqsinplaq3dsoftballqsinplaq3rdqsinplaqacqsinplaqacstarqsinplaqarcheryqsinplaqbaseballqsinplaqbasketballqsinplaqbassfishqsinplaqbmxqsinplaqbowlingqsinplaqcheerleadingqsinplaqcoachqsinplaqdartsqsinplaqfootballqsinplaqgolfqsinplaqhockeyqsinplaqkartqsinplaqmotocrossqsinplaqmusicqsinplaqpinewoodqsinplaqsoccerqsinplaqstockcarqsinplaqswimmingqsinplaqtennisqsinplaqtrackqsinplaqvictoryqsinplaqvolleyball11Find Sports Plaques Discounted at TrophyCentral. Each Holographic Sports Plaque Features Free Engraving. Fast shipping!custom-pagetrophy-award-guidesfun-guide-to-goat-awardscoach-resources-guidecar-show-awards-guidefun-event-guideyouth-sports-parent-guidesafe-sports-day1trophy-award-guides1Explore our extensive selection of sports and hobby recognition resource guides. Get detailed guidance and advice on recognition from the experts.custom-pagesports-award-hub103210331034103510361037103810391041104270199191certificates"1-3 business days" "Columbia, South Carolina; Marquette, Michigan" "UPS (FedEx available on request)"1"Quick-Ship Items" "Award Certificates and Diploma Covers" "Award Certificates and Diploma Holders" "Award Certificates and Diploma Frames" "Award Certificate and Diploma Holders" "Certificate and Diploma Holders" "Certificates and Frames" "Certificates and Diploma Holders" "Diploma Covers and Certificates" "Diploma Covers and Award Certificates" "Diploma Covers, Frames and Holders" "Diploma Covers, Frames, Holders and Certificates"Find sports award certificates discounted at TrophyCentral. Prove you're the MVP with a TrophyCentral's sports certificate. Titles include: baseball, football, soccer and more!

Printed Sports Certificates & Templates

This section includes a fabulous selection of high-quality, sports certificate templates. Each sports certificate measures a standard 11" x 8 1/2", is printed on 60 lb. paper and includes a place to write or print the athlete's name, event, date and more.

Shop with Ease at TrophyCentral!

If you are looking to buy online, look no further! TrophyCentral has a great selection that will fit any budget. Our top-rated representatives are happy to assist you with all of your sports and school certificate and award needs. Our experts in New York and Michigan have been providing suggestions and guidance since 1999!

]]>
custom-pagetrophies-football11"7-10 business days w/engraving" "Chicago, Illinois" "UPS (FedEx available on request)"trophies606307-101 3 230.45218.25RS Owens1:22%11Complete selection of sports awards, medals, and trophies for teams and leagues. Custom engraving. Perfect for championships, tournaments, and participation recognition.

Awards for Every Sport & Every Achievement

Whether you're recognizing championship victories, individual excellence, or team participation, our sports awards collection provides the perfect way to celebrate athletic achievement. We understand that every sport has its unique culture and traditions, which is why we offer specialized awards for dozens of activities - from traditional team sports to individual competitions.

Every sports award includes free personalization with team names, player names, dates, and achievements. Our experienced team works with coaches, league organizers, and tournament directors to provide bulk pricing, rush delivery, and custom design services. With over [X years] of experience in sports recognition, we help make your awards ceremony memorable and meaningful.

Why Choose Our Sports Awards?

  • Complete Selection: Trophies, medals, plaques, and ribbons for 50+ sports
  • Quality Guaranteed: Durable construction and professional craftsmanship
  • Free Engraving: Personalize every award at no additional cost
  • Fast Delivery: Rush options available for last-minute tournaments
  • Bulk Pricing: Special rates for teams, leagues, and large orders
  • Expert Support: Award specialists to help with selection and customization

Don't see your sport listed? We carry awards for virtually every athletic activity. Contact our awards team for personalized recommendations, or explore our Academic Awards for scholastic recognition.

Ready to honor your athletes? Browse our sports awards collection and create lasting memories that celebrate dedication, teamwork, and achievement. Every champion deserves recognition - let us help you provide it.

If you need more information before deciding, see our expert resource section: ]]>
11Check out this great infographic relating to sports awards. Add some fun to your next awards ceremony by sharing these fun facts and trivia.custom-pageinserts150668149783350458150432151608850739849320150151502471495291498111507413502711507591507401504215060115065715182575014715013614896015066714930115020805059415012615074155013915113415063615063715066615024515182205011615071295047815074065074005070375075015181895181794898535173345176685049215048915016915074115074105036315060415044315038615014315020415075575176544896565056315073924976495061715020795065015022915034149314150719250281150207450752350662150153497658489678507464507390507453506945502031489612498170492691507396507174489690501425066514928715073974929915176605046015056915023715060715067315062015066415057515065015069734928414896895018314976615075195072015021085021105019715075355017114898245015250259151840450744050429150663150255149766548971350718350428150308150706048964550706950741250419150419150389149323150321150441149322148963449765950739150453148962350740549819150729650264111Browse our huge selection of sports inserts - 2" discs that can be used to create unique insert medals, trophies and plaques.sports-pins1award-medals1
  • Sports Awards Resource Hub
  • Engraving FAQs
  • Planning Award Ceremonies That People Actually Remember
  • Medal Buying Guide
  • ]]>
    custom-pagegold-pins-lapelgold-starsrising-star-pbbaseballpinsbasketballlapelpinscheerleadingpinsfootballpinsgolfpinsmascotpinspickleball-u-pbsoccerpinsswimmingpinstennis-u-pbtrackpinsvolleyballpinssoftball-pinscl20ec28rdec22ec90ec12ec11ec70ec69cl50cl51cl54cl47cl87cl951lapel-award-pins1Our sports pins are sure to get some attention. Each sports pin is discounted and features a clutch back for easy attachment to clothing.Letter and Jacket Sports Pins The section above includes our large selection of gold finish and color letter pins, in many popular sports, perfect for JV and Varsity jackets. In addition to traditional sports pins, like baseball, soccer and football, we also have a wide variety of sports related pins, like MVP, All Star, Champs, Coach and many more. These are high-quality gold and color finish pins that feature a clutch-pin back for easy and safe attachment to clothing. Stock sports lapel pins are quick-ship items and leave the factory in just 1-2 business days and often the same day.

    Shop with Confidence at TrophyCentral!

    If you are looking to buy sports pins online, look no further! TrophyCentral has a great selection that will fit any budget. Our top-rated representatives are happy to assist you with all of your needs. Our experts in New York and Michigan have been providing suggestions and guidance since 1999!]]>
    qsinplaqarcheryqsinplaqbaseballqsinplaq3dbaseballqsinplaqbasketballqsinplaq3dbasketballqsinplaqbmxqsinplaqbowlingqsinplaq3dbowlingqsinplaqcheerleadingqsinplaqcoachqsinplaqdartsqsinplaqbassfishqsinplaqfootballqsinplaq3dfootballqsinplaqgolfqsinplaqkartqsinplaqmotocrossqsinplaqpinewoodqsinplaqsoccerqsinplaq3dsoccerqsinplaq3dsoftballqsinplaqstockcarqsinplaqswimmingqsinplaqtennisqsinplaqtrackqsinplaqvictoryqsinplaqvolleyballqsinplaqhockeyqsinplaq1stqsinplaq2ndqsinplaq3rd11Find Sports Plaques Discounted at TrophyCentral. Each Sports Plaque Includes a 4" Insert and Free Engraving. Fast 1-2 day shipping.Colorful Holographic Sports Emblem Plaques These handsome looking plaques feature colorful 2" inserts in a variety of sports designs. Each plaque includes free engraving. Use our industry-leading engraving wizard to format your text, or leave it to the Experts at TrophyCentral! Don't hesitate to call us if you have any questions. Our customer service experts will be thrilled to assist you. TrophyCentral has been delivering smiles since 1999!]]>sports-award-hubtrophies-archerytrophies-badmintontrophies-baseballtrophies-basketballtrophies-bicycle-cyclingtrophies-billiardstrophies-bmxtrophies-bocce-balltrophies-bowlingtrophies-boxingtrophies-cheerleading-spirittrophies-coachtrophies-crickettrophies-curlingtrophies-dartstrophies-disc-golftrophies-equestrian-horsetrophies-figure-skatingtrophies-bass-fishingtrophies-marlin-fishingtrophies-footballtrophies-hockey-goalietrophies-golftrophies-gymnasticstrophies-ice-hockeytrophies-golf-hole-in-onetrophies-karate-martial-artstrophies-lacrossetrophies-marksman-shooting-rifletrophies-mascottrophies-motocrosstrophies-paintballracing-trophies-awardstrophies-racquetballtrophies-roller-hockeyrunning-trophiestrophies-sailing-boattrophies-skateboardingtrophies-cross-country-skiingtrophies-downhill-skiingtrophies-snowboardingtrophies-snowmobiletrophies-soccertrophies-softballtrophies-swimming-divingtrophies-t-balltrophies-table-tennis-ping-pongtrophies-tennistorch-trophiestrophies-track-fieldtrophies-trap-skeet-shootingtrophies-volleyballtrophies-weightlifting-powertrophies-wrestlingquickshiptrophies-goatresin-trophiestr-resin-trophies1trophies1Shop quality sports trophies and awards for all sports and age groups. Find custom designs, fast shipping, and unbeatable value at TrophyCentral.Sports Awards Resource Hub. There you will find expert guides on a variety of award recognition topics, including: ]]>11Award ideas for spring youth baseball, softball, and T-ball leagues covering MVP, batting, pitching, sportsmanship, and participation. Budget tips for coaches and league organizers.11Go beyond the blue ribbon with creative spring festival award ideas. Celebrate every participant with trophies, perpetual plaques, and volunteer recognition that build lasting traditions.custom-pagegift-certificate-templates1"Download Only"certificates4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Gift Certificate template (design 1) is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.gift-certificate-design-1gift-certificate-a1Gift Certificate11Build an end-of-season track and field awards program that honors every runner, jumper, and thrower on your roster. Award ideas for sprints, distance, hurdles, field events, relays, and special recognition categories.custom-pagename-badges-tagswoyoulipr100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Square Badges Discounted At TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.namebadges-sqrcustom-pagedancemedals12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    medals105502-41130025Classic MedallicsInsertsMusic, Drama, Art, Dance1:22%"Award Medals" "Art / Dance / Drama Medals" "Award Medals - All Subjects" "Dance Awards"Buy these quality Square Dance Inserts (Litho) at TrophyCentral. Each Square Dance Insert can be used to create a unique plaque, medal or trophy.502611Dance
    custom-pagegeneral-corporate-awards1"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"458221512.0212.00Vision AwardsTrophies1:22%,26:41%Find this fabulous Cosmic World Award discounted at TrophyCentral. TrophyCentral is known for its top-rated customer service191custom-pagegeneral-corporate-awards1"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"4582215111 2 3 4 5 6 7 8 9622Vision AwardsTrophies11:22%,26:41%"Corporate Awards"custom-pagepersonalized-gifts11personalized gifts105503-610.4513620.25Classic MedallicsGiftsGeneral Gifts1:22%Find this Stainless Steel Tankard at TrophyCentral. Add Engraving to the Tankard for a Special Touch!Groomsmencustom-pagesoccerwaterbottles7107071084710797107623088230852308423077230325608856085560845603256077113841137011376113794107041076410844107911Find stainless steel water bottles discounted at TrophyCentral. Each stainless sports water bottle is personalized with your logo or artwork.

    Shop For Stainless Water Bottles With Confidence at TrophyCentral

    We offer a huge selection, discounted prices and great customer service. Do you need help with some ideas or with ordering? Yes, we sell online, but we have real people who would love to help you! Feel free to call our customer service experts in Michigan, New York and online. TrophyCentral - delivering smiles since 1999!


    ]]>
    custom-pagegifts-desk-general11personalized gifts105503-610.4511219.65Classic MedallicsGiftsEngraved Gifts1:30%Shop for Stainless Steel Wine Cooler from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.12-20-2020Engraved Giftscustom-pagephotoplaques11"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498552-310.451020.45TrophyCentral1:22%Engraved Gifts, Coachcustom-pagebest-moment-capturedstandout-coachshare-your-best-thank-you11The TrophyCentral Standout Awards honor coaches, teachers, neighbors, and photographers who make a difference every day. Submit a photo, nominate someone, or vote for your favorite. Winners receive a real engraved trophy.custom-pagestandout-awards11Know a coach who changed someone's life? Nominate them for the TrophyCentral Standout Coach Award. Community nominated, judge scored, and the winner receives a real engraved trophy. Nominations open now.1custom-pagestar-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsGeneral1:30%,50:34%,100:38%"Star Pins" "Star Lapel Pins" "Star Award Pins"br28011-15-2010Star, Generalcustom-pagestar-trophies11"7-10 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498553-510.4548.45RS OwensTrophies1:22%"Star Award" "Achievement Award" "Achievement Awards" "Graduation Award" "Music Awards" "Drama Awards" "General Recognition Awards" "Art Awards" "Star Awards" "Leadership Recognition" "Drama Trophies" "Drama Trophy"Star Achievement Award: Visit TrophyCentral to see this and similar Trophies and AwardsDrama, Starcustom-pageacrylicawards11"1-2 business days" "Marquette, MI" "UPS"general498852-310.451021.45Quick TrophyCrystal Awards1:14%"New Products"The star achiever award features a brilliant gold star. 6 1/2" tall black acrylic on gold base. Includes 3 lines of engraving.12-20-2020Generalcustom-pagestar-trophies11trophies105503-611.51823.9Classic MedallicsTrophiesGeneral1:22%,20:29%Find Our Star Blazer Trophy Discounted at TrophyCentral. Features a Black Stone Finish. Free Engraving!05-15-2017custom-pagestar-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsGeneral1:30%,50:34%,100:38%"Star Pins" "Star Lapel Pins" "Star Award Pins"Find these 3/8 inch star pins discounted at TrophyCentral. Each lapel pin features a quality clutch back. Large quantity discounts available.br290Star, Generalcustom-pagestar-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsGeneral1:30%,50:34%,100:38%"Star Pins" "Star Lapel Pins" "Star Award Pins"Find these 5/8 inch star pins discounted at TrophyCentral. Each lapel pin features a quality clutch back. Large quantity discounts available.br291Star, Generalcustom-pageblank-medals10medals498552-40.525033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%This medal features a unique star frame and a personalized front for your logo or artwork.Star1achievement-medals1Find star medals discounted at TrophyCentral. Each star medal includes a free neck ribbon. Fast 1-2 day shipping.custom-pagereligioustrophies1plaques498552-41JDSPlaques1Find this Star of David plaque discounted at TrophyCentral. Our Star of David plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Religiouscustom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsGeneral1:22%Buy these high-quality Star Of Excellence Inserts at TrophyCentral. Each Star Of Excellence Insert can be used to create a unique plaque, medal or trophy.518645General, Star
    custom-pagestar-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:34%,100:39%,500:43%"Star Pins" "Star Lapel Pins" "Star Award Pins"Find these Star of Excellence pins at TrophyCentral. Each Star of Excellence lapel pin features a quality finish and clutch back.br54803-20-2011General, Starcustom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsGeneral1:22%Buy these quality Star Performer (498150) Inserts (Litho) at TrophyCentral. Each Star Performer (498150) Insert can be used to create a unique plaque, medal or trophy.498150General, Star
    custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsGeneral1:22%Buy these quality Star Performer (507574) Inserts (Litho) at TrophyCentral. Each Star Performer (507574) Insert can be used to create a unique plaque, medal or trophy.507574General
    custom-pagestar-trophies1trophies498552-311622.85TrophiesMusic, Drama, Art, Dance1Find this popular star performer figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at trophyCentral. Ships in a fast 1-2 days!mqt-star-p-plDrama, Dance, Schoolcustom-pagetrophies-drama20medals498551-30.5100021TrophyCentralInsertsSports, Hobby, Org, Livestock1Find this colorful Star Performer 2" Epoxy-covered insert discounted at TrophyCentral. Fast 1-2 day shipping.Starcustom-pagestar-trophies1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Star Performer Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Starcustom-pagestar-trophies1trophies498552-312421.33TrophiesMusic, Drama, Art, Dance1Find these star performer budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqt-star-p-scbDrama, Dance, Schoolcustom-pageresin-trophies1498552-313633.4TrophiesMusic, Drama, Art, Dance1Find this budget star performer award trophy discounted at Trophy Central. Features a real marble base and plastic figure. Engraving is free. Fast 1-2 day shipping.star-trophiesDrama, Dance, Schoolcustom-pagestar-trophies1trophies498552-411229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find this star champion's cup trophy discounted at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's Cup - StarStarcustom-pagestar-trophies1trophies498551-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Star Performer insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Starcustom-pagestar-trophies1trophies498552-31219TrophiesMusic, Drama, Art, Dance1Find these fabulous two-tier Star Performer Three-Column Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!mqt-star-p-ttDrama, Dance, Schoolcustom-pagestar-trophies1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Star Performer single column insert trophy features a choice of column color, a marble base and free trophy engraving.Starcustom-pagestar-trophies1trophies498552-311623.65TrophiesMusic, Drama, Art, Dance1These quick-ship trophies from TrophyCentral feature a unique star design, real marble base and marble trophy figure platform. Fast 1-2 day shipping.mqt-star-p-dmDrama, Dance, Schoolcustom-pagestar-trophies1trophies498551-310.71217.38trophies1Starcustom-pagestar-trophies1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Star Performer Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Starcustom-pagestar-trophies1medals498551-30.525035.5TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find this colorful Star Performer insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Starcustom-pagestar-trophies1medals498551-30.525035.5TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find this Star Performer insert medal with a personalized front rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Starcustom-pagestar-trophies1plaques498551-311.11623.5TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these star performer insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Starcustom-pagestar-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsBusiness1:30%,50:32%,100:35%,500:39%"Star Awards" "Star Award"Find these Star Performer Pins discounted at TrophyCentral. Each Star Performer Lapel pin features a clutch-back. Be sure to browse all of our drama and music pins!br278General, Starcustom-pagestar-trophies12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    medals105503-60.75130033.75Classic Medallicsaward-medalsGeneral1:22%,100:28%,500:34%,1000:45%"Dance Medals" "Star Award" "General Award Medals" "Award Medals - All Subjects" "School Medals" "Music Awards" "General Recognition Awards" "Drama Awards" "Art Awards" "Art / Dance / Drama Medals" "Star Awards"These inexpensive 1 1/4 inch Star Performer Medals offer a high quality, but low price for those on a tight budget.e923110-01-2008General, Business, Academic
    custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsGeneral1:22%Buy these high-quality Star Performer Inserts (Etched, 517786) at TrophyCentral. Each Star Performer Inserts (Etched, 517786) can be used to create a unique plaque, medal or trophy.517786General, Star
    custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsGeneral1:22%Buy these high-quality Star Performer Inserts (Etched, 518367) at TrophyCentral. Each Star Performer Inserts (Etched, 518367) can be used to create a unique plaque, medal or trophy.518367General, Business
    custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-40.3713003.37Classic MedallicsInsertsGeneral1:22%Buy these quality Mylar Star Performer Decal Inserts at TrophyCentral. Each Star Performer Decal can be used to create a unique plaque, medal or trophy.489724Star
    custom-pagestar-trophies1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our star-performer insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Starcustom-pageresin-trophies1trophies498552-313633.4TrophiesMusic, Drama, Art, Dance1Our star performer participation trophies feature a real slant-front white marble base and free personalization. Significant quantity discounts available. Fast 1-2 shipping.mqt-star-p-ncDrama, Dance, Schoolcustom-pagestar-trophies1perpetual trophies498552-31234TrophiesMusic, Drama, Art, Dance1Find this Perpetual Star Performer Trophy Discounted at TrophyCentral. Each Trophy has enough room for 32 names. Ships in just 1-2 days.mqt-star-p-perpDrama, Dance, Schoolcustom-pagekeychains21105502-40.39125035.39Classic MedallicsGiftsKeychains1:22%,10:25%,25:32%,50:39%,100:47%"Star Awards" "Star Award"Find these popular Pewter Star Performer Key Chains at TrophyCentral; discounted prices!pk88-cmKeychainscustom-pagesports-pinsplasticpinboxvelapinbox10star-pins"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsGeneral1:22%,50:30%,100:33%,500:47%"Star Awards" "Dance Awards" "Star Award" "Dance Pins" "Dance Lapel Pins" "Drama Pins"Star Performer Letter Pins: EC Series Star Performer Lapel Pins feature a high-quality enameled finish and ship in just 1-2 business days!ec69Dramacustom-pagestar-pinsplasticpinboxvelapinbox5"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsBusiness1:30%,50:32%,100:35%,500:39%"Star Awards" "Star Award"Find these Star Performer pins discounted at TrophyCentral. Each Star Performer lapel pin features a gold finish and clutch-back.br36803-06-2008Star, Generalcustom-pagestar-pinsplasticpinboxvelapinbox1"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsGeneral1:30%,50:34%,100:38%"Dance Awards" "Dance Pins" "Dance Lapel Pins" "Drama Pins"Find these 7/8" star performer pins discounted at TrophyCentral. Each star performer pin features a clutch-back and fast 1-2 day shipping!br412Star, Generalcustom-pagestar-trophies1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Star Performer Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Starcustom-pagegold-pins-lapelsilver-starsbronze-starsbr280br583ec11ec12br592bbr592s1lapel-award-pins1

    Custom Star Pins and Awards - Recognize Every Achievement, Big and Small

    Star pins are one of the most versatile and cost-effective recognition tools available, giving teachers, employers, coaches, and program coordinators an easy way to celebrate achievement, encourage effort, and reinforce positive behavior on an ongoing basis. From elementary classrooms where gold star pins reward completed homework, strong test scores, and outstanding effort, to corporate recognition programs where star performer and employee of the month pins build a culture of appreciation, from athletic programs where coaches recognize hustle and dedication beyond statistics, to military and community organizations where star pins mark service milestones and special accomplishments, quality star pins create visible, wearable recognition that motivates recipients long after the moment of presentation. Our versatile selection includes traditional gold star lapel pins in multiple sizes, raised and flat star designs in gold, silver, and bronze for recognizing different achievement levels, rising star and star performer pins ideal for standout recognition in school and workplace programs, and a wide range of specialty star shapes and finishes suited to every program and budget. Most orders ship in 1-2 business days with same-day shipping available on many styles.

    Frequently Asked Questions About Star Pins

    What is the difference between flat and raised star pin designs?

    Flat star pins offer a sleek, polished appearance with a smooth surface that photographs well and works equally well for classroom, corporate, and athletic recognition. Raised star pins feature a dimensional design with added height and texture that gives the pin a more substantial, premium look and feel. Both styles are constructed to the same quality standard with secure butterfly clutch or pin back attachments. The choice typically comes down to personal preference and program aesthetics rather than any difference in durability or wearability.

    What programs and occasions are star pins most commonly used for?

    Star pins are used across a remarkably wide range of recognition programs. In schools they are most commonly used for homework completion, academic achievement, perfect attendance, reading milestones, and classroom behavior recognition. In workplaces they recognize employee of the month, sales performance, years of service, and team accomplishments. Athletic programs use them to reward hustle, sportsmanship, and personal bests. Military and community organizations use star pins to mark service levels and special designations. Gold, silver, and bronze finish options make it easy to create tiered recognition systems where the pin color itself communicates the level of achievement.

    Do you offer bulk discounts on star pins?

    Yes, Trophy Central offers significant bulk discounts on star pins that scale with order quantity, making frequent recognition affordable for classrooms, workplaces, and programs of any size. Teachers ordering gold stars for an entire semester of classroom rewards, coordinators purchasing assorted gold, silver, and bronze pins for a tiered recognition program, and employers buying star performer pins for company-wide recognition all benefit from bulk pricing. Browse our full selection of star pins above to find the styles and finishes that fit your program best.

    If you need more information before deciding, see our expert resource section:
    ]]>
    star-trophies star-medals
    custom-pageplaques11"2-4 business days" "Marquette, MI" "UPS"plaques498552-410.451016.45JDS-SPlaquesBlank Plaques1:30%,2:33%,10:38%"New Products"Find star plaques discounted at TrophyCentral. Each star plaque features free a beautiful wood finish, free engraving and fast 1 to 2 day shipping.Blank, Generalcustom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceCertificates / CoversEmbosser Seals1:22%,3:28%,5:31%Find these Star Certificate Seals discounted at TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.803stGeneralcustom-pagename-badges-tagswoyoulipr100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Star Shaped Badges Discounted At TrophyCentral.namebadges-suncustom-pagetrophies-cheerleading-spirit1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.45169.5Tower RibbonTrophies1:14%These Unique Star Shield Series Engraved Cheerleader Trophies Typically Ship in 1-2 Business Days!wssx60Cheerleading, Sportscustom-pagetrophies-go-kart1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.45169.5Tower RibbonTrophies1:14%These Unique Star Shield Series Engraved Go Kart Trophies Typically Ship in 1-2 Business Days!wss698Go Kartcustom-pagetrophies-swimming-diving1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.45169.5Tower RibbonTrophies1:14%These Unique Star Shield Series Engraved Swimming Trophies Typically Ship in 1-2 Business Days!wssx7909-30-24Swimming / Diving, Sportscustom-pagetrophies-wrestling1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.45169.5Tower RibbonTrophies1:14%These Unique Star Shield Series Engraved Wrestling Trophies Typically Ship in 1-2 Business Days!wssx71Wrestling, Sportscustom-pageachievement-certificates-awards1"Download Only"free-academic4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Star Student Award template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Star-Student-Award-Certificatestar-student-award-freeAcademic, Studentcustom-pageall-star-trophiesstar-performer-plaque-irising-star-plaque-istar-performer-eirising-star-ei1achievement-trophies-awards1Star trophies in multiple sizes with free engraving and logos. Competitive pricing. Fast 1-2 day shipping. Honor champions with quality star awards. Shop now!Custom Star Trophies & Awards - Recognize Every Standout Performance

    Our eye-catching star-shaped trophies feature brilliant designs that symbolize excellence and outstanding performance across all fields. Each star trophy showcases meticulous craftsmanship with polished finishes that reflect light beautifully, creating an impressive display piece.

    The versatile star motif works perfectly for corporate recognition, academic achievements, sports victories, and special milestone celebrations. Available in multiple sizes and configurations, these awards honor champions across every industry and achievement level.

    Premium Materials & Customization Options

    Choose from high-quality crystal, metal, and acrylic materials available in multiple sizes with transparent pricing to fit any budget to suit your specific recognition needs and budget requirements.

    Every star trophy includes complimentary personalization services, allowing you to add custom text, names, dates, and company logos to create personalized awards with professional precision. Our expert engraving team ensures your message is perfectly crafted to create a lasting memento of achievement.

    Why Buy Star Trophies from Trophy Central?

    Trophy Central offers an unmatched variety of star trophies with competitive price points and clear pricing on all sizes and fast 1-2 day shipping to meet your urgent deadlines. Our experienced team provides personalized engraving assistance and expert guidance to help you select the perfect awards to honor your champions.

    With decades of trusted service and thousands of satisfied customers, we guarantee exceptional quality and complete satisfaction with every order. From budget-friendly options to premium star trophies, our extensive selection of awards ensures you'll find exactly what you need to recognize your teams in style.

    Order Your Star Trophy Today

    Browse our complete collection of star trophies and customize your perfect recognition solution with just a few clicks online. Compare prices across our full variety of sizes and styles to find the best fit for honoring your champions.

    Take advantage of our quick turnaround times and satisfaction guarantee to ensure your awards ceremony is absolutely memorable. Don't wait! Honor your deserving champions with beautiful star trophies and medals that will be treasured for years to come.

    Frequently Asked Questions

    What personalization options are available for star trophies?

    All-star trophies include free engraving for names, dates, achievements, and company logos. Our skilled engraving team can accommodate custom text layouts and special formatting requests to create the perfect personalized star award.

    How quickly can star trophies be shipped?

    Most star trophies and awards in all sizes ship within 1-2 business days after order confirmation. Rush delivery options are available for urgent deadlines, ensuring your awards arrive exactly when you need them.

    Are bulk discounts available for large orders?

    Yes, we offer attractive volume pricing on star trophies and star medals for bulk orders. Contact our sales team for custom quotes on large quantities, and we'll work with your budget to provide the best possible pricing.

    What sizes are available for star trophies?

    Our star trophies range from compact desktop awards to impressive, large presentation pieces. Multiple size options ensure you'll find the best star trophy to match your ceremony's importance and budget requirements.

    ]]>
    trophies star-pins trophies-victory
    custom-pagemedallion-inserts-general-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these quality Star With Handshake Inserts (Litho) at TrophyCentral. Each Star With Handshake Insert can be used to create a unique plaque, medal or trophy.507472General
    custom-pagevolunteerpinsplasticpinboxvelapinbox10105502-30.31150030.3Classic Medallicslapel-award-pins11:22%,50:30%,100:33%,500:47%Find These Star-Shaped Volunteer Lapel Pins Discounted At TrophyCentral. Each Volunteer Pin Features A Clutch-Back. Fast 1-2 Day Shipping!Volunteer-HeartVolunteercustom-pagename-badges-tagswoyoulipr100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Starburst Badges Discounted At TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.namebadges-star11"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)""PC10=458221510.45319.95Vision AwardsTrophies1:22%,25:28%"Star Awards" "General Recognition Awards" "Star Award"The Starphire Award features glass with black crystal star accent and base. Includeds etching. Available in 2 sizes.12-20-2040custom-page3-4-stars-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsGeneral1:22%,50:25%,100:29%,500:32%"Star Pins" "Star Lapel Pins" "Star Award Pins"Find this Stars - 3/4 Inch Gold Pin at TrophyCentral. Stars - 3/4 Inch Gold and other pins ship in just 1-2 business days!br199gStar, General11From blue ribbons for every entry to Grand Champion trophies for your top livestock and project winners, here are the county fair and 4-H award ideas that match the effort these kids actually put in.custom-pagemedallion-inserts-government-agencies-and-logos12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsHero1:22%"Award Medals" "Award Medals - All Subjects" "Medals - All Others"Buy these high-quality State Seal Of California Inserts at TrophyCentral. Each State Seal Of California Insert can be used to create a unique plaque, medal or trophy.515769General
    custom-pagemedallion-inserts-government-agencies-and-logos12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsHero1:22%"Award Medals" "Award Medals - All Subjects" "Medals - All Others"Buy these high-quality State Seal Of Florida Inserts at TrophyCentral. Each State Seal Of Florida Insert can be used to create a unique plaque, medal or trophy.51761512-20-2020General
    custom-pagemedallion-inserts-government-agencies-and-logos12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsHero1:22%"Award Medals" "Award Medals - All Subjects" "Medals - All Others"Buy these high-quality State Seal Of Pennsylvania Inserts at TrophyCentral. Each State Seal Of Pennsylvania Insert can be used to create a unique plaque, medal or trophy.5176137-15-2011General
    custom-pagemedallion-inserts-government-agencies-and-logos12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsHero1:22%"Award Medals" "Award Medals - All Subjects" "Medals - All Others"Buy these high-quality State Seal Of Texas Inserts at TrophyCentral. Each State Seal Of Texas Insert can be used to create a unique plaque, medal or trophy.517657General
    custom-pagemedallion-inserts-general-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these quality Statue Of Liberty Inserts (Litho) at TrophyCentral. Each Statue Of Liberty Insert can be used to create a unique plaque, medal or trophy.495335General
    custom-pagegeneral-corporate-awards11"15 business days w/engraving" "Kentucky" "UPS (FedEx available on request)"general410181510.45438.45J CharlesGeneral Awards1:22%,13:28%Find this Globe Trophy with a slender body at TrophyCentral This award is perfect for global recognition events.custom-pagebottles-st80"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14142014.8Glass AmericaPromotional ProductsSports / Water Bottles1:14%,640:26%Our custom red water bottle collection features retractable sipper straws with matching carabineers. Choice of imprint color choices. Buy bulk and save!11376Sports / Water Bottlescustom-pagebottles-st80"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14142014.8Glass AmericaPromotional ProductsSports / Water Bottles1:14%,640:26%Our custom steel gray water bottle features retractable sipper straw and matching carabineers. Choice of imprint color choices. Buy bulk and save!11370Sports / Water Bottlescustom-pagequickshiptrophies-steer1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Fabulous Steer Figure Place Trophy with 1st, 2nd or 3rd Place Trim, Marble Base and Free personalization. Ships in a fast 1-2 days!qtsteerplcustom-pagequickshiptrophies-steer1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find these popular Steer Figure year trim trophies discounted at TrophyCentral. Available in multiple sizes and includes free personalization. Features gold year of event trim.qtsteeryrcustom-pagequickshiptrophies-steer1trophies498852-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with steer figure discounted at TrophyCentral. Includes free text engraving!cup-steer-pcustom-pagequickshiptrophies-steer1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these steer figure budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtsteerscbcustom-pagequickshiptrophies-steer1498852-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Find this budget steer (cow) award trophy discounted at Trophy Central. Features a real marble base and plastic steer figure. Engraving is free. Fast 1-2 day shipping.quickshiptrophies-steercustom-pagequickshiptrophies-steer1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:26%Find these fabulous Steer Figure Winners Line Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qtsteerttcustom-pagequickshiptrophies-steer1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:28%See this championship trophy with a Steer figure at TrophyCentral. Be sure to see all of our Steer figure awards.qtsteerttwcustom-pagequickshiptrophies-steer1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:21%,100:24%These popular Steer Figure Elite Series Trophies feature a choice of column size and color, a white marble base and free trophy personalization!custom-pagequickshiptrophies-steer1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.05Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%These quick-ship trophies from TrophyCentral feature a Steer figure, real marble base and marble trophy figure platform, choice of column size and color.custom-pagequickshiptrophies-steer1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Steer Figure figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-steer-scbcustom-pagequickshiptrophies-steer1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.4226Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:18%,10:23%Find these fabulous Steer Champions Line 3-Column Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qtsteer3ccustom-pagequickshiptrophies-steer1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:27%,100:32%Our popular Steer Figure participation trophies feature a real slant-front marble base and free engraving.qtsteernccustom-pagequickshiptrophies-rabbitqtsteerncqtsteerscqtsteerdmqtsteeryrqtsteerttqtsteerttwqtsteer3cqtsteerplmqtsteerscbcup-steer-scbcup-steer-pbdg-steer11Find Steer Trophies discounted at TrophyCentral. Each Steer (Cow) Trophy includes free engraving. Fast 1-2 day shipping.

    Shop with Confidence at TrophyCentral

    We offer a huge selection, discounted prices and top-rated customer service. Do you need help with some ideas or with ordering? Yes, we sell online, but we have real people who would love to help you! Feel free to call our customer service experts in Michigan, New York and online. TrophyCentral - delivering smiles since 1999!


    ]]>
    quickshiptrophies-goat quickshiptrophies-bull.html
    custom-pageperplaq1"4-6 business days "Marquette, MI" "UPS"plaques498553-610.45315.45JDS-SPlaquesPerpetual Plaques1:22%"Minuteman" "New Products"Walnut plaque (perpetual) with 12 nameplates. Includes header plate and first nameplate engraving.wpp1209-06-2014Perpetual, Name Platecustom-pageperplaq1"4-6 business days "Marquette, MI" "UPS"plaques498553-610.45321.45JDS-SPlaquesPerpetual Plaques1:22%"Minuteman" "New Products"Walnut plaque (perpetual) with 45 nameplates. Includes header plate and first nameplate engraving.wpp4508-10-2011custom-pageperplaq1"4-6 business days "Marquette, MI" "UPS"perpetual plaques498553-610.45316.95JDS-SPlaquesPerpetual Plaques1:22%"Minuteman" "New Products"Find This Beautiful 18 Plate Step Edge Walnut Perpetual Plaque Discounted At TrophyCentral. Fast Shipping. Top-Rated Customer Service.wpp18Return to thesection for other great choices.perplaq08-20-2022Perpetual, Name Platecustom-pageperplaq1"4-6 business days "Marquette, MI" "UPS"perpetual plaques498553-610.45318.45JDS-SPlaquesPerpetual Plaques1:22%"New Products"Find This Beautiful 24 Plate Step Edge Walnut Perpetual Name Plaque Discounted At TrophyCentral. Fast Shipping. Top-Rated Customer Service.wpp2406-30-2022Perpetual, Name Platecustom-pageperplaq1"4-6 business days "Marquette, MI" "UPS"perpetual plaques498553-610.45319.95JDS-SPlaquesPerpetual Plaques1:22%"Minuteman" "New Products"Find This Beautiful 36 Plate Step Edge Walnut Perpetual Name Plaque Discounted At TrophyCentral. Fast Shipping. Top-Rated Customer Service.wpp3608-10-2011Perpetual, Name Platecustom-pagebadgeribbonsholders11"1-2 business days" "Topeka, Indiana" "UPS (FedEx available on request)"465711-21 260.3620030.36Tower RibbonRibbonsStock Ribbons1:22%,5:20%Find this popular printed badge ribbon discounted at TrophyCentral. Available in many colors and titles. Fast 1-2 day shipping.badgeribbbonscustom-pagequickshiptrophies-stock-car1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:16%Fabulous Stock Car Place trophy with 1st, 2nd or 3rd Place Trim, Marble Base and Free Engraving. Ships in a fast 1-2 days!qtscarplcustom-pagequickshiptrophies-stock-car1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:16%This popular Stock Car trophy features a real marble base, column, figure and trim indicating year of award. Includes up to three lines of free engraving!qtscaryrcustom-pagequickshiptrophies-stock-car1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with car show / stock car figure discounted at TrophyCentral. Includes free text engraving!cup-scar-pcustom-pagequickshiptrophies-stock-car1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these car show / stock car budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtscarscbcustom-pagequickshiptrophies-stock-car1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:26%Find these fabulous two-tier Stock Car Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtscarttcustom-pagequickshiptrophies-stock-car1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-411.215Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:28%Find this awesome Car Show two tier championship trophy discounted at TrophyCentral. Add up to 3 lines of Free Personalization!qtscarttwcustom-pagequickshiptrophies-stock-car1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:22%This popular Car Show / Stock Car Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtscarsccustom-pagequickshiptrophies-stock-car1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.05Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:16%Find These Popular Stock Car Deluxe Platform Trophies Discounted at TrophyCentral. Real Marble; Free Engraving!qtscardmcustom-pagequickshiptrophies-stock-car1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Car Show / Stock Car figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-scar-scbcustom-pagequickshiptrophies-stock-car1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-411.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:18%,10:23%Find these fabulous two-tier, 3-column champion Stock Car Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtscar3cCar Showcustom-pageholographic-insert-plaques1"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498852-310.45811.6Quick TrophyPlaquesInsert1:14%,3:14%See this stunning Stock Car plaque and other Holographic Plaques at TrophyCentral.qsinplaqstockcarcustom-pagequickshiptrophies-stock-car1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:25%Our popular Stock Car participation trophies feature a real slant-front marble base and free engraving.qtscarnccustom-pagequickshiptrophies-stock-car1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.4234Quick TrophyTrophies1:14%,3:15%,10:16%Find this Perpetual Stock Car Trophy Discounted at TrophyCentral. Each Trophy has enough room for 32 names. Ships in just 1-2 days.qtstockperpReturn to thesection for other great choices.quickshiptrophies-stock-carcustom-pageracing-medalsqtscarncqtscarscqtscardmqtscaryrqtscarplqtscarttqtscarttwqtscar3cqtstockperpmqtscarscbcup-scar-pcup-scar-scb1trophies-car-truck1Find a great selection of stock car trophies discounted at TrophyCentral. Each stock car trophy includes free personalization! See our complete selection of stock car trophies, medals and awards.

    Stock Car Trophies and Awards - Honor Every Driver, Race, and Championship Season

    Stock car trophies are the centerpiece of the victory lane tradition that has defined grassroots motorsports from local dirt tracks to regional oval series for generations. Every driver who straps in and takes the green flag deserves recognition for the skill, preparation, and competitive spirit that racing demands, and quality awards reflect that dedication with the same seriousness competitors bring to the track. Our stock car trophy collection features stock car and racing figurine designs in a range of sizes from affordable heat winner and event trophies to the large multi-column championship pieces appropriate for season points titles and series championships. Traditional column designs with checkered flag trim and stock car inserts in gold, silver, and bronze finishes allow race directors to build a complete podium set with consistent visual hierarchy, while premium resin racing sculptures offer a more detailed alternative for feature events and marquee races that warrant a more distinctive award. Every trophy includes free engraving with driver name, finish position, race name, track, and season details, and stock car racing medals with free neck ribbons provide an affordable recognition alternative for large fields and multi-class events where presenting trophies to every starter is the goal.

    Frequently Asked Questions About Stock Car Trophies

    What trophy sizes work best for different stock car racing award categories?

    Heat race and consolation winners are well served by 10-inch to 12-inch single column trophies that recognize the achievement without overshadowing the feature event awards presented later in the night. Feature race winners in weekly program classes deserve 14-inch to 18-inch trophies that carry genuine visual presence in the victory lane photo and on the driver's shelf at home, with the size clearly communicating that a feature win is a more significant achievement than a heat finish. Special event and invitational race winners warrant 18-inch to 22-inch premium trophies that reflect the elevated status of the event on the regional racing calendar. Season points champions and series title winners deserve the most impressive award in the program, making 24-inch to 30-inch multi-column championship trophies the appropriate choice for crowning the driver who sustained top performance across an entire season. Perpetual trophies that add a new engraving plate for each season's champion are popular with established series that want to build a trophy with history, displaying it at the track and adding to its significance year over year. Hard charger awards, most improved driver recognition, and crew chief honors can be recognized with 12-inch to 15-inch mid-range trophies that differentiate them clearly from heat winners while reserving the largest pieces for feature and championship honors.

    What details should stock car trophy engraving include?

    Stock car trophy engraving should document the specific race result so the award tells a complete story when the driver looks at it years later. Essential elements include driver name, finish position or award title, race or event name, track name, and season or date. For example: Jake Morrison, Feature Winner, Modified Class, Riverside Speedway, Summer Shootout 2025, or Tyler Renshaw, Season Points Champion, Late Model Division, Tri-County Racing Series, 2025. Car number engraving adds a personal detail that drivers appreciate, particularly for trophies that will be photographed in victory lane where the number connects the award to the car. For special events and invitational races, noting the specific event name rather than a generic race title adds prestige: Jim Callahan, Winner, Annual Memorial Classic, Lakeside Oval, August 2025. Crew and team awards should include the team or car owner name alongside the driver. When space allows on larger championship trophies, adding the final points total or win count for the season documents the specific achievement behind the title rather than simply stating the outcome.

    Should stock car racing programs give trophies to every starter or only to top finishers?

    The right approach depends on the level and culture of the racing program, and most successful series use a tiered structure that recognizes broad participation while still creating clear incentive for top performance. Weekly program tracks that rely on car count for competitive fields benefit from presenting a participation or hard charger award to every driver who takes the green flag in the feature, keeping entry fees attractive and rewarding the investment drivers make in showing up and competing regardless of their finishing position. This approach is particularly important for beginner and street stock classes where encouraging driver development and return participation matters as much as competitive recognition. Feature podium positions, heat race winners, and fast qualifiers should receive progressively larger and more distinctive trophies that create clear visual hierarchy communicating the achievement level, giving drivers visible incentive to move up through the competitive order. Season championship recognition deserves the most substantial award investment in the program, since a points title represents sustained excellence across dozens of events and every competitor in the series understands the difficulty of the accomplishment. Special event and invitational races that draw larger purses and attract outside competition warrant trophy upgrades that match the elevated status of the event and create the kind of winner photos that promote the series on social media and in local motorsports coverage.

    If you need more information before deciding, see our expert resource section:
    ]]>
    custom-pagefirst-place-ribbons11"1-2 business days" "Topeka, Indiana" "UPS (Post Office Priority Mail may also be available)"ribbons465711-21 260.3630021.36Tower RibbonRibbons1:22%,50:26%,100:31%See this fabulous mini-rosette ribbon discounted at TrophyCentral. Mini rosettes are a fun and inexpensive way to recognize a special achievement!Blue Ribbon, Red Ribbon, 1st / 2nd / 3rd / Etc., Honorable Mention, Participant, Achievementcustom-pageofficesigns11240162-310.5183.38Roanoke1Find date stamps and custom rubber stamps at TrophyCentral.com at discounted prices. Fast shipping on all custom stamps.custom-pagename-badges-tagswoyoulipr100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Stop Sign Badges Discounted At TrophyCentral.namebadges-stopcustom-page11custom-pagenew-trophies-21trophies498551-310.452429Trophies1Find this popular Street Rod trophy discounted at TrophyCentral. Features a real marble base, free engraving and fast shipping.street-rod-cup-place-trophy-tccustom-pagequickshiptrophies-street1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Fabulous Street Rod Figure Trophy with choice of 1st, 2nd or 3rd place trim.qtstreetrodplcustom-pagequickshiptrophies-street1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%This popular Street Rod Figure Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!qtstreetrodyrcustom-pagequickshiptrophies-street1trophies498852-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with street rod figure discounted at TrophyCentral. Includes free text engraving!cup-streetrod-pcustom-pagequickshiptrophies-street1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these street rod budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtstreetrodscbcustom-pagequickshiptrophies-street1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:26%Find these fabulous two-tier Street Rod Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtstreetrodttcustom-pagequickshiptrophies-street1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:28%See this championship trophy with a Street Rod figure at TrophyCentral. Be sure to see all of our Street Rod figure awards.qtstreetrodttwcustom-pagequickshiptrophies-street1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:21%,100:24%This popular Street Rod Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtstreetrodsccustom-pagequickshiptrophies-street1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.05Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%These quick-ship trophies from TrophyCentral feature a Hot Rod figure, real marble base and marble trophy figure platform, choice of column size and color.qtstreetroddmcustom-pagequickshiptrophies-street1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Street Rod figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-streetrod-scbcustom-pagequickshiptrophies-street1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.4226Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:18%,10:23%Find these fabulous Street Rod Champions Line 3-Column Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qtstreetrod3ccustom-pagequickshiptrophies-street1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:27%,100:32%Our popular Street Rod Participation Trophies feature a real slant-front marble base and free personalization. Significant quantity discounts available.qtstreetrodnccustom-pagetrophies-car-truckqtstreetrodncqtstreetrodscqtstreetroddmqtstreetrodplqtstreetrodyrqtstreetrodttqtstreetrodttwqtstreetrod3cmqtstreetrodscbcup-streetrod-scbcup-streetrod-p11See a fabulous selection of Street Rod Figure Trophies at TrophyCentral. Free engraving on Street Car Trophies.street rod trophies, street rod trophy, street rod awards, street rod trophies and awards

    Street Rod Trophies and Awards - Recognize the Craftsmanship Behind Every Build

    Street rod trophies honor something different from most sports awards: not who crossed the finish line first, but who poured the most skill, vision, and personal investment into a build that expresses their own style and passion. A well-chosen street rod trophy acknowledges that the recipient spent years, sometimes decades, fabricating, restoring, and perfecting a vehicle that reflects their personality and craftsmanship, making the award a recognition of artistic and mechanical achievement as much as competitive success. Our street rod trophy collection features classic street rod and hot rod figurine designs in a range of sizes suited for every tier of car show recognition, from participant dash plaques and class winner trophies at the entry level to large multi-column Best in Show and Grand Champion pieces that serve as the centerpiece award of the entire event. Traditional column designs with street rod inserts work well for shows building a consistent visual award program across multiple classes, while premium resin rod sculptures offer a more detailed and distinctive alternative for flagship awards and special recognition categories. Every trophy includes free engraving with recipient name, award category, show name, car club or organization, and year so the award documents the specific achievement in full.

    Frequently Asked Questions About Street Rod Trophies

    What award categories do most street rod and car shows use?

    Street rod and car show award structures vary widely based on event size, vehicle diversity, and the culture of the organizing club or association, but most shows build their recognition program around a combination of class-based awards and special category trophies that together cover the full range of entries. Class awards typically divide vehicles by era, style, or build type, with common divisions including pre-1949 street rods, 1950s customs, 1960s muscle, trucks, and rat rods, ensuring that a meticulously restored 1932 Ford and a 1969 Camaro compete within their own peer groups rather than against each other. Special category awards recognize specific areas of excellence regardless of class, with Best Engine, Best Paint, Best Interior, Best Chassis, Most Original, and Most Unusual among the most widely presented. People's Choice awards decided by show attendee vote rather than judges are popular at cruise nights and charity shows where community engagement is as important as competitive recognition. The highest tier typically includes Best in Show or Grand Champion as the single most prestigious award of the event, followed by second and third place overall awards at larger shows with enough entries to justify a full podium. Club participation awards and dash plaques presented to every registered entrant are standard at most shows, acknowledging that every builder who trailered or drove their vehicle to the event contributed to making the show possible.

    What trophy sizes are appropriate for different street rod show award levels?

    Trophy size at a car show communicates the prestige of the award within the show's visual hierarchy, and getting the proportions right across all award levels is important for the overall impression the show makes on participants. Participation and dash plaque awards work best as smaller flat plaque pieces or 6-inch to 8-inch economy trophies that acknowledge every entrant without competing visually with the class and category awards. Class winners in individual divisions are well served by 12-inch to 16-inch single column trophies that have enough presence to be displayed with pride without overwhelming the award's meaning. Special category winners such as Best Paint, Best Engine, and Best Interior deserve 14-inch to 18-inch trophies that reflect the selective nature of the award and reward the specific craftsmanship being recognized. People's Choice awards typically rate the same size tier as special categories since the vote of the attending public carries genuine prestige. The Best in Show or Grand Champion trophy should be noticeably larger and more impressive than every other award at the event, making 24-inch to 30-inch multi-column championship pieces the standard choice for this role. The visual gap between a class winner trophy and the Best in Show piece is what gives the top award its meaning, so resisting the temptation to save money by sizing down the flagship award is always the right call for a show that wants to be taken seriously by the street rod community.

    What should street rod trophy engraving include?

    Street rod trophy engraving should capture the vehicle, the owner, and the specific award so the trophy serves as a complete record of the achievement rather than a generic recognition piece. Essential elements include owner name, vehicle year and make if space allows, award category, show or event name, organizing club or association, and year. For example: Dave Kowalski, 1936 Ford Coupe, Best in Show, Tri-State Street Rod Nationals, NSRA 2025, or Carol Tanner, Best Paint, Lakewood Cruise Night, Summer Series 2025. Including the vehicle year and make is particularly meaningful for street rod awards because the car is as much a part of the achievement as the owner, and a trophy that names both creates a more complete keepsake than one that only identifies the person. For People's Choice awards, noting that the recognition came from the vote of fellow enthusiasts adds a layer of meaning: Jake Simmons, 1951 Mercury, People's Choice Award, voted by show attendees. Club membership or car club name adds community context that resonates with owners who have invested years in a club and want their club affiliation on the trophy alongside their individual achievement. Keep engraving concise enough that all elements remain legible at the font size the engraving plate accommodates, prioritizing owner name, award title, show name, and year when space requires choices.

    If you need more information before deciding, see our expert resource section:
    ]]>
    quickshiptrophies-camero quickshiptrophies-stock-car
    custom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these high-quality Student Council Award Inserts at TrophyCentral. Each Student Council Award Insert can be used to create a unique plaque, medal or trophy.51816106-10-2014Student Council, Academic
    custom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-40.3713003.37Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these quality Mylar Student Council Award Decal Inserts at TrophyCentral. Each Student Council Award Decal can be used to create a unique plaque, medal or trophy.489812Student Council, Academic
    custom-pageawardcertificates115"1-3 business days" "Columbia, South Carolina; Marquette, Michigan" "UPS (FedEx available on request)"certificates290631-21 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,50:38%,100:42%Find these Student Council certificates discounted at TrophyCentral. Each Student Council certificate measures 8 1/2 x 11 inches and typically ships in 1-2 days.7010Student Council, Academiccustom-pagegold-pins-lapelplastic-pinbox-t5student-council-pins498551-2.3150030.3lapel-award-pins1Find this gold student council lapel pin discounted at TrophyCentral. Each pin features a clutch back and measures roughly 7/8".Student Council, Academiccustom-pagestudent-council-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:30%,100:33%,500:47%"School Pins"Student Council Letter Pins: EC Series Student Council Lapel Pins feature a high-quality enameled finish and ship in just 1-2 business days!ec36Student Council, Academiccustom-pageacademic-lamp-general102-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    medals105503-60.5115014Classic Medallicsaward-medalsAcademic1:22%,25:24%,50:30%,100:36%,500:42%"School Medals" "School Award Medals" "Scholastic Medals" "Scholastic Award Medals" "Academic Medals" "Academic Award Medals" "Medals, School"Your students will love these colorful Student Council Medals from TrophyCentral. Each Student Council medal includes a neck ribbon! Fast shipping.tm9812Student Council, Academic
    custom-pagestudent-council-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:28%,100:32%,500:42%"School Pins"Find Student Council pins at TrophyCentral. Each AP Series Student Council pin includes a clutch back.ap14Student Council, Academiccustom-pageschool-pinsstudent-council-pinap14ec36hp23br469br54111Find student council pins discounted at TrophyCentral. Each student council pin features a clutch-back for easy attachment to clothing.

    Lapel Pins: Student Council

    If you are looking for an inexpensive, yet quality way to recognize your students, you have come to the right place! Student council lapel pins typically ship in a quick 1-2 business days and often the same day an order is placed. We offer discounted and bulk prices and top-rated customer service. If you have a question, please call our experts. They would be happy to assist you!
    ]]>school-pinscustom-pagescholarship-resource-hub11Complete student nomination worksheet for teachers. Organize observations and gather specific examples before writing scholarship nominations. custom-pageawardcertificates11certificates290631-31 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,25:24%,100:40%,500:50%Find this student of the month certificate and other awards discounted at TrophyCentral. Student of the month certificates are beautifully printed and measure 11 x 8 1/2 inches.933Academiccustom-pageachievement-certificates-awards1"Download Only"free-academic49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"See this Student Of The Month Certificate designed exclusively for TrophyCentral! Student Of The Month Certificates can be downloaded for free!studentfrAcademic, Studentcustom-pageachievement-certificates-awards1"Download Only"free-academic49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our student of the month template (female) is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-female-student-of-the-month-certificatefemale-student-of-the-month-freeAcademic, Studentcustom-pageachievement-certificates-awards1"Download Only"free-academic49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our student of the month template (male) is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-male-student-of-the-month-certificatemale-student-of-the-month-freeAppreciation, Academiccustom-pageawardcertificates115"1-3 business days" "Columbia, South Carolina; Marquette, Michigan" "UPS (FedEx available on request)"certificates290631-21 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,50:38%,100:42%Find these Student of the Month certificates discounted at TrophyCentral. Each Student of the Month certificate measures 8 1/2 x 11 inches and typically ships in 1-2 days.7030Academiccustom-pagemedals-general102-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    medals105503-60.5115014Classic Medallicsaward-medalsAcademic1:22%,25:24%,50:30%,100:36%,500:42%"School Medals" "School Award Medals" "Scholastic Medals" "Scholastic Award Medals" "Academic Medals" "Academic Award Medals" "Medals, School"Your students will love these colorful Mylar Student of the Month Medals from TrophyCentral. Each Student of the Month medal includes a neck ribbon!tm9711General, Academic
    custom-pageeawardmedals12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    medals105503-60.75130033.75Classic Medallicsaward-medalsAcademic1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "School Medals"These inexpensive 1 1/4 inch Student of the Month Medals offer a high quality, but low price for those on a tight budget.e996212-20-2020Academic
    custom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-40.3713003.37Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these quality Mylar Student Of The Month Decal Inserts at TrophyCentral. Each decal can be used to create a unique plaque, medal or trophy.489711Academic
    custom-pageschool-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"Find Student of the Month pins discounted at TrophyCentral. Each Student of the Month lapel pin features a quality clutch back.br39512-25-2010General, Academiccustom-pageachievement-certificates-awards1"Download Only"free-academic4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Student of the Week template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Student-of-the-Week-Certificatestudent-of-the-week-freeAcademic, Studentcustom-pageschool-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"Find these Student of the Week pins discounted at TrophyCentral. Each lapel pin features a beautiful finish and clutch-back.br540Academiccustom-pageschool-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:28%,100:32%,500:42%"School Pins" "School Lapel Pins"Find Student Recognition Award pins at TrophyCentral. Each AP Series Student Recognition Award pin includes a clutch back.ap77Academiccustom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these high-quality Student Recognition Award Inserts at TrophyCentral. Each Student Recognition Award Insert can be used to create a unique plaque, medal or trophy.517806General, Academic
    custom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-40.3713003.37Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these quality Mylar Student Recognition Award Decal Inserts at TrophyCentral. Each decal can be used to create a unique plaque, medal or trophy.489667Academic
    custom-pageacademic-resource-hub11Discover amazing student recognition award ideas! From perfect attendance to student of the month, find creative trophies and fun recognition that motivates students and celebrates their unique achievements.custom-pageacademic-lamp-general52-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    medals105503-60.5115014Classic Medallicsaward-medalsAcademic1:22%,25:24%,50:30%,100:36%,500:42%"School Medals" "School Award Medals" "Scholastic Medals" "Scholastic Award Medals" "Academic Medals" "Academic Award Medals" "Medals, School"Your students will love these colorful Mylar Student Recognition Medals from TrophyCentral. Each Student Recognition medal includes a neck ribbon!tm9667General, Academic
    custom-pageschool-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"Find this Student Recognition Pin at TrophyCentral. Student Recognition and other pins ship in just 1-2 business days!br319Academiccustom-pagescholarship-resource-hub11Comprehensive scholarship application timeline for students from junior year through senior year. Includes month-by-month checklists, organization strategies and more!custom-pagesports-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Lacrosse Awards" "Lacrosse Medals"Buy these quality Lacrosse (504781) Inserts (Litho) at TrophyCentral. Each Lacrosse (504781) Insert can be used to create a unique plaque, medal or trophy.50478108-21-2018Lacrosse, Sports
    custom-pagesports-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Lacrosse Awards" "Lacrosse Medals"Buy these quality Lacrosse Litho Inserts at TrophyCentral. Each Lacrosse Insert can be used to create a unique plaque, medal or trophy.507406Lacrosse, Sports
    custom-pageengravablemugmedallion-inserts-motivational--recognition--salesmedallion-inserts-general-medallion-insertsmedallion-inserts-government-agencies-and-logosmedallion-inserts-occupational-subjectsmedallion-inserts-military-medallion-insertsmedallion-inserts-organizationsmedallion-inserts-academic-medallion-insertsmedallion-inserts-arts-and-music-medallionsmedallion-inserts-fraternal-organizational-insertssports-inserts111custom-pagesummer-camp-awards1"Download Only"free-camp4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Summer Camp Award Template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.summer-camp-awardsummer-campCampingcustom-pagegeneral-corporate-awards1"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"458221510.45619.05Vision AwardsTrophies1:22%,26:36%Summit Corporate Awards from TrophyCentral.custom-pageservicepins11plasticpinboxvelapinbox"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.371150030.37Classic Medallicslapel-award-pinsBusiness1:22%,100:45%Shop for Swarovski Crystal Service Pins from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.custom-page111custom-pagesports-inserts1105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Swimming Awards"Buy these quality Swim All Styles (Female) Inserts (Litho) at TrophyCentral. Each Swim All Styles (Female) Insert can be used to create a unique plaque, medal or trophy.507060Swimming / Diving, Sportscustom-pagesports-inserts1105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Swimming Awards"Buy these quality Swim All Styles Male Inserts (Litho) at TrophyCentral. Each Swim All Styles Male Insert can be used to create a unique plaque, medal or trophy.507069Swimming / Diving, Sportsblog-trophycentral11custom-pageshop-by-categoryqtswimncqtswimacrwge479wbt780qtswimscmaswtrmoxtmaswtrmoxtfeswtrqtswimdmqtswimyrqtswimplqtswimttqtswimttwqtswim3cqtswimtrtr7010tr7011tr9922wssx79qtswimperpmqtswimscbcup-swim-scbcup-swim-pswimming-part-iswimming-single-iswimming-champ-iswimming-plaque-iswimming-e-part-iswimming-e-single-icup-swimming-scb-icup-swimming-inbdg-swimmingchamp-cup-swim-tce9038e9283ir16swimmingmedalsqcm-31me106gz9036z9038tm9990gswimming-mgswimming-mcswimming-mc-prswimming-jigfswimming-jibfswimming-jisfswimming-ribbonscl38cl37cl47cl54goldstarpinsswimming-pb504281503081507060489645507069507412504191503891493231swimming-eiqsinplaqswimmingswimming-cup-place-trophyswimming-cup-place-column-trophy1trophies1"Swimming Awards" "Sports Trophies"Custom Swimming Trophies and Awards - Celebrate Every Stroke, Race, and Championship Season

    Swimming trophies celebrate the dedication, discipline, and competitive drive that define one of the most demanding individual sports in the world. From age-group recreational leagues introducing young swimmers to their first 25-yard freestyle, to USA Swimming club programs training year-round for regional and national championships, from high school dual meets and conference titles to masters programs competing well into adulthood, quality swimming awards recognize athletes, coaches, and relay teams across every level of the sport. Our collection includes traditional column trophies in a range of heights and finishes with swimmer toppers depicting freestyle, backstroke, butterfly, and breaststroke athletes, dynamic resin figures capturing male and female swimmers mid-stroke, acrylic and crystal awards suited to banquets and end-of-season ceremonies, and diving trophies honoring springboard and platform competitors alongside their pool counterparts. With figurines for both male and female athletes, designs scaled from youth participation through elite championship, and free engraving on every order, our collection makes it easy to find the right award for every swimmer, event, and budget.

    Swimming Medals

    Swim meets run on medals, from the youngest age-groupers finishing their first 25-yard freestyle to senior swimmers competing for league titles. Our swimming medals come in 1¼" through 2¾" sizes and gold, silver, and bronze finishes, each with a free ribbon and free engraving. For dual meets and invitationals, medals are a fast and affordable way to recognize every heat winner. For year-end banquets and championship events, larger engraved medals make a keepsake swimmers hold onto long after the season ends.

    Choosing the Right Trophy Size for Your Swim Program

    For recreational youth leagues and participation awards, 6" to 9" trophies are the right fit. They are meaningful without overshadowing the experience of the sport. Individual event champions and all-star honorees typically receive 10" to 14" trophies. Season MVPs, top scorers, and coaches awards step up to 15" to 18". Reserve 20" and taller trophies for league champions, conference titles, and perpetual team awards that live in a display case year after year.

    What to Engrave on Swimming Trophies and Medals

    The most useful swim awards include four things: the swimmer's name, the specific achievement, the team or league name, and the season year. For individual event awards, something like Jordan Marsh, 100 Butterfly Champion, Riverside Aquatic Club, 2025 tells the whole story. Relay team trophies can list all four swimmer names on the base. If you are unsure what to include, our engraving team can help you format the text during checkout.

    Be sure to see our expert guides:

    Frequently Asked Questions

    What trophy sizes work best for different swimming award categories?

    Participation and first-time competitor awards work well at 6" to 9". Individual event champions at dual meets and invitationals typically receive 10" to 14" trophies. Season-long awards like Most Improved, High Point Scorer, and team MVP step up to 15" to 18". For league champions and championship meet winners, 20" and taller trophies make the achievement feel permanent. Perpetual trophies with engraved plates added each season are a popular choice for programs that want a single award to carry the history of the team.

    What should swimming trophy and medal engraving include?

    At minimum, include the swimmer's name, their achievement, and the year. Adding the team or event name makes the award meaningful long after the season. For competitive meets, specific language like "200 IM Champion" or "Fastest 50 Free, Girls 10 & Under" means more than a generic "First Place." For relay teams, engraving all four swimmer names on the trophy base is always a nice touch. A complete example: Sofia Reyes, 100 Backstroke Champion, Lakeview Swim Club Invitational, 2025. Our engraving team reviews every order before production.

    Should a youth swim program give trophies to every swimmer or only to top finishers?

    It depends on the age group and program goals. For recreational leagues with younger swimmers, typically 12 and under, participation trophies reward the commitment to the season and the team. Most programs at this level give a modest participation trophy to everyone, with medals or a slightly larger trophy for event winners. For competitive club programs and high school teams, merit-based awards carry more weight because the swimmers understand what they represent. A practical approach is medals for place finishes at meets and trophies for season-long achievements like MVP, most improved, or league champion. If budget is tight, medals go further than trophies at the same per-unit cost.

    ]]>
    custom-pagetrophies-swimming-diving1trophies498551-310.452429Trophies1Find this popular Swimming trophy discounted at TrophyCentral. Features a real marble base, free engraving and fast shipping.swimming-cup-place-trophy-tccustom-pagetrophies-swimming-diving1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular swimming figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at trophyCentral. Ships in a fast 1-2 days!qtswimplSwimming / Diving, 1st / 2nd / 3rd / Etc., Sportscustom-pagetrophies-swimming-diving20swimming-mc swimming-mc-pr498552-40.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful Swimming 2" Epoxy-covered insert decal discounted at TrophyCentral. Fast 1-2 day shipping.Swimming / Diving, Sportscustom-pagetrophies-swimming-diving1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%This popular Swimming trophy features a real marble base, column, figure and trim indicating year of award. Includes up to three lines of free engraving!qtswimyrSwimming / Diving, Sportscustom-pagetrophies-swimming-diving1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with swimmer figure discounted at TrophyCentral. Includes free text engraving!cup-swim-pSwimming / Diving, Sportscustom-pagetrophies-swimming-diving1medals498552-30.525033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Swimming Freestyle 2 1/4" Antique Gold Medal Discounted at TrophyCentral. Each medal features a free ribbon. Fast shipping!Swimming / Diving, Sportscustom-pagefree-sports-templates1"Download Only"free-sports49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Swimming template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Swimming-Certificateswimming-freeSwimming / Diving, Sportscustom-pagefree-sports-templates1"Download Only"free-sports49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"See this Swimming Certificate designed exclusively for TrophyCentral! Swimming Certificates can be downloaded for free! Each Swimming Award Certificate measures 11 x 8 1/2 inches.swimmingfrSwimming / Diving, Sportscustom-pagetrophies-swimming-diving11Creative swimming award ideas with engraving examples for your team banquet. From Ace Machine to Dig Master, discover 15+ unique ways to recognize every player with actual trophy wording templates.custom-pagetrophies-swimming-diving1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Swimming Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Swimming / Diving, Sportscustom-pagetrophies-swimming-diving1trophies498552-311224.45TrophiesSports, Hobby, Org, Livestock1Find these swimmer budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtswimscbSwimming / Diving, Sportscustom-pagetrophies-swimming-diving1498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Find this budget swimming award trophy discounted at Trophy Central. Features a real marble base and plastic swimmer / diver figure. Engraving is free. Fast 1-2 day shipping.bdg-swimmingSwimming / Diving, Sportscustom-pagetrophies-swimming-diving1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.451 2 3 4 5 6 7 8 911230.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,6:23%,12:24%,24:26%Shop for Cast Stone Swim Awards at TrophyCentral. We have a great selection of Swim and other recognition trophies at discounted prices.tr9922Swimming / Diving, Sportscustom-pagesporcerswimmingfr1swimmingfrcertificates290631-31 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,25:27%,100:40%,500:50%"Swimming Awards"Give your swim team the recognition they deserve with swimming certificates from Trophy Central. Shop our discounted swim certificates today!1039Swimming / Diving, Sportscustom-pagetrophies-swimming-diving1trophies498552-411229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find this swimming champion's cup trophy discounted at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's Cup - SwimmingSwimming / Diving, Sportscustom-pagetrophies-swimming-diving1trophies498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Swimming insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-Swimming-InsertSwimming / Diving, Sportscustom-pagetrophies-swimming-diving1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous Swimmer Two Tier Trophies Discounted at TrophyCentral. Fast 1-2 Day Shipping! Free Personalization!qtswimttSwimming / Diving, Sportscustom-pagetrophies-swimming-diving1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.215Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%See this championship trophy with a Swimming figure at TrophyCentral. Be sure to see all of our Swimming figure awards.qtswimttwReturn to the section for our complete selection!trophies-swimming-divingSwimming / Diving, Sportscustom-pagetrophies-swimming-diving1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Swimming single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - SwimmingSwimming / Diving, Sportscustom-pagetrophies-swimming-diving1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451224.45Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%Find these popular Swimmer Elite Series trophies discounted and with free personalization at TrophyCentral.qtswimscReturn to thesection for more great choices.trophies-swimming-divingSwimming / Diving, Sportscustom-pagetrophies-swimming-diving1trophies498551-311821.06TrophyCentraltrophies1Swimming / Diving, Sportscustom-pagecustommedals50"Standard Service: 8 Business Days from Receipt of Artwork, Rush Service (Extra Charge): 3 Business Days from Receipt of Artwork" "Oxnard, CA" "UPS (FedEx available on request)"medals930335-1010.630033.6Simba Calaward-medalsSports, Hobby, Org, Livestock1:22%,300:40%,500:51%,1000:54%"Swimming Medals" "Swimming Awards"These 2 1/2 inch custom Swimming Race Medals come with an outer-ring which allows you to add your school or league name, date and location.qcm-31Swimming / Diving, Sportscustom-pagetrophies-swimming-diving1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451623.65Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:28%Find These Popular Swimming Deluxe Platform Series Trophies Discounted at TrophyCentral. Real Marble Base; Free Personalization!qtswimdmSwimming / Diving, Sportscustom-pagesports-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Swimming Awards"Buy these quality Swimming GENERAL (507412) Inserts (Litho) at TrophyCentral. Each Swimming GENERAL (507412) Insert can be used to create a unique plaque, medal or trophy.507412Swimming / Diving, Sports
    custom-pagetrophies-swimming-diving1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Swimmer figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-swim-scbSwimming / Diving, Sportscustom-pagetrophies-swimming-diving1trophies498551-310.71217.38trophies1Swimming / Diving, Sportscustom-pagetrophies-swimming-diving1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Swimming Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Swimming / Diving, Sportscustom-pagetrophies-swimming-diving1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous two-tier, 3-column champion Swimming Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtswim3cSwimming / Diving, Sportscustom-pagetrophies-swimming-diving1medals498552-30.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Colorful Swimming insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Swimming / Diving, Sportscustom-pagetrophies-swimming-diving1medals498552-40.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Swimming insert medal With A Personalized Front Rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Swimming / Diving, Sportscustom-pagecherry-insert-plaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these swimming insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Swimming / Diving, Sportscustom-pagesports-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Swimming Awards"Buy these high-quality Swimming Inserts (493231) at TrophyCentral. Each 2 inch insert can be used to create a unique plaque, medal or trophy.493231Swimming / Diving, Sports
    custom-pagetrophies-swimming-diving1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our swimming insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - SwimmingSwimming / Diving, Sportscustom-pagetrophies-swimming-diving1j9036 sporcer eventribbons sports"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%,25:23%,50:29%,100:34%Our popular Swimming participation trophies feature a real slant-front marble base and free engraving.qtswimncSwimming / Diving, Sportscustom-pagetrophies-swimming-diving1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.4234Quick TrophyTrophies11:14%,3:15%,10:16%"Swimming Awards" "Swimming Trophies"Find this Perpetual Swimming Trophy Discounted at TrophyCentral. Each Trophy has enough room for 32 names. Ships in just 1-2 days.qtswimperpSee our other fabulousin a variety of sizes and styles.trophies-swimmingSwimming / Diving, Sportscustom-pagesports-pinscl38cl37cl47cl54goldstarpinsswimming-pb11Shop for swimming pins at TrophyCentral. Pins for swimming and diving ship in 1-2 business days.swimming pins, swimming award pins, swimming awards, swimming lapel pinsSwimming Award Pins TrophyCentral has a great selection of stock swimming lapel pins. Our swimming letter pins are available with a color or gold finish. Choose from several styles, including: male swimmer, female swimmer, CAPT, and more.

    Shop with Confidence at TrophyCentral!

    If you are looking to buy swimming lapel pins online, look no further! TrophyCentral has a great selection that will fit any budget. Our top-rated representatives are happy to assist you with all of your swimming pin / diving pin needs. Our experts in New York and Michigan have been providing suggestions and guidance since 1999!]]>
    swimmingmedals1 trophies-swimming-diving
    custom-pagetrophies-swimming-divingplastic-pinbox-t5lapel pins498551-20.525040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find this Swimming Gold Enamel lapel pin discounted at TrophyCentral. Features a clutch-pin back for easy attachment to clothing.. Fast 1-2 day shipping.swimming-pbSwimming / Diving, Sportscustom-pageaward-ribbons-printed1"1-2 business days" "Topeka, Indiana" "UPS (Post Office Priority Mail may also be available)"ribbons465711-21 26120030.36Tower RibbonRibbons11:22%,50:46%Find swimming ribbons discounted at Trophy Central. Choose from 1st - 6th place, participant and more!Swimming / Diving, Sportscustom-pagetrophies-swimming-diving1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Swimming Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Swimming / Diving, Sportscustom-pagetrophies-golf1"10 business days" "Aliquippa, PA" "UPS"trophies1500110-1410.45824.45Glass AmericaCrystal AwardsSports, Hobby, Org, Livestock1:22%,10:25%Sylvan Golf Tower. Ideal for leagues, schools, and tournaments. Fast shipping.Golf, Sportscustom-pagetrophies-swimming-diving12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    medals105503-60.75130033.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,100:28%,500:34%,1000:45%"Swimming Awards" "Swimming Medals"These inexpensive 1 1/4 inch Synchronized Swimming Medals offer a high quality, but low price for those on a tight budget.e9283Swimming / Diving, Sports
    custom-pagetrophies-softballt-ball-plaque-it-ball-ei1trophies1"Sports Trophies" "Trophies" "T-Ball Awards" "T-Ball Trophies"Find a great selection of t-ball trophies at TrophyCentral. Each t-ball trophy and award includes free engraving. T-ball medals include a ribbon.

    Custom T-Ball Trophies and Awards - Celebrate Every Young Slugger and First-Season Player

    T-ball trophies celebrate the enthusiasm, effort, and first steps on the diamond that make youth baseball and softball programs so meaningful for families and communities. From recreational park district leagues where boys and girls ages three to six swing at their first pitches and round the bases with pure joy, to organized YMCA and community t-ball programs where young players learn to throw, catch, and work as a team for the very first time, from end-of-season celebrations where every child on the roster deserves to go home with something special, to coach and volunteer recognition that honors the adults who make these programs possible, quality t-ball awards create lasting keepsakes from a child's first experience in organized sports. Our versatile selection includes budget participation trophies and economy insert awards ideal for recognizing every player on the team affordably, marble base participation trophies and single column designs featuring t-ball player figurines, bobble head and little buddy novelty trophies that young players love, double platform trophies with year indicator and place trim options, two-tier and champion's trophies for league and end-of-season highlights, insert plaques for coaches and volunteers, and medals with free ribbons for leagues that prefer a wearable keepsake every player can take home on the last day of the season. Every award includes free engraving personalized with player name, team, and season.

    T-Ball Medals

    In addition to trophies, we offer a wide selection of T-Ball medals ideal for participation awards and team recognition. Choose from gold, silver, and bronze finishes, with styles designed specifically for young players. T-Ball medals are a popular and budget-friendly way to celebrate every child's first experience on the field, making them perfect for leagues, teams, and end-of-season events.

    Frequently Asked Questions About T-Ball Trophies

    Should t-ball programs give trophies to every player?

    Yes, universally. T-ball is typically the first organized sport a child ever plays, and a participation trophy at the end of the season is often their very first sports award. These affordable 6-inch to 9-inch trophies cost little but mean everything to a young player proudly carrying them home and displaying them on a dresser or bookshelf. The goal at this age is to build positive associations with organized sports, encourage return participation next season, and make every child feel like a valued member of the team. Even programs that present a larger coach's award or team MVP trophy should still ensure every player leaves the end-of-season celebration with their own award.

    What details should t-ball trophy engraving include?

    Essential elements include the player's name, team name, league or organization name, and season year. Keeping the format consistent across the full team order makes the end-of-season ceremony feel organized and intentional. For coach and volunteer awards, adding a title such as Head Coach or Team Volunteer and the season year creates a meaningful keepsake. Keep text concise and readable, as smaller participation trophies have limited engraving space.

    Do you offer bulk discounts for t-ball leagues?

    Yes, Trophy Central offers significant bulk discounts on t-ball trophies and medals that scale with order quantity, keeping award budgets manageable for leagues and programs of any size. League coordinators ordering participation trophies for an entire season roster across multiple teams, park districts purchasing end-of-season awards for all age divisions, and coaches ordering medals for a full team all benefit from bulk pricing. Browse our t-ball medals above for the most budget-friendly option when every player needs to go home with something special.

    If you need more information before deciding, see our expert resource section:
    ]]>
    trophies 1st-place-medals
    custom-pagetrophies-t-ball1trophies498551-310.452429Trophies1Find this popular T-Ball trophy discounted at TrophyCentral. Features a real marble base, free engraving and fast shipping.t-ball-cup-place-trophy-tccustom-pagetrophies-t-ball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular T-ball trophy with 1st, 2nd or 3rd place trim, marble base and free personalization, discounted at trophyCentral. Ships in a fast 1-2 days!qttballplReturn to ourcategory for more individual and team awards.trophies-t-ballBaseball / T-Ball, 1st / 2nd / 3rd / Etc., Sportscustom-pagetrophies-t-ball1498554-Feb0.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful T-Ball 2" Epoxy-covered insert decal discounted at TrophyCentral. Fast 1-2 day shipping.Baseball / T-Ball, T-Ball, Sportscustom-pagetrophies-t-ball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular T-Ball year trim trophy discounted at trophyCentral. Available in multiple sizes and includes free personalization.qttballyrBaseball / T-Ball, Sportscustom-pagetrophies-t-ball1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with t-ball figure discounted at TrophyCentral. Includes free text engraving!cup-tball-pBaseball / T-Ball, Sportscustom-pagefree-sports-templates1"Download Only"free-sports4985501Trophy CentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our T-Ball template is free and designed exclusively for Trophy Central. T-Ball certificate templates measure 11" x 8 1/2" and can be easily downloaded and printed.t-ball-certificatet-ball-frT-Ball,. Sportscustom-pagetrophies-t-ball11"3-4 business days + shipping time" "Marquette, MI" "UPS (FedEx available on request)"trophies498552-310.451224.5JDS-STrophiesSports, Hobby, Org, Livestock1:22%,12:32%Kids love our engraved t-ball bank trophy! T-ball bank trophies are made of resin and the baseball figure is hand-painted.baseballbank106-15-2011Baseball / T-Ball, Sportscustom-pagetrophies-t-ball11"1-3 business days + shipping time" "Marquette, MI" "UPS (Post Office Priority Mail may be available on request)"trophies498552-310.453631.05JDS-STrophiesSports, Hobby, Org, Livestock1:22%,10:23%Find T-Ball Bobble Head Trophies Discounted at TrophyCentral. Fast 1-2 Day Shipping and Free Personalization!babohe208-10-2013Baseball / T-Ball, Sportscustom-pagetrophies-t-ball1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these T-Ball Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.T-Ball, Sportscustom-pagetrophies-t-ball1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find this budget t-ball trophy with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqttballscbBaseball / T-Ball, Sportscustom-pagetrophies-t-ball1498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Find this budget t-ball award trophy discounted at Trophy Central. Features a real marble base and plastic t-ball figure. Engraving is free. Fast 1-2 day shipping.bdg-t-ballT-Ball, Sportscustom-pagetrophies-t-ball1trophies498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a T-Ball insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-T-Ball-InsertBaseball / T-Ball, T-Ball, Sportscustom-pagetrophies-t-ball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous two-tier T-Ball Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qttballttBaseball / T-Ball, Sportscustom-pagetrophies-t-ball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.215Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%See this championship trophy with a T-Ball figure at TrophyCentral. Be sure to see all of our T-Ball figure awards.qttballttwBaseball / T-Ball, Sportscustom-pagecoaching-teaching-guides11Master T-ball coaching with age-appropriate drills, practice plans, and parent management tips for 4-6 year olds. Includes free certificates and award ideas to motivate young players.custom-pagetrophies-t-ball1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our T-Ball single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - T-BallT-Ball, Sportscustom-pagetrophies-t-ball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:32%This popular T-Ball Figure Elite Series Trophy features a choice of column size and color, a marble base and free trophy engraving!qttballscSee more fabulousin a huge variety of sizes and styles.trophies-t-ballBaseball / T-Ball, Sportscustom-pagetrophies-t-ball1trophies498551-311821.06TrophyCentraltrophies1Baseball / T-Ball, Sportscustom-pagetrophies-t-ball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451623.65Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%These quick-ship trophies from TrophyCentral feature a T-Ball figure, real marble base and marble trophy figure platform, choice of column size and color.qttballdmReturn to thesection for other great choices.trophies-t-ballBaseball / T-Ball, Sportscustom-pagetrophies-t-ball1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with T-Ball figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-tball-scbBaseball / T-Ball, Sportscustom-pagetrophies-t-ball1trophies498551-310.71217.38trophies1Baseball / T-Ball, Sportscustom-pagetrophies-t-ball1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these T-Ball Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.T-Ball, Sportscustom-pagetrophies-t-ball1medals498553-Feb0.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this colorful T-Ball insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.T-Ball, Sportscustom-pagetrophies-t-ball1medals498553-Feb0.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this T-Ball insert medal with a personalized front rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.T-Ball, Sportscustom-pagecherry-insert-plaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these t-ball insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Baseball / T-Ball, Sportscustom-pagetrophies-t-ball1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511218.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,6:24%,12:26%,24:29%,48:31%"Baseball Awards"Find these popular T-Ball Design Little Buddy Series Trophies Discounted at TrophyCentral. Free Personalization! TrophyCentral is a Top-Rated Merchant.tr7048Baseball / T-Ball, Sports11Find T-Ball Medals Discounted at TrophyCentral. Each T-Ball Medal Includes a Free Ribbon.Shop for T-Ball Award Medals with Ease Our t-ball medals are a perfect way to recognize boys and girls for their youth t-ball league participation. We have gold, silver and bronze medal frames for teams that have multiple place winners.]]>tballmedalscustom-pagetrophies-t-ball1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our t-ball insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - T-BallT-Ball, Sportscustom-pagetrophies-t-ball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%,25:23%,50:29%,100:34%Our T-Ball Player Participation Trophies feature a real slant-front white marble base and free personalization. Significant quantity discounts available.qttballncReturn to thesection for more fabulous choices.trophies-t-ballBaseball / T-Ball, Sportscustom-pagetrophies-t-ball1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these T-Ball Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.T-Ball, Sportscustom-pageletter-shaped-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find these popular T-shaped custom mascot badges at TrophyCentral. Great for fundraising! TrophyCentral is a top-rated Yahoo merchant.letterbadges-tcustom-pagepickleball-trophiestable-tennis-plaque-itable-tennis-ei1trophies1Table Tennis / Ping Pong Trophies from TrophyCentral. Each table tennis trophy includes free engraving. Fast 1-2 day shipping.Table Tennis Recognition Trophies TrophyCentral has an industry-leading selection of ping pong trophies. Hit a winning slam with our Championship Trophies. All of our sports and recreation trophies include up to three lines of FREE ENGRAVING (larger awards may include additional lines). ]]>custom-pagetrophies-table-tennis-ping-pong1trophies498551-310.452429Trophies1Find this popular Table Tennis trophy discounted at TrophyCentral. Features a real marble base, free engraving and fast shipping.table-tennis-cup-place-trophy-tccustom-pagetrophies-table-tennis-ping-pong1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular table tennis figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at trophyCentral. Ships in a fast 1-2 days!qtttennisplTable Tennis / Ping Pong, 1st / 2nd / 3rd / Etc., Sportscustom-pagetable-tennis-medals1medals498554-Feb0.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful Table Tennis 2" Epoxy-covered insert decal discounted at TrophyCentral. Fast 1-2 day shipping.Ping Pong / Table Tenniscustom-pagetrophies-table-tennis-ping-pong1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%This popular Table Tennis (Ping Pong) trophy features a real marble base, column, figure and trim indicating year of award. Includes up to three lines of free engraving!qtttennisyrTable Tennis / Ping Pong, Sportscustom-pagetrophies-table-tennis-ping-pong1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with table tennis / ping pong figure discounted at TrophyCentral. Includes free text engraving!cup-ttennis-pTable Tennis / Ping Pong, Sportscustom-pagefree-sports-templates1"Download Only"free-sports4985501Trophy CentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Table Tennis template is free and designed exclusively for Trophy Central. Table Tennis certificate templates measure 11" x 8 1/2" and can be easily downloaded and printed.table tennis-certificatetable-tennis-frTable Tennis / Ping Pong, Sportscustom-pagetrophies-table-tennis-ping-pong1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Table Tennis Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Table Tennis / Ping Pong, Sportscustom-pagetrophies-table-tennis-ping-pong1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these table tennis / ping pong budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtttennisscbTable Tennis / Ping Pong, Sportscustom-pagetrophies-table-tennis-ping-pong1498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Find this budget ping pong (table tennis) award trophy discounted at Trophy Central. Features a real marble base and plastic figure. Engraving is free. Fast 1-2 day shipping.bdg-ping-pongTable Tennis / Ping Pong, Sportscustom-pagetrophies-table-tennis-ping-pong1trophies498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Table Tennis insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-Table Tennis-InsertPing Pong / Table Tenniscustom-pagetrophies-table-tennis-ping-pong1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous two-tier Table Tennis / Ping Pong Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtttennisttTable Tennis / Ping Pong, Sportscustom-pagetrophies-table-tennis-ping-pong1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-411.215Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%See this championship trophy with a Table Tennis / Ping Pong figure at TrophyCentral. Be sure to see all of our Table Tennis / Ping Pong figure awards.qtttennisttwTable Tennis / Ping Pong, Sportscustom-pagetrophies-table-tennis-ping-pong1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Table-Tennis single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - Table-TennisTable Tennis / Ping Pong, Sportscustom-pagetrophies-table-tennis-ping-pong1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:24%This popular Table Tennis / Ping Pong Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtttennisscTable Tennis / Ping Pong, Sportscustom-pagetrophies-table-tennis-ping-pong1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.05Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:15%Find These Popular Table Tennis / Ping Pong Deluxe Platform Trophies Discounted at TrophyCentral. Real Marble; Free Engraving!qtttennisdmTable Tennis / Ping Pong, Sportscustom-pagetrophies-table-tennis-ping-pong1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Table Tennis / Ping Pong figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-ttennis-scbTable Tennis / Ping Pong, Sportscustom-pagetrophies-table-tennis-ping-pong1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Table Tennis Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Table Tennis / Ping Pong, Sportscustom-pagetrophies-table-tennis-ping-pong1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-411.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous two-tier, 3-column champion Table Tennis / Ping Pong Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtttennis3cTable Tennis / Ping Pong, Sportscustom-pagetrophies-table-tennis-ping-pong1medals498553-Feb0.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this colorful Table Tennis insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Table Tennis / Ping Pong, Sportscustom-pagetrophies-table-tennis-ping-pong1medals498553-Feb0.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Table Tennis insert medal with a personalized front rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Table Tennis / Ping Pong, Sportscustom-pagecherry-insert-plaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these table tennis insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Ping Pong / Table Tennis11Find Table Tennis medals discounted at TrophyCentral Each Table Tennis and Ping Pong medal includes a free ribbons.custom-pagetrophies-table-tennis-ping-pong1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our table-tennis insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - Table-TennisTable Tennis / Ping Pong, Sportscustom-pagetrophies-table-tennis-ping-pong1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:28%Our popular Table Tennis / Ping Pong participation trophies feature a real slant-front marble base and free engraving.qtttennisncTable Tennis / Ping Pong, Sportscustom-pagetrophies-table-tennis-ping-pong1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Table Tennis Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Table Tennis / Ping Pong, Sports11custom-pageblog-trophycentral11Teacher Appreciation Week is May 5-9, 2026. Discover 12 meaningful award categories for educators, budget planning tips for schools, and an ordering countdown to make sure recognition arrives on time.custom-pageaward-medalscraponblba51-341151-782551-818670mqt-apple-dmmqt-apple-perpappreciation-award-plaqueapclaw1personalized-gifts1Find teacher appreciation trophies and gifts discounted at TrophyCentral. Add personalization for a special touch.

    Teacher Appreciation Gifts and Awards - Meaningful Recognition for Educators Who Make a Difference

    Teacher appreciation gifts carry more weight when they are personalized, because a gift that includes a teacher's name, subject, school, and a specific message communicates that the recognition was intentional rather than an afterthought picked up from a store shelf. Our teacher appreciation collection spans the full range of recognition formats and budgets, from affordable teacher appreciation trophies with apple and torch figurine designs to engraved wood and marble plaques suited for classroom or office wall display, engraved desk gifts and journals that teachers will use every day, and lapel pins that educators can wear with pride. Every gift includes free personalized engraving, making it practical for individual students and families to give a truly personal teacher gift as well as for school PTAs and administrators ordering in volume for staff appreciation events, end of year ceremonies, and teacher of the year programs. Whether you are recognizing a kindergarten teacher who inspired a love of learning, a high school coach who changed an athlete's trajectory, or a veteran educator retiring after decades in the classroom, a personalized teacher appreciation gift creates a lasting keepsake that reflects the genuine impact of exceptional teaching.

    Frequently Asked Questions About Teacher Appreciation Gifts

    What teacher appreciation gifts do teachers actually want to receive?

    Teachers consistently report that personalized gifts are among the most meaningful they receive, specifically because personalization signals that the giver invested thought rather than simply grabbing something convenient. A trophy or plaque engraved with the teacher's name, the grade or subject they teach, the school, and the year creates a keepsake that a teacher will keep for the entirety of their career and often display proudly in their classroom or home office. Practical personalized items like engraved journals, pen sets, and desk accessories rank highly because teachers use them daily and the personalization keeps the recognition visible rather than stored in a closet. Lapel pins are popular with educators who wear them on lanyards or jacket collars as a small but visible symbol of recognition they can carry throughout the school day. The common thread across all well-received teacher gifts is specificity: a gift that could have been given to anyone feels less meaningful than one that was clearly chosen with that particular teacher in mind. Including the subject they teach, a specific class year, or even the name of a student giving the gift elevates a standard recognition item into something genuinely personal.

    What should I engrave on a teacher appreciation gift?

    Teacher appreciation engraving works best when it captures the specific relationship and school year so the gift remains meaningful long after the occasion. For trophies and plaques, include the teacher's full name, their title or subject, school name, and year, for example: Mrs. Patricia Nguyen, 5th Grade Teacher, Riverside Elementary, 2024-2025, or Mr. David Chen, AP Chemistry, Jefferson High School, Teacher of the Year 2025. A brief sentiment such as Thank You for Making a Difference or Your Dedication Inspires Us All adds warmth without taking up excessive space. End of year gifts from a class can note the grade level and year: Thank You from Room 12, Third Grade, 2024-2025. Retirement gifts for teachers deserve a fuller engraving that acknowledges the scope of their career, such as Mrs. Karen Walsh, 30 Years of Dedicated Service, Oakwood School District, Retired June 2025. For gifts from individual students or families, including the student's name alongside the teacher's adds a personal connection that makes the gift even more meaningful as a keepsake the teacher will associate with a specific child for years to come.

    What is the best teacher appreciation gift for a school to give versus what a parent or student should give?

    Schools and PTAs presenting teacher appreciation gifts on behalf of the institution have different needs than individual families giving a personal end of year gift, and the right format differs accordingly. School and district-level recognition programs benefit from a consistent award format across all staff so that every teacher receives a gift of equal quality and presentation, making engraved trophies or plaques with consistent sizing and styling the practical choice for teacher appreciation week events, teacher of the year programs, and staff recognition ceremonies. A wood or marble plaque engraved with the school name and year alongside the teacher's name and award category creates a professional institutional recognition piece that looks intentional and organized rather than rushed. Individual families and students giving a personal gift have more flexibility and can lean into the personal nature of their relationship with the teacher, making desk gifts, journals, and smaller engraved items appropriate since they are scaled to a personal gesture rather than a formal institutional award. For end of year class gifts where parents pool contributions from an entire classroom, a quality engraved trophy or crystal award in the teacher appreciation design makes an impressive presentation that reflects the collective gratitude of the whole group. See our complete collections of award plaques, engraved gifts, and award pins for all available teacher appreciation recognition options.

    If you need more information before deciding, see our expert resource section:
    ]]>
    teacher-pins simenplaq
    11custom-pageteacher-appreciationbr313br297br303br271br531br550br24111Find teacher pins discounted at TrophyCentral. Each teacher pin features a clutch-pin back. Fast 1-2 day shipping.Shop with confidence at TrophyCentral We feature a huge selection of quality lapel pins in many school subjects, all at discounted prices. Need help? Our experts in Michigan and New York would be happy to assist you!]]>custom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these high-quality Teacher Recognition Award Inserts at TrophyCentral. Each Teacher Recognition Award Insert can be used to create a unique plaque, medal or trophy.517825Academic
    custom-pageteacher-appreciation1"3-6 business days with engraving, Without engraving: 1-3 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"plaques105503-610.4511219.65Classic MedallicsPlaquesInsert1:22%,3:24%,5:27%"School Awards" "School Products"Genuine Walnut Teacher Recognition Award Plaque with 2 Inch Insert and Free Engraving.51-7825Academic11Discover effective teacher resources for motivating students! From classroom rewards to recognition systems, find creative tools that inspire learning and celebrate student achievements.custom-pagegifts-desk-general11personalized gifts105503-610.45165.25Classic MedallicsGiftsEngraved Gifts1:22%Shop for Teacher's Apple Clock Awards from TrophyCentral.Engraved Clocks, Teacher's Award, Academiccustom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these high-quality Teacher's Award Inserts at TrophyCentral. Each Teacher's Award Insert can be used to create a unique plaque, medal or trophy.517805Academic
    custom-pageteacher-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"br24103-05-2011Academic, Teacher's Awardcustom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these high-quality Teachers The Core Of Education Inserts at TrophyCentral. Each Teachers The Core Of Education Insert can be used to create a unique plaque, medal or trophy.518388Academic, Academic
    custom-pageachievement-certificates-awards1"Download Only"free-academic49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Teaching Excellence Award template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Teaching-Excellence-Award-Certificateteaching-excellence-awardTeacher, Appreciation, Academiccustom-pagescholarship-resource-hub11Student character documentation system: weekly check-ins, monthly reviews, portfolio building. Develops self-awareness while preparing scholarship applications.custom-pagefreeawardcertificates1"Download Only"free-sports4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Team Award template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Team-Award-Certificateteam-award-freeTeam, Business, Academiccustom-pagesports-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these high-quality Team Mother Inserts at TrophyCentral. Each Team Mother Insert can be used to create a unique plaque, medal or trophy.51765412-20-2020General
    custom-pageblog-trophycentral11Season-end award strategies for youth sports teams. Universal and sport-specific categories for soccer, basketball, baseball, softball, volleyball, football.custom-pageschool-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:30%,100:35%,500:48%"School Pins" "School Lapel Pins"Find These Fabulous Teamwork Lapel Pins Discounted At Top-Rated TrophyCentral.hp2409-01-2019General, Academic, Businesscustom-pagecorporatepinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsBusiness1:30%,50:32%,100:35%,500:39%Find this Teamwork Leads To Success Pin at TrophyCentral. Lapel pins feature a high quality finish and clutch back, Fast 1-2 day shipping.br535Business, General, Academiccustom-pageeawardmedals12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    medals105503-60.75130033.75Classic Medallicsaward-medalsGeneral1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "School Medals" "General Award Medals"These inexpensive 1 1/4 inch Teamwork Medals offer a high quality, but low price for those on a tight budget.e9196General, Business, Academic
    custom-pagegeneral-corporate-awards1plaques498552-41JDSPlaques1Find this Teamwork Plaque discounted at TrophyCentral. Our teamwork plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Teamworkcustom-pagecorporatepinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsBusiness1:30%,50:32%,100:35%,500:39%Find these Teamwork Wins the Race Pins discounted at TrophyCentral. Each lapel pin features a gold finish and clutch-back. Fast shipping!br520Businesscustom-pagemedallion-inserts-general-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these quality Television Inserts (Litho) at TrophyCentral. Each Television Insert can be used to create a unique plaque, medal or trophy.507407Occupations
    custom-pagepickleball-trophiestennis-plaque-i49-7649tennis-u-pbtennis-ei1trophies1"Tennis Awards" "Sports Trophies"

    Find Custom Tennis Recognition Trophies and Awards with Ease at Trophy Central

    Trophy Central has an industry-leading selection of tennis trophies and plaques. Be sure to see our popular Motion Xtreme Series and column trophies. All of our trophies include up to three lines of FREE ENGRAVING (larger awards include additional lines). Medals include a free ribbon.

    Shop with Confidence at Trophy Central

    If you are looking to buy online, look no further! Our top-rated representatives are happy to assist you with all of your needs. Our experts in New York and Michigan have been providing suggestions and guidance since 1999, serving over 370 Fortune 500 companies and more than 9,600 educational institutions.
    Do you need help selecting a trophy or choosing engraving? Be sure to see our trophy resources:

    Frequently Asked Questions

    What engraving options are available for tennis awards?

    All tennis trophies include free engraving services where you can add player names, tournament titles, dates, team names, and personalized messages. Our expert engraving team ensures crisp, professional lettering that enhances your plaques or insert medals' appearance and creates a meaningful keepsake.

    How quickly can tennis trophies be shipped?

    Most tennis medals and trophies ship within 1-2 business days after engraving is completed, with expedited options available for urgent tournaments or events. Orders over $99 qualify for free shipping, and we work with reliable carriers like UPS to ensure your trophies and plaques arrive safely and on time.

    Do you offer bulk discounts on tennis awards?

    Yes. We pride ourselves on providing low prices and bulk discounts on large tournaments or team orders, helping you save more while maintaining award quality. Call or email our team for custom quotes on bulk purchases, and we'll ensure you get the best value for your tennis recognition needs.

    Can I see examples of engraving layouts before ordering?

    Our page features engraving guides and samples of our tennis medals to help you visualize different designs and layout options for your tennis trophies. Our customer service team can also provide personalized assistance and suggestions to ensure you make an informed choice and get an engraving that looks perfect and captures the achievement appropriately.
    ]]>
    silver-cup-trophies 1st-place-medals
    custom-pagesports-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Tennis Medals"Buy these quality Tennis (GENERAL) Inserts (Litho) at TrophyCentral. Each 2 inch Insert can be used to create a unique plaque, medal or trophy.497649Tennis, Sports
    custom-pagetrophies-tennis1trophies498551-310.452429Trophies1Find this popular Tennis trophy discounted at TrophyCentral. Features a real marble base, free engraving and fast shipping.tennis-cup-place-trophy-tccustom-pagetrophies-tennis1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%"Tennis Trophies" "Tennis Trophy" "Trophies, Tennis" "Tennis Awards"Find this popular 1st, 2nd or 3rd place tennis trim trophy, with marble base and free personalization, discounted at trophyCentral. Ships in a fast 1-2 days!qttennisplSee other greatfor your leagues and tournaments!trophies-tennisTennis, 1st / 2nd / 3rd / Etc., Sportscustom-pagetrophies-tennis20498552-40.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful Tennis 2" Epoxy-covered insert decal discounted at TrophyCentral. Fast 1-2 day shipping.Tennis, Sportscustom-pagetrophies-tennis1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%"Tennis Trophies" "Tennis Trophy" "Trophies, Tennis"This popular Tennis trophy features a real marble base, column, figure and trim indicating year of award. Features free engraving!qttennisyrTennis, Sportscustom-pagetrophies-tennis1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with tennis figure discounted at TrophyCentral. Includes free text engraving!cup-tennis-pTennis, Sportscustom-pagetrophies-tennis1medals498552-30.525033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Tennis Racket 2 1/4" Antique Gold Medal Discounted at TrophyCentral. Each medal features a free ribbon. Fast shipping!Tennis, Sportscustom-pagefree-sports-templates1"Download Only"free-sports49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Tennis template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Tennis-Certificatetennis-freeTennis, Sportscustom-pagetrophies-tennis11Creative tennis award ideas with engraving examples for your team banquet. From Ace Machine to Dig Master, discover 15+ unique ways to recognize every player with actual trophy wording templates.custom-pagetrophies-tennis12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    "PT1=Medals" "PC12=105503-60.75130033.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,100:28%,500:34%,1000:45%"Tennis Awards" "Tennis Medals"These inexpensive 1 1/4 inch Tennis Medals offer a high quality, but low price for those on a tight budget.tennismedals102-15-2015Tennis, Sports
    11Complete guide to tennis awards, tournament recognition, and trophy selection. Learn about professional and amateur tennis awards, USTA programs, and how to celebrate tennis achievements at every level.custom-pagetrophies-tennis1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Tennis Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Tennis, Sportscustom-pagetrophies-tennis1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these tennis budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqttennisscbTennis, Sportscustom-pagetrophies-tennis1498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Find this budget tennis award trophy discounted at Trophy Central. Features a real marble base and plastic male or female tennis figure. Engraving is free. Fast 1-2 day shipping.bdg-tennisTennis, Sportscustom-pagetrophies-tennis1trophies498552-411229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find this tennis champion's cup trophy discounted at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's Cup - TennisTennis, Sportscustom-pagetrophies-tennis1trophies498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Tennis insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-Tennis-InsertTennis, Sportscustom-pagetrophies-tennis1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%"Tennis Trophies" "Tennis Trophy" "Trophies, Tennis"Find these fabulous two-tier Tennis Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qttennisttTennis, Sportscustom-pagetrophies-tennis1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.215Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%"Tennis Trophies" "Tennis Trophy" "Trophies, Tennis"See this championship trophy with a Tennis figure at TrophyCentral. Be sure to see all of our Tennis figure awards.qttennisttwTennis, Sportscustom-pagetrophies-tennis1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Tennis single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - TennisTennis, Sportscustom-pagetrophies-tennis1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%"Tennis Trophies" "Tennis Trophy" "Trophies, Tennis"This popular w/Tennis Figure Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qttennisscSee our complete selection of popularin large variety of styles and sizes.trophies-tennisTennis, Sportscustom-pagesports-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Tennis Medals"Buy these quality Tennis Court Inserts (Litho) at TrophyCentral. Each Tennis Court Insert can be used to create a unique plaque, medal or trophy.507392Tennis, Sports
    custom-pagetrophies-tennis1trophies498551-311821.06TrophyCentraltrophies1Tennis, Sportscustom-pagetrophies-tennis1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451623.65Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%"Tennis Trophies" "Tennis Trophy" "Trophies, Tennis"These quick-ship trophies from TrophyCentral feature a Tennis figure, real marble base and marble trophy figure platform, choice of column size and color.qttennisdmTennis, Sportscustom-pagesports-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Tennis Medals"Buy these quality Tennis Female Inserts (Litho) at TrophyCentral. Each Tennis Female Insert can be used to create a unique plaque, medal or trophy.502079Tennis, Sports
    custom-pagetrophies-tennis1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Tennis figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-tennis-scbTennis, Sportscustom-pagetrophies-tennis1trophies498551-310.71217.38trophies1Tennis, Sportscustom-pagetrophies-tennis1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Tennis Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Tennis, Sportscustom-pagetrophies-tennis1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%"Tennis Trophies" "Tennis Trophy" "Trophies, Tennis"Find these fabulous two-tier, 3-column champion Tennis Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qttennis3cReturn to the section for more popular awards.trophies-tennisTennis, Sportscustom-pageholographic-insert-plaques1"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498852-310.45811.6Quick TrophyPlaquesInsert1:14%,3:14%"Tennis Awards"See this stunning Tennis plaque and other Holographic Plaques at TrophyCentral.qsinplaqtennisTennis, Sportscustom-pagetrophies-tennis1medals498552-30.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Colorful Tennis insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Tennis, Sportscustom-pagetrophies-tennis1medals498552-40.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Tennis insert medal With A Personalized Front Rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Tennis, Sportscustom-pagecherry-insert-plaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these tennis insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Tennis, Sportscustom-pagesports-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Tennis Medals"Buy these quality Tennis Inserts (Litho) at TrophyCentral. Each Tennis Insert can be used to create a unique plaque, medal or trophy.505631Tennis, Sports
    custom-pagesports-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Tennis Medals"Buy these quality Tennis Male Inserts (Litho) at TrophyCentral. Each Tennis Male Insert can be used to create a unique plaque, medal or trophy.506171Tennis, Sports
    1sports-medals1Shop Tennis Medals for players and teams. Customize with engraving. Affordable, fast shipping, and perfect for tennis tournaments and school events.

    Our collection of tennis medals is designed to celebrate every serve, rally and victory. Whether you are hosting a school tournament, rewarding a recreational league or recognizing outstanding performance at a championship, we have the perfect tennis medal to fit the occasion.

    Choose from classic gold, silver and bronze tennis medals, or add a personal touch with custom engraving and colorful ribbons. These medals make lasting keepsakes for players of all ages and levels. With affordable prices and fast shipping, you can count on us to help make your award ceremony a success.

    From junior competitions to high school, college or club events, tennis medals are a timeless way to recognize dedication, sportsmanship and achievement on the court.

    ]]>
    trophies-tennis
    custom-pagesports-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-40.3713003.37Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Tennis Medals"Buy these quality Mylar Tennis Decal Inserts at TrophyCentral. Each tennis decal can be used to create a unique plaque, medal or trophy.489656Tennis, Sports
    custom-pagetrophies-tennis1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our tennis insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - TennisTennis, Sportscustom-pagetrophies-tennis1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%,25:23%,50:29%,100:34%"Tennis Trophies" "Tennis Trophy" "Trophies, Tennis" "Tennis Awards"Our Tennis Participation Trophies feature a real slant-front white marble base and free personalization. Significant quantity discounts available.qttennisncSee more greathere.trophies-tennisTennis, Sportscustom-pagetrophies-tennis1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.4234Quick TrophyTrophies11:14%,3:15%,10:16%"Tennis Awards" "Tennis Trophies"Find this Perpetual Tennis Trophy Discounted at TrophyCentral. Each Trophy has enough room for 32 names. Ships in just 1-2 days.qttennisperpTennis, Sportscustom-pagekeychains21105502-40.39125035.39Classic MedallicsGiftsKeychains1:22%,10:25%,25:32%,50:39%,100:47%"Tennis Awards"Find these popular Pewter Tennis Key Chains at TrophyCentral; discounted prices!pk58-cmKeychainscustom-pagetrophies-tennisplastic-pinbox-t5lapel pins498551-20.525040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find this Gold Tennis Enamel lapel pin discounted at TrophyCentral. Features a clutch-pin back for easy attachment to clothing.. Fast 1-2 day shipping.tennis-u-pbTennis, Sportscustom-pagetrophies-tennis1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Tennis Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Tennis, Sportscustom-pageofficesigns11"2-3 business days" "Roanoke, Virginia" "UPS (FedEx available on request)"240162-310.455015.45RoanokeOffice Signs1Find tent signs and table number signs discounted at TrophyCentral. Choose sign and lettering color. Each medal includes a neck ribbon. Fast 1-2 day shipping.objid-from-string-test11custom-pageyswtest2111noindexed-items111noindexed-items11Testimonials for TrophyCentral - See what our customers have to say about us. TrophyCentral is a top-rated Yahoo merchant with incredible customer service!custom-pagegeneral-corporate-awards1"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"458221510.45416.45Vision AwardsTrophies1:22%,26:25%"New Products"Find the Tetra Award at TrophyCentral. The Tetra and all corporate awards are discounted and included engraving.custom-pagename-badges-tagswoyoulipr100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Texas Shaped Badges Discounted At TrophyCentral.namebadges-texascustom-pagetrophies-swimming-divingplasticpinboxvelapinbox10star-pins"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"105502-30.31021300060.3Classic Medallicslapel-award-pins1:22%,100:38%,250:42%,500:52%,1000:59%Find These Gold Star Pins Discounted At TrophyCentral! Each Gold Star Pin Includes A Clutch-Back. Large Quantity Discounts.star-pinscustom-pageappreciation-templates1"Download Only"free-appreciation4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Thank You Award template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Thank-You-Award-Certificatethank-you-award-freeThank You, Volunteer, Appreciationcustom-pageawardcertificates1thankyou1thankyoucertificates290631-31 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,25:25%,100:36%,500:51%Find this thank you certificate discounted at TrophyCentral. Thank you certificates are beautifully printed and measure 11 x 8 1/2 inches.963Academic, Thank Youcustom-page9631"Download Only"free-appreciation49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"See this Thank You Certificate designed exclusively for TrophyCentral! Thank You Certificates can be downloaded for free!thankyouThank You, Volunteer, Appreciationcustom-pagevolunteerpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsBusiness1:30%,50:32%,100:35%,500:39%Find these Thank You lapel pins discounted at TrophyCentral. Each Thank You pin features a beautiful finish and clutch back.br380Thank You, Volunteer, Generalcustom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsGeneral1:22%Buy these high-quality Thank You Inserts at TrophyCentral. Each Thank You Insert can be used to create a unique plaque, medal or trophy.518157Volunteer, Thank You
    custom-pagetrophies-volunteer1plaques498552-41JDSPlaques1Find this Thank-You Plaque discounted at TrophyCentral. Our thank-you plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Thank Youcustom-pagewalnut-insert-plaques1"3-6 business days with engraving, Without engraving: 1-3 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"plaques105503-610.4511219.65Classic MedallicsPlaquesInsert1:22%,3:24%,5:27%Genuine Walnut Thank You Plaque with 2 Inch Insert and Free Engraving.51-8157Thank Youcustom-pagetrophies-volunteer11trophies498552-50.452417.49Classic MedallicsTrophiesGeneral1:22%,5:23%,10:25%,20:26%Shop for Thank You Trophies from TrophyCentral. A Perfect Thank You Trophy for Volunteers.Volunteercustom-pageblog-trophycentral11Transform Thanksgiving into meaningful employee recognition. 10 proven strategies from service awards to peer nominations. Budget tips and presentation guide.custom-pagecrystalcups11"7-10 business days w/engraving" "Kentucky" "UPS (FedEx available on request)"410187-1010.45432.45JcharlesTrophies1:22%,25:24%Find This Aspire Award Discounted At TrophyCentral. Price Of The Aspire And Other Trophies Includes Engraving!custom-pageblog-trophycentral11The Class of 2026 earned their graduation the hard way. Discover why this milestone deserves a lasting keepsake and how the right commemorative pin carries their story forward.11Ultimate guide to fantasy football awards covering championship trophies, consolation prizes, punishment awards, and creative recognition ideas for league commissioners and players.11Comprehensive guide to award plaques covering materials (wood, acrylic, crystal), engraving options, design choices, and recognition strategies for teachers, coaches, and event planners.11Master perpetual trophy and plaque selection with our comprehensive guide covering design options, materials, sizing, maintenance, and long-term recognition strategies.custom-pagetrophy-award-guides11Learn how to plan memorable award ceremonies with our comprehensive guide. Get expert tips on venue selection, timing, presentation best practices, and creating meaningful recognition events that inspire and motivate.11Master ribbon selection with our comprehensive guide covering ribbon types, materials, sizing, colors, and attachment methods for sports, academic, and corporate events.11Comprehensive guide to football awards for young athletes covering trophies, medals, ribbons, and recognition ideas from Pee Wee leagues through high school football programs.11Discover the complete guide to award medal types, from Olympic-style medals to academic recognition and sports awards. Learn about materials, designs, customization options, and how to choose the perfect medal for any achievement.custom-pageaward-ribbons-rosettes1award-ribbons-rosettes1Master ribbon color selection with our comprehensive guide covering traditional place colors, sports ribbons, academic awards, and awareness ribbon meanings for every recognition need.custom-pagetrophies-football1perpetual-plate-for-goat-trophytrophies458227-1012.5230.5VisionsTrophies1"General Recognition Awards"Celebrate the Greatest player or performer of All Time with this perpetual cast resin GOAT award with bronze tone and matte black finishes. Engraving included.custom-pageglass-crystal-awards1"10-15 business days w/engraving" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"general105505-1010.451 2 3 4 5 6 7 8 91420.45Classic MedallicsCrystal Awards1:22%,25:24%Shop for The Matterhorn Trophies from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.Leadershipcustom-pagecoaching-teaching-guides11Recognition strategies that actually motivate performance. Learn when to use trophies vs. verbal acknowledgment across workplace, education, and volunteer contexts. Budget-friendly options included. custom-pageemployee-resource-hub11A comprehensive case study on happiness, its psychological and physiological basis, and how to make people smile.11Discover the world of lapel pins! From sports trading pins to corporate recognition, learn about pin types, designs, and how these tiny treasures make big impacts.custom-pageacademic-resource-hub11Complete guide for PTA and PTO parents covering creative fundraising ideas, volunteer recognition, custom lapel pins, ribbons for events, and building school community spirit.custom-pageglass-crystal-awards1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"general410187-1013423JcharlesCrystal Awards1:22%,25:23%Find the Vanguard award discounted at TrophyCentral. The Vanguard combines eye-catching angles to portray movement and good design.custom-pagecrystalgifts1optionallogo101"5-10 business days w/engraving" "Mt. Vernon, NY" "UPS (FedEx available on request)"general105505-1010.451856.45Classic MedallicsCrystal Awards1:30%,5:36%Shop for Thick Jaded Glass Clock from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.12-20-2040custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality Third Infantry Division Inserts at TrophyCentral. Each Third Infantry Division Insert can be used to create a unique plaque, medal or trophy.515112Military, Hero, Army
    custom-pagemedallion-inserts-general-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    "PT1=Medals" "G=Unisex" "SC1=105502-4130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these high-quality Third Place Inserts at TrophyCentral. Each Third Place Insert can be used to create a unique plaque, medal or trophy.5134613rd Place
    custom-page1st-place-medals12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    medals105503-60.751 2 3 4 5 6 7 8 9130042.75Classic Medallicsaward-medalsGeneral1:22%,25:24%,50:30%,100:36%,500:42%Shop for Third Place Torch Medals at TrophyCentral. Fast 1-2 Day Shipping!tm9917bSports, Academic, General, Torch, Achievement, 1st / 2nd / 3rd / Etc.
    custom-pagebaseballdisplay11"7-10 business days w/Logo, 4-6 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 2311857Perfect CaseDisplay Cases11:14%,5:17%Three Baseball Glass Display Case. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.basedisplay-310-16-2017Baseball / T-Ball, Sports11Shop for two-tier, three column trophies at TrophyCentral. Each trophy is discounted and includes engraving.1custom-pagehockeypuckdisplays1"7-10 business days w/Logo, 4-6 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 2311841Perfect CaseDisplay Cases11:14%,5:17%Three Hockey Puck Glass Display Cases from TrophyCentral.hockeydisplay-3Hockey, Sportscustom-pageribbons1rtp6621rtp6615rtp6616rtp6610rtp6617rtp6620rtp6622rtp6612rtp6623rtp6609rtp6619rtsp694rtsp40921ribbons11"School Products" "Quick-Ship Items" "Homecoming Sashes" "Sashes" "Homecoming Sash" "School Sashes" "Pageant Sashes" "Custom Sashes" "Beauty Pageant Sashes" "Graduation Sashes" "Pageant Sash" "Prom Sashes" "Prom Sash"Find beautiful tiaras for proms, homecoming, and weddings. Elegant design, classic and elaborate styles. Bulk discounts. Fast 1-2 days shipping. Order today!Tiaras for Homecoming, Proms, Pageants, and Wedding days Trophy Central offers various prom and homecoming tiaras to suit any style. From classic designs that sparkle with faux diamonds to more elaborate options, our collection has something for everyone. We also offer princess and queen tiaras, perfect for girls of all ages, all at discounted prices.

    Find a Tiara Online with Ease

    Trophy Central has a great selection of inexpensive but fancy plastic crowns that will fit any budget. Our top-rated representatives are happy to assist you with your questions and needs. Our experts in New York, Michigan, and online have been providing suggestions and guidance since 1999. To begin shopping, click on an image above, or for personal service, call us toll-free at 1-888-809-8800.

    Frequently Asked Questions

    Do queen tiaras come in different sizes?

    Yes, our queen tiaras feature adjustable designs and come in various size options to ensure a comfortable and secure fit for different head sizes.

    Will tiaras and crowns match different dress colors?

    Our elegant designs are versatile and complement virtually any outfit you wear. They feature timeless style elements that enhance rather than compete with your attire. Their timeless elegance ensures they complement a wide range of palettes, while crystal accents provide a subtle shine.

    Are these tiaras suitable gifts for special occasions?

    Absolutely, these princess crowns make exceptional present choices for daughters, granddaughters, or anyone celebrating milestones, moments like birthdays and graduations, as well as family celebrations.

    Do you offer discounts, and how fast do items ship?

    Yes, we offer bulk discounts on larger orders, and most in-stock items ship within 1–2 business days.

    ]]>
    banners-spirit ribbons1-crowns
    custom-pagemascot-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Tiger Mascot Badges Discounted At TrophyCentral.mascotbadges-tigercustom-pagemascotpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:30%,100:33%,500:47%"Mascot Awards" "Mascot Pins"Find these Tiger Lapel Pins and other colorful mascot pins at TrophyCentral. Fast 1-2 day shipping!em06Mascotcustom-pagemascot-plaques1plaques498552-41JDSPlaques1Find this tiger plaque discounted at TrophyCentral. Our tiger mascot plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Mascotcustom-pagemascotinserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-40.3713003.37Classic MedallicsInsertsMascots1Buy these quality Tigers Mascot Medal Inserts at TrophyCentral. Each Tigers Insert can be used to create a unique plaque, medal or trophy.489923Mascot
    custom-pagetrophy-resource-guides11Discover expert tips for arranging trophies and awards in a case. Learn how to create balance, highlight achievements, and design a stunning display that stands out.custom-page12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105503-615013.5award-medals1"School Medals" "School Award Medals" "Scholastic Medals" "Scholastic Award Medals" "Academic Medals" "Academic Award Medals" "Medals, School"Your students will love these colorful, Mylar School Medals from TrophyCentral. Medals are available in a large number of subjects and include neck ribbon.tm-medals-all
    custom-pagetrophies-funny-horses-rear1trophies498552-310.45Trophy CentralTrophies1Find this popular toilet bowl figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!Toilet Bowlcustom-pagetrophies-funny-horses-rear1trophies498552-31Trophy CentralTrophies1Find these toilet bowl budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Toilet Bowlcustom-pagetrophies-funny-horses-rear1trophies498552-30.45Trophy CentralTrophies1Find this budget toilet bowl award trophy discounted at Trophy Central. Features a real marble base and plastic toilet bowl figure. Engraving is free. Fast 1-2 day shipping.Toilet Bowlcustom-pagetrophies-funny-horses-rear1trophies498552-310.75Trophy CentralTrophies1Find these fabulous two-tier toilet bowl three-column trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!Toilet Bowlcustom-pagetrophies-funny-horses-rear1trophies498552-310.45Trophy CentralTrophies1This popular toilet bowl award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.Toilet Bowlcustom-pagetrophies-funny-horses-rear1trophies498552-310.45Trophy CentralTrophies1These quick-ship trophies from TrophyCentral feature a toilet bowl figure, real marble base and marble trophy figure platform, choice of column size and color.Toilet Bowlcustom-pagetrophies-funny-horses-rear1trophies498552-310.45Trophy CentralTrophies1Our toilet bowl participation trophies feature a real slant-front white marble base and free personalization. Significant quantity discounts available.Toilet Bowlcustom-pagetrophies-funny-horses-rear1perpetual trophies498552-311.4Trophy CentralTrophies1Find this Perpetual Toilet Bowl Trophy Discounted at TrophyCentral. Each Trophy has enough room for 32 names. Ships in just 1-2 days.Toilet Bowlcustom-pagename-badges-tagswoyoulipr100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Tooth Shaped Badges Discounted At TrophyCentral.namebadges-toothtrophy-and-award-buying-lists11Discover the top 10 baseball trophies, medals, and awards for Little League and youth teams. Free engraving, fast shipping, and quality recognition for every player.11Discover the best unique trophies and medals for hunting clubs, trap shooting leagues, skeet competitions, and gun club marksmanship events. Free engraving on trophies, free ribbons on medals.trophy-and-award-buying-lists11Discover the top 10 soccer trophies, medals, and awards for youth leagues and tournaments. Free engraving, fast shipping, and quality recognition for every player.trophy-and-award-buying-lists11Explore 12 outstanding volunteer awards from Trophy Central, perfect for recognizing the dedication of community and student volunteers.trophies-volunteertrophy-and-award-buying-lists11Explore the top 14 awards for high-performing students available at TrophyCentral. Each award is designed to recognize and motivate students for their academic achievements and efforts.trophies-academictrophy-and-award-buying-lists11Explore the top 7 hilarious awards for Fantasy Sports losers. Perfect for adding humor to your fantasy league with these funny trophies and plaques from TrophyCentral.fantasy-trophies-awardstrophy-and-award-buying-lists11Discover the best science fair awards available at Trophy Central, perfect for school science competitions. Browse top trophies, plaques, and ribbons to motivate and recognize student achievements.scienceawardscustom-pagetop-awards-by-category11A comprehensive guide to top academic awards for high school students, including national scholarships, subject-specific recognition, and more.custom-pagetop-awards-by-category11Learn about the top basketball awards in the US, from high school to the professional level. Discover the most prestigious honors, their history, and key players who have won them.1custom-pagetop-awards-by-category11Explore the top high school football teams for the 2024 season, featuring standout players and previous national champions. 1custom-pagefreeawardcertificates1"Download Only"certificates49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Top Performer template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Top-Performer-Certificatetop-performer-freePerforming Arts, Academiccustom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these high-quality Top Producer Award Inserts at TrophyCentral. Each Top Producer Award Insert can be used to create a unique plaque, medal or trophy.518667Occupations
    custom-pagecorporatepinsplasticpinboxvelapinbox5"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsBusiness1:30%,50:32%,100:35%,500:39%"Music Lapel Pins"Find these Top Producer Pins discounted at TrophyCentral. Each lapel pin features a gold finish and clutch-back. Fast 1-2 day shipping!br555Businesscustom-pagetop-awards-by-category11A comprehensive guide to top swimming awards for high school students, including national and international recognitions and scholarships.custom-pagetop-awards-by-category11Explore the top track and field awards for high school students. Learn about prestigious honors that recognize athletic excellence in track events, field events, and more. custom-pagemedallion-inserts-general-medallion-inserts20498552-40.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful Torch 2" Epoxy-covered insert decal discounted at TrophyCentral. Fast 1-2 day shipping.Torch, 1st / 2nd / 3rd / Etc.custom-pagenew-tc-gold-medals11st-place-medalsmedals498552-30.525033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Victory Torch 2 1/4" Antique Gold Medal Discounted at TrophyCentral. Each medal features a free ribbon. Fast shipping!Torch, 1st / 2nd / 3rd / Etc.custom-page1st-place-medals1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Torch Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Torchcustom-pagetrophies-academic1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511230.45Classic MedallicsTrophiesGeneral1:22%,6:23%,12:24%,24:26%Shop for Cast Stone Achievement Torch Awards at TrophyCentral. We have a great selection of Achievement Torch and other recognition trophies at discounted prices.tr9910Academic, Generalcustom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceCertificates / CoversEmbosser Seals1:22%,3:28%,5:31%Find these Torch Certificate Seals Discounted at TrophyCentral. Seals are Easy to Apply with a Pressure-Sensitive Backing. Fast shipping!803dtGeneralcustom-pagetorch-trophies1trophies498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Torch insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-Torch-InsertTorch, 1st / 2nd / 3rd / Etc.custom-pagetorch-trophies1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Torch single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - TorchTorchcustom-pagetorch-trophies1trophies498551-311821.06TrophyCentraltrophies1custom-pagecustommedals50"Standard Service: 8 Business Days from Receipt of Artwork, Rush Service (Extra Charge): 3 Business Days from Receipt of Artwork" "Oxnard, CA" "UPS (FedEx available on request)"medals930335-1010.630033.6Simba Calaward-medalsSports, Hobby, Org, Livestock1:22%,300:40%,500:51%,1000:54%These 2 1/2 inch custom Torch Medals come with an outer-ring which allows you to add your school or league name, date and location.qcm-48Generalcustom-page1st-place-medals1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"medals498852-30.38150030Quick TrophyDog TagsSports, Hobby, Org, Livestock1:14%,10:15%Find these Torch Dog Tags Discounted at TrophyCentral. The price of each torch dog tag includes Custom Engraving and Chain!qtdogtorchGeneralcustom-pagetorch-trophies1trophies498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Torch Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Torchcustom-pagemedallion-inserts-general-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these high-quality Torch Hand Scroll Inserts at TrophyCentral. Each Torch Hand Scroll Insert can be used to create a unique plaque, medal or trophy.51764812-20-2020General
    custom-pagenew-tc-color-medals11st-place-medalsmedals498552-30.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Colorful Torch insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Torchcustom-pagetorch-trophies1trophies498552-40.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Torch insert medal With A Personalized Front Rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Torchcustom-pagecherry-insert-plaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these torch insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.1st / 2nd / 3rd / Etc., Torchcustom-pagetorch-trophies1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these torch insert plaques with a large engraving plate discounted at TrophyCentral. Price includes free text engraving.1st / 2nd / 3rd / Etc., Torchcustom-page1st-place-medals1105502-41130025Classic MedallicsInsertsGeneral1:22%Buy these quality Torch Medal Inserts (Litho) at TrophyCentral. Each Torch Medal Insert can be used to create a unique plaque, medal or trophy.507028Generalcustom-pageplace-medalstorch-mctorch-mc-prtorch-mgtorch-medal-goldtorch-medal-silvertorch-medal-bronzeir27me100gvictorymedalsqcm-48tm9916stm9915gtm9917bqtdogtorchj9665torch-jigftorch-jibftorch-jisfe98xxe9075z98xx1achievement-medals1

    General Achievement Torch Medals and First Place Medals

    Sometimes it is difficult to find the right medal for your event. The place and torch medals in this section are perfect for any occasion. Olympic-style medals are widely recognized and are available in multiple styles - traditional gold, silver and bronze finishes or in full color. Torch and achievement medals are also available in 1st through 6th place designs. Remember, each torch medal includes a free neck ribbon! Whether the medals are for a family reunion or school field day event winners, these inexpensive, but high-quality, reward medallions are sure to be well received. Add some fun to your next event or practice by including some fun facts found on the TrophyCentral Olympics Infographic!

    You can share this graphic on your website as long as you include attribution to http://www.trophycentral.com/1st-place-medals.html with the graphic. Thanks!

    Fun Olympics Facts


    ]]>
    1st / 2nd / 3rd Place, Torchstar-medals torch-trophies
    custom-pagetorch-trophies1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our torch insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - Torch AchievementTorchcustom-page1st-place-medals1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Torch Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Torchcustom-pageaward-medalstorch-e-part-itorch-e-single-itorch-single-itorch-part-itorch-champ-itorch-plaque-itorch-plaque-iftr9910cup-torch-in1achievement-trophies1Find torch trophies and awards discounted at TrophyCentral. Each torch trophy includes 3 lines of personalization. Fast 1-2 day shipping.

    Custom Torch Trophies & Awards

    Click on a product image above for more details such as size and color options. We offer large quantity discounts and fast 1-2 day shipping.

    Shop with Ease at TrophyCentral

    To start shopping, use our search bar above, or for personal service, call us toll free at 1-888-809-8800. Our reps in Michigan, NY and online would be thrilled to assist you!
    ]]>
    trophies insert-trophies-awards trophies-victory
    custom-pagehigh-end-awards1"14 business days" "Erlanger, KY" "UPS"general410187-1010.451 2 3 4 5 6 7 8 9428.45JcharlesGeneral Awards1:22%,25:24%Find the Torchier Award discounted at TrophyCentral. These magical pieces feature lyrical swirls, rhythmic patterns of suspended air bubbles, and free flowing forms that make for fascinating conversation pieces.07-25-2020custom-pagemascotinserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-40.3713003.37Classic MedallicsInsertsMascots1Buy these quality Tornados Mascot Medal Inserts at TrophyCentral. Each Tornados Insert can be used to create a unique plaque, medal or trophy.489920Mascot
    custom-pagesports-inserts1105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Touchdown Football Litho Medal Insert. Ideal for leagues, schools, and tournaments. Fast shipping.507440Sportscustom-pagetrophies-track-field1trackmedals1 1041 eventribbons 9x12cherryp sports"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular track figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at trophyCentral. Ships in a fast 1-2 days!qttrackplcustom-pagetrophies-track-field1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1cup-track-pcustom-pagetrophies-track-field1medals498552-30.525033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Track and Field Runner 2 1/4" Antique Gold Medal Discounted at TrophyCentral. Each medal features a free ribbon. Fast shipping!custom-pagefree-sports-templates1"Download Only"free-sports49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Free-female-track-and-field-certificatefemale-track-and-field-freecustom-pagefree-sports-templates1"Download Only"free-academic49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Free-male-track-and-field-certificatemale-track-and-field-freecustom-pagetrophies-track-field1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1mqttrackscbcustom-pagesporcer1trackfrcertificates290631-21 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,25:27%,100:40%,500:50%"Track Awards"1041custom-pagetrophies-track-field1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous two-tier Track Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qttrackttcustom-pagetrophies-track-field1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.215Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%See this championship trophy with a Track figure at TrophyCentral. Be sure to see all of our Track figure awards.qttrackttwcustom-pagetrophies-track-field1trackmedals1 1041 eventribbons 9x12cherryp sports"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%qttracksccustom-pagetrophies-track-field1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451623.65Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%qttrackdmcustom-pagetrophies-track-field1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1cup-track-scbcustom-pagetrophies-track-field1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous two-tier, 3-column champion Track Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qttrack3ccustom-pagetrophies-track-field1trackmedals1 1041 eventribbons 9x12cherryp sports"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%,25:23%,50:29%,100:34%qttrackncSee more greatin a large variety of sizes and styles for individuals and teams.trophies-track-fieldcustom-pagetrophies-track-field12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Track (GENERAL) Inserts (Litho) at TrophyCentral. Each Track (GENERAL) Insert can be used to create a unique plaque, medal or trophy.506641
    custom-pagetrophies-track-field1trophies498551-310.452429Trophies1Find this popular Track trophy discounted at TrophyCentral. Features a real marble base, free engraving and fast shipping.track-cup-place-trophy-tccustom-pagetrophies-track-field20498552-40.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful Track 2" Epoxy-covered insert decal discounted at TrophyCentral. Fast 1-2 day shipping.custom-pagetrophies-track-field1trackmedals1 1041 eventribbons 9x12cherryp"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%This popular Track trophy features a real marble base, column, figure and trim indicating year of award. Includes up to three lines of free engraving!qttrackyrcustom-pagetrophies-track-field11Creative track and field award ideas with engraving examples for meets and season banquets. From Sprint Sensation to Iron Athlete, discover 15+ unique ways to recognize track athletes with actual trophy wording templates.custom-pagefree-sports-templates1"Download Only"free-sports49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"See this Track Certificate designed exclusively for TrophyCentral! Track Certificates can be downloaded for free! Each Track Award Certificate measures 11 x 8 1/2 inches.trackfrcustom-pagetrophies-track-field1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Track Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.custom-pagetrophies-track-field1498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Find this budget track award trophy discounted at Trophy Central. Features a real marble base and plastic track / runner figure. Engraving is free. Fast 1-2 day shipping.bdg-trackcustom-pagetrophies-track-field1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.451 2 3 4 5 6 7 8 911230.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,6:23%,12:24%,24:26%Shop for Cast Stone Track Awards at TrophyCentral. We have a great selection of Track and other recognition trophies at discounted prices.tr9920Return to section.trophies-track-fieldSwimming / Diving, Sportscustom-pagetrophies-track-field1trophies498552-411229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find this track champion's cup trophy discounted at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's Cup - Trackcustom-pagetrophies-track-field1trophies498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Track insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-Track-Insertcustom-pagetrophies-track-field1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Track single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - Trackcustom-pagetrophies-track-field1trophies498551-311821.06TrophyCentraltrophies1custom-pagecustommedals50"Standard Service: 8 Business Days from Receipt of Artwork, Rush Service (Extra Charge): 3 Business Days from Receipt of Artwork" "Oxnard, CA" "UPS (FedEx available on request)"medals930335-1010.630033.6Simba Calaward-medalsSports, Hobby, Org, Livestock1:22%,300:40%,500:51%,1000:54%"Track Medals" "Track Awards"These 2 1/2 inch custom Track (Winged Shoe) Medals come with an outer-ring which allows you to add your school or league name, date and location.qcm-38custom-pagetrophies-track-field1105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Track GENERAL Female Inserts (Litho) at TrophyCentral. Each Track GENERAL Female Insert can be used to create a unique plaque, medal or trophy.504601custom-pagetrophies-track-field1trophies498551-310.71217.38trophies1custom-pagetrackpinsplastic-pinbox-t1498551-30.5200040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find this Track Gold Enamel lapel pin discounted at TrophyCentral. Features a clutch-pin back for easy attachment to clothing.. Fast 1-2 day shipping.track-u-pbcustom-pagetrophies-track-field1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Track Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.custom-pageholographic-insert-plaques1"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498852-310.45811.6Quick TrophyPlaquesInsert1:14%,3:14%"Track Awards"See this stunning Track plaque and other Holographic Plaques at TrophyCentral.qsinplaqtrackcustom-pagetrophies-track-field1medals498552-30.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Colorful Track insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.custom-pagetrophies-track-field1medals498552-40.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Track insert medal With A Personalized Front Rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.custom-pagecherry-insert-plaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these track insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.custom-pagetrophies-track-field12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these unique Track Inserts, with an "all event" design, discounted at TrophyCentral.506501
    custom-pagetrophies-track-field1105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Track Inserts (Litho) at TrophyCentral. Each Track Insert can be used to create a unique plaque, medal or trophy.492991custom-pagetrophies-track-field12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    medals105503-60.75130033.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock Bottles1:22%,100:28%,500:34%,1000:45%"Track Medals"These inexpensive 1 1/4 inch Track Medals offer a high quality, but low price for those on a tight budget.e903906-14-2019
    custom-pagetrophies-track-field12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these high-quality Track Inserts at TrophyCentral. Each Track Insert can be used to create a unique plaque, medal or trophy.517660
    11"Track Medals"See these Track Inserts at TrophyCentral; Each insert measures 2". TrophyCentral is a Top-Rated Yahoo Merchant.trackmedals211Shop for Custom Track & Field Medals with Ease at Trophy Central

    We have a huge selection, low prices, and great customer service. Feel free to call or email us. Our experts would be happy to help you choose the ideal award!

    Many track medals come in gold, silver, and bronze finishes to recognize different levels of achievement. Remember, all medals include a neck ribbon, and all orders are shipped within 1-2 business days.

    Frequently Asked Questions

    What events do your track and field medals cover?

    Our medals cover all major track and field events, including sprints, distance running, hurdles, relay races, high jump, long jump, shot put, discus, javelin, pole vault, and cross country competitions.

    Can I customize medals with our team or event information?

    Absolutely! We offer customization options that allow you to personalize ribbon colors and types to create personalized awards that reflect your organization's identity.

    Are bulk discounts available for large orders?

    Yes, our customers enjoy attractive bulk pricing discounts that make it more affordable to purchase medals for entire teams, large competitions, or multi-event meets.

    What sizes are available for medals?

    Medals come in multiple sizes, ranging from 1 1/4" to 2 3/16 inches, depending on the engraving. See each product page for exact dimensions.

    ]]>
    trackpins
    custom-pagetrophies-track-field1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our track insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - Trackcustom-pagetrophies-track-field1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.4234Quick TrophyTrophies1:14%,3:15%,10:16%"Track Awards" "Track Trophies"Find this Perpetual Track Trophy Discounted at TrophyCentral. Each Trophy has enough room for 32 names. Ships in just 1-2 days.qttrackperpSee all of our fabulousin a large variety of styles and sizes.trophies-track-fieldcustom-pagetrophies-track-fieldcl12cl42cl41ec23ec65cl50track-pbcross-country-pbcross-country-u-pbtrack-u-pb11Shop for track pins from TrophyCentral. Find a great selection of track medals and pins.track pins, track lapel pins, track awards, track awards pinsAward Pins: Track When you are looking for an inexpensive way to recognize your track stars and up and comers, the pins in the section above are just what you need. Each track pin has a clutch back for easy and safe attachment to clothing. Pins typically ship in a fast 1-2 business days.]]>trackmedals2 trophies-track-fieldcustom-pagetrackpinsplastic-pinbox-t5lapel pins498551-20.525040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find this Track Gold Enamel lapel pin discounted at TrophyCentral. Features a clutch-pin back for easy attachment to clothing.. Fast 1-2 day shipping.track-u-pbcustom-pagetrophies-track-field1"1-2 business days" "Topeka, Indiana" "UPS (Post Office Priority Mail may also be available)"ribbons465711-21 26120030.36Tower RibbonRibbons11:22%,50:46%Find track ribbons discounted at Trophy Central. Choose from 1st - 6th place, participant and more!custom-pagetrophies-track-field1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Track Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.custom-pageshop-by-categoryqttrackncmoxtfetrtr1motionwge473moxtfetrtrwbt774wbt773tr9920qttracktrtr7012tr7013qttrackperpcup-track-pchamp-cup-track-tcmarathon-champ-itrack-champ-itrack-e-part-itrack-plaque-icup-track-scb-icup-marathon-scb-icup-track-inbdg-tracktrackpinstrack-ribbonsqttrackdmqttrackttqttrackttwqttrackyrqttrackplqttrack3cqttrackscmqttrackscbcup-track-scbtrack-single-imarathon-e-single-itrack-e-single-imarathon-single-iir36e9083e7037ir15ir38ir37ir40ir39ir21ir20e9059e9042e9102e2651e9108e9105e9237e9240e9076e6491e9044e9111e9039e6973e9868e5541z9039z9046trackmedals1tm9992gj9555j9683j9672m156m157m157bm157gm157sm156bm156gm156sqcm-38tm9993gtrack-jigftrack-jisftrack-jibftrack-mctrack-mc-prtrack-mgtrack-ei492991517660504601505691502371506071506731506201506641505751506501506973track-part-itrack-cup-place-column-trophytrack-cup-place-trophy1trophies1"Track Awards" "Cross Country Awards" "Sports Trophies"Find Track Trophies Discounted at TrophyCentral. Each Track Trophy Includes Free Personalization. Medals include a ribbon.

    Custom Track Trophies

    TrophyCentral has an industry-leading selection of track and field trophies in a variety of designs - runners, finish line, stop watch and many more! Be sure to see our popular Classic Line Trophies with a Track Runner Figure, Boy's and Girl's Motion Xtreme Series Track Trophies, and our Track Participation Trophies. All track trophies include free personalization. What are you waiting for - it's time to cross the finish line!

    Shop with Confidence at TrophyCentral!

    If you are looking to buy track trophies online, look no further! TrophyCentral has an industry-leading selection that will fit any budget, all at discounted prices. Our top-rated representatives are happy to assist you with all of your track & running trophy and award needs. Our experts in New York and Michigan have been providing suggestions and guidance since 1999!
    ]]>
    trophies
    12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
    498555-8.52Use this handy UPS shipment tracker to follow your TrophyCentral package and to determine when it will arrive. Track up to 5 packages at once.
    custom-pagetrophies-track-field12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    medals105503-60.5115014Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,50:28%,100:34%,500:41%"Track Awards" "Award Medals - All Subjects" "Sports Medals" "Track Medals" "Track Ribbons"Find our Track 2" Olympic-Style J-Series Medals at a super price point at TrophyCentral. Large quantity discounts available!Track MedalsTrack Medalsj9555
    custom-pagecounty-fair-awardsqttractorncqttractorscqttractorplqttractoryrqttractorttqttractorttwqttractor3cqttractordmmqttractorscbcup-tractor-scbcup-tractor-p1trophies-livestock-farm-animals1Find Tractor Trophies discounted at TrophyCentral. Each Tractor Trophy includes free engraving. Fast 1-2 day shipping.tractor trophies, tractor trophy, tractor awards, tractor trophies and awards

    Shop For Tractor & Farm Awards With Confidence at TrophyCentral

    We offer a huge selection, discounted pricing and great customer service. Do you need help with some ideas or with ordering? Yes, we sell online, but we have real people who would love to help you! Feel free to call our customer service experts in Michigan, New York and online. TrophyCentral - delivering smiles since 1999!


    ]]>
    custom-pagenew-trophies-21trophies498551-310.452429Trophies1Find this popular Tractor trophy discounted at TrophyCentral. Features a real marble base, free engraving and fast shipping.tractor-cup-place-trophy-tccustom-pagequickshiptrophies-tractor1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Fabulous Tractor Figure Place trophy with 1st, 2nd or 3rd Place Trim, Marble Base and Free personalization. Ships in a fast 1-2 days!qttractorplcustom-pagequickshiptrophies-tractor1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%This popular Tractor Figure trophy features a real marble base, column, figure and trim indicating year of award. Includes up to three lines of free engraving!qttractoryrcustom-pagequickshiptrophies-tractor1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with tractor figure discounted at TrophyCentral. Includes free text engraving!cup-tractor-pcustom-pagequickshiptrophies-tractor1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these tractor budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqttractorscbcustom-pagequickshiptrophies-tractor1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:26%Find these fabulous two-tier Tractor Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qttractorttcustom-pagequickshiptrophies-tractor1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:28%Find this awesome Tractor Figure two-tier championship trophy discounted, and with free engraving, at TrophyCentral!qttractorttwcustom-pagequickshiptrophies-tractor1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:21%,100:24%This popular Tractor Figure Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qttractorsccustom-pagequickshiptrophies-tractor1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.05Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%Find This Popular Tractor Deluxe Platform Series Trophy Discounted at TrophyCentral. Real Marble Base. Free Personalization!custom-pagequickshiptrophies-tractor1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Tractor figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-tractor-scbcustom-pagequickshiptrophies-tractor1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.4226Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:18%,10:23%Find these fabulous Farm Tractor Champions Line Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qttractor3ccustom-pagequickshiptrophies-tractor1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:27%,100:32%Find Our Farm Tractor Figure Participation Trophies Discounted at TrophyCentral. Features A Real Marble Base And Free Personalization!qttractornccustom-pagebaseballdisplay11"7-10 business days w/Logo, 4-6 without" "Apopka, FL 32712" "UPS (FedEx available on request)"327765-101 3 22 2311413Perfect CaseDisplay Cases1:14%,5:18%Find this trading card glass display discounted at TrophyCentral. This display is great for baseball cards or any type of playing card!Baseball / T-Ball, Sportscustom-pagegeneral-corporate-awards1"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"458221510.45628.05Vision AwardsTrophies1:22%,26:34%Find the Trajectory Global Awards at TrophyCentral. Each Global Award Includes a Gift Box and Free Engraving.custom-pageaward-medalsqtshootncqtshootscqtshootdmqtshootyrqtshootplqtshootttqtshootttwqtshoot3cqttrapperpmqtshootscbcup-shoot-scbcup-shoot-pbdg-trap1trophies1Custom Trap and Skeet Shooting Recognition Trophies TrophyCentral has a great online selection of discounted Skeet Shooting and Trap Shooting trophies. Be sure to see our participation trophies, featuring a great low price. Our single column trophy with a skeet shooter figure is also a customer favorite. All of our trophies include up to three lines of free personalization (larger awards include additional lines).]]>hunting-shooting-medals silver-cup-trophiescustom-pagetrophies-trap-skeet-shooting1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular skeet shooting figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at trophyCentral. Ships in a fast 1-2 days!qtshootplcustom-pagetrophies-trap-skeet-shooting1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with trap skeet shooting figure discounted at TrophyCentral. Includes free text engraving!cup-shoot-pcustom-pagetrophies-trap-skeet-shooting1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these trap skeet shooting budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtshootscbcustom-pagetrophies-trap-skeet-shooting1trophies498551-310.453633.4trophies1Find this budget trap / skeet shooting award trophy discounted at TrophyCentral. Features a real marble base and plastic skeet shooter figure. Engraving is free. Fast 1-2 day shipping.custom-pagetrophies-trap-skeet-shooting1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous two-tier Skeet Shooting Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtshootttcustom-pagetrophies-trap-skeet-shooting1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-411.215Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%Find this awesome Trap-Skeet Shooting two tier championship trophy discounted at TrophyCentral. Add up to 3 lines of Free Personalization!qtshootttwcustom-pagetrophies-trap-skeet-shooting1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%This popular Trap Skeet Shooting Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtshootsccustom-pagetrophies-trap-skeet-shooting1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451623.65Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%Find These Popular Trap-Skeet Shooting Deluxe Platform Trophies Discounted at TrophyCentral. Real Marble; Free Engraving!qtshootdmcustom-pagetrophies-trap-skeet-shooting1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Trap Skeet Shooting figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-shoot-scbcustom-pagetrophies-trap-skeet-shooting1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-411.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous two-tier, 3-column champion Trap-Skeet Shooting Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtshoot3ccustom-pagetrophies-marksman-shooting-rifle1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.4234Quick TrophyTrophies1:14%,3:15%,10:16%Find this Perpetual Hunting / Trap / Skeet Shooting Trophy Discounted at TrophyCentral. Each Trophy has enough room for 32 names. Ships in just 1-2 days.qttrapperpReturn to thesection for other great choices.trophies-trap-skeet-shootingcustom-pagesilver-cup-trophies11"7-10 business days w/engraving" "Chicago, Illinois" "UPS (FedEx available on request)"trophies606307-101 3 230.456.8RS OwensCrystal Awards1:22%"Golf Awards" "Team Award" "Team Awards"Find this Treviso Sartor European Silver Cup Award Discounted At TrophyCentral.trsaawcu1custom-pagedisplaycases211"7-10 business days" "Connelly Springs, North Carolina" "UPS (FedEx available on request)"display case286127-1010.452.75SpartaCraftDisplay CasesSpecialty Cases11:14%Find this Tri-Column Flag Display Stand discounted at TrophyCentral. Folds flat for easy storage.Flag Casescustom-pagetrophies-track-field1105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Triathlon Inserts (Litho) at TrophyCentral. Each Triathlon Insert can be used to create a unique plaque, medal or trophy.506973custom-pageglass-crystal-awards11"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"general458221510.45312.45Vision AwardsGiftsEngraved Gifts1:22%,26:26%Find this Trident Bent Glass Award with Amethyst Accents Discounted at TrophyCentral. Price Includes Engraving and Gift Box.custom-pagepersonalizedleather-leathergifts1"4 to 7 business days w/initials or name, 10 to 14 w/logo , 3 to 5 for stock items, (rush service available – please call)" "Teaneck, NJ" "UPS (FedEx available on request)"personalized gifts498554-710.453618.45JDS IndustriesGiftsWallets1"Father's Day Gifts" "Unique Gifts" "Personalized Gifts"Find this trifold wallet discounted at TrophyCentral. Each wallet is personalized with your message. Choice of colors.Leather Wallets, Groomsmencustom-pagecrystalcups1"14 business days" "Erlanger, KY" "UPS"410187-1010.451 2 3 4 5 6 7 8 9428.45JcharlesGeneral Awards1:22%,25:24%See this beautiful Trio Vase at TrophyCentral. Vase Includes engraving. TrophyCentral is a Top-Rated Yahoo Merchant.03-29-2015custom-pagefootballdisplay11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231113Perfect CaseDisplay Cases11:14%,5:16%Triple Mini Helmet Glass Display Cases from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.Football, Sportscustom-pagemascotpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:30%,100:33%,500:47%"Mascot Awards" "Mascot Pins"Find these Trojan Lapel Pins and other colorful mascot pins at TrophyCentral. Fast 1-2 day shipping!em1611-21-2009Mascotcustom-pagemascot-plaques1plaques498552-41JDSPlaques1Find this trojan plaque discounted at TrophyCentral. Our trojan mascot plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Mascotcustom-pagemascottrophies1"4-6 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies498553-610.451016.25Classic MedallicsTrophiesAcademic1:22%,5:24%,10:28%,50:32%"Mascot Awards"Buy this Trojan mascot trophy and other mascot awards at TrophyCentral.mt201504-15-2018Mascotcustom-pagemascotinserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-40.3713003.37Classic MedallicsInsertsMascots1Buy these quality Trojans Mascot Medal Inserts at TrophyCentral. Each Trojans Insert can be used to create a unique plaque, medal or trophy.489930Mascot
    custom-pagemusicartpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsMusic, Drama, Art, Dance1:22%,50:30%,100:33%,500:45%"Music Lapel Pins" "Band Lapel Pins" "Music Pins"Find These Trombone Pins Discounted at TrophyCentral. Each Trombone Pin Features a Clutch-Pin Back and Fast 1-2 Day Shipping!mp10Music / Band / Choruscustom-pagetrophies-golf1"10 business days" "Aliquippa, PA" "UPS"trophies1500110-1410.451236.45Glass AmericaCrystal AwardsSports, Hobby, Org, Livestock1:22%,10:25%Troon Golf Awards. Ideal for leagues, schools, and tournaments. Fast shipping.Golf, Sportscustom-pagefree-sports-templatescup-trophies-large-and-smallglass-crystal-awardsrock-n-jox-allclassic-line-allachievement-trophies-awardstrophies-archerytrophies-badmintontrophies-baseballtrophies-basketballtrophies-bicycle-cyclingtrophies-billiardstrophies-bmxtrophies-bocce-balltrophies-bowlingtrophies-boxingtrophies-cheerleading-spirittrophies-coachtrophies-crickettrophies-curlingtrophies-dartstrophies-disc-golftrophies-equestrian-horsetrophies-figure-skatingtrophies-bass-fishingtrophies-marlin-fishingtrophies-footballtrophies-hockey-goalietrophies-golftrophies-gymnasticstrophies-ice-hockeytrophies-karate-martial-artstrophies-lacrossetrophies-marksman-shooting-rifletrophies-motocrossracing-trophies-awardstrophies-racquetballtrophies-roller-hockeyrunning-trophiestrophies-sailing-boattrophies-skateboardingtrophies-cross-country-skiingtrophies-downhill-skiingtrophies-snowboardingtrophies-snowmobiletrophies-soccertrophies-softballtrophies-swimming-divingtrophies-t-balltrophies-tennistorch-trophiestrophies-track-fieldtrophies-trap-skeet-shootingtrophies-volleyballtrophies-weightlifting-powertrophies-wrestlingquickshiptrophies-goatresin-trophiespickleball-trophiestr-resin-trophiestrophies-academictrophies-funny-horses-reartrophies-livestock-farm-animalsgeneral-corporate-awardsreligioustrophiestrophies-volunteerquickshiptrophies-firemanteacher-appreciationtrophies-military-heroart-trophiestrophies-chesscitizenship-awardsdebate-trophiestrophies-mascotquickshiptrophies-graduatetrophies-honor-roll-societytrophies-mathreadingawardsscienceawardsquickshiptrophies-spellingperfect-attendance-awardsschooltrophies14schooltrophies18trophies-cooking-culinarytrophies-dancetrophies-dramatrophies-musicphotography-trophies-and-awardstrophies-beauty-queeninsert-trophies-awardstrophies-generalstar-trophiesplace-trophiestrophies-victoryall-star-trophiesmvp-trophiestrophies-family-reunionhorseshoescounty-fair-awardstrophies-cards-pokertrophies-beer-pongtrophies-camperstrophies-cornholetrophies-paintballtrophies-pinewood-derby-scoutstrophies-table-tennis-ping-pongtrophies-car-truckquickshiptrophies-wheel1index1Trophies in 80+ styles. Shop sports trophies, trophy cups, crystal awards, resin sculptures and more. Free custom engraving. Fast 1-2 day turnaround. trophies
  • Engraving FAQ's
  • Tips for presenting a trophy or award
  • Trophy personalization ideas and samples
  • 📣 Are you an event manager, distributor or retailer? Be sure to see our: Wholesale & Affiliate Programs.

    Frequently Asked Questions About Trophies

    What types of trophies and awards can I buy at TrophyCentral?

    Browse TrophyCentral's extensive collection of quality achievement trophies, academic trophies, and corporate recognition awards. Choose from column trophies, resin designs, crystal and acrylic awards, and more - all featuring free personalized engraving and fast 1-2 day shipping.

    Can I customize my trophy with engraving?

    Yes! Most trophies at TrophyCentral include free engraving. You can personalize your award with individual names, dates, event titles, and even logos, depending on the product.

    How long does it take to receive a trophy order?

    Most trophy orders ship within 1-2 business days of when the order is placed. Shipping times may vary based on your location and order size. Expedited shipping options are also available during checkout.

    Is there a minimum order requirement?

    No minimum order is required. Whether you need a single trophy for your child or dozens for a team or organization, TrophyCentral is happy to help. Bulk discounts are available for larger orders.

    What if I need help choosing the right award?

    TrophyCentral has a knowledgeable customer service team ready to answer any questions you might have. You can call, email, or use the live chat feature on the website for personalized recommendations and help with customization options.

    ]]>
    11Search for trophies by style at TrophyCentral. Choose from column trophies, resin trophies and many more! Free shipping on orders over $100!Traditional Column Trophies Each of the sections above includes our selection of column trophies that have a consistent look and feel, making them ideal for little league, AYSO or any event where you want to award multiple levels of achievement. All awards have the high-quality bases, either white marble or wood, and all feature the same column styles and colors. Columns are available in many colors; please see individual product pages for details. League and other large orders can take advantage of significant quantity discounts as well as free shipping on online orders over $100.

    Shop With Confidence!

    Whether you need a column trophy for a tournament, contest, or end of season ceremony, TrophyCentral has a style to meet your needs. Remember, we offer free engraving and free shipping on trophy orders over $100! To find the perfect style to meet your needs, click on an image, use our keyword search above, or for personal service, call us toll-free at 1-888-809-8800. ]]>
    1111Complete trophy and award selection guide covering materials, styles, sizing, and budget considerations. Expert advice for choosing perfect recognition products for every occasion and achievement level.custom-pageindexacademic-resource-hubsports-resource-hubemployee-resource-hubtop-awards-by-categoryengraving-faqsatlossforwordstrophies-wording-samplesguide-to-planning-award-ceremoniesblog-trophycentralcoaching-teaching-guidesambassador-programtrophies-awards-wholesalescholarship-resource-hubask-trophy-expert1index1custom-pagetrophy-resource-guides11Discover the best lighting options for trophy cases, from LED spotlights to ambient and accent lighting. Learn how to highlight awards and protect them at the same time.music-awards-guidemotivational-medals-guiderising-star-awardspickleball-award-listmotivational-reading-awardswedding-contest-giveaway-ideasscience-competition-awardsstudent-awards7-fantasy-losersfunny-volunteerinexpensive-trophiesfree-motivational-awardsmusic-pin-guideemployee-sales-leadershiptop-volunteer-products10-unique-tennis-awards10-unique-golf-awards10-unique-pickleball-awardstop-10-soccer-awardstop-10-baseball-awards-html11A collection of products lists to help you find the perfect award for your needs.custom-pagecreative-trophy-display-ideaschoose-right-trophy-casetips-for-arranging-a-trophy-casetrophy-case-lighting-guide111custom-pagelapel-award-pinsdisplaycases1walmouncasdisplaycases2enclosed-bulletin-boardsnoname111index1"School Products"sleek wall-mounted options to impressive freestanding designs, our cases suit every setting, from schools and sports clubs to offices and personal collections. If you need more information before deciding, see our expert resource section: Our cases are proudly made in the USA by trusted manufacturers like Waddell, known for their quality craftsmanship and attention to detail. Each case is built to last, providing durability while maintaining an elegant presentation. You can choose from a variety of sizes, finishes, and styles - from classic wooden frames to modern glass and metal designs - ensuring that your display perfectly complements the space and style you desire. Beyond aesthetics, our display cases are functional. Adjustable shelving, lockable doors, and protective glass panels make it easy to organize, secure, and showcase your awards. They also help keep your items dust-free and protected from everyday wear, preserving them for years to come. Whether you are commemorating a championship, honoring academic excellence, or celebrating personal milestones, Trophy Central has the right display solution for you. Our expert team is ready to assist you in selecting the perfect case, offering guidance on size, style, and configuration to fit your collection perfectly. Show off your accomplishments with pride and confidence - our trophy cases ensure your awards are not only protected but presented in a way that truly honors your hard work and achievements. Celebrate every victory by giving it the display it deserves. ]]>custom-pagetrophy-award-guidesblog-car-show-awardsblog-types-of-trophiesblog-blue-ribbon-brillianceblog-trophy-room-ideasthanksgiving-employee-recognition-guidechampionship-season-football-awards-guidecamp-awards-articlederby-awards-articlefamily-awards-articleteam-sports-season-end-awards-guideacademic-competition-awards-guidewinter-cooking-awards-articlewrestling-season-recognition-awardsswim-team-recognition-awardswedding-awards-creative-ideasearth-day-environmental-awards-schoolsprom-spring-formal-recognitionevent-planner-recognition-differentiationclass-of-2026-graduation-keepsaketeacher-appreciation-weekreligious-award-recognition-ideascharity-car-show-fundraising-guide11Discover expert insights on trophies, awards, recognition programs, and celebration ideas. Trophy Central's blog features tips for choosing the perfect awards and honoring achievements.noindexed-items11Trophy Central Customer Reviews: Visit TrophyCentral to see this and similar Trophies and Awards1noindexed-items11Trophy Central Customer Reviews - All Discounted Trophies, Awards and Promotional Products.1custom-pagetrophies1trophies1Free custom engraving on every trophy and plaque order. No minimums, no fees. In-house engraving, fast turnaround, and every order reviewed before it ships.custom-pagetrophies11trophies"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"498552-30.35100021TrophyCentral1:14%,100:46%"Engraving"flplwcustom-pageblog-trophycentral12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
    498555-8.52Trophy display setup for schools and offices: placement, interior layout, lighting, and a maintenance schedule to keep your case looking sharp.
    custom-pagetrophy-award-guides11custom-pageengraving-faqstrophiesplaquestagsbadgesaward-medalslapel-award-pinsaward-ribbons-rosettescertificatespersonalized-giftstrophycasestrophy-award-guidesshop-by-categorynew-trophies-212-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
    498555-8.52 ]]>do-not-delete-used-in-webstore-template

    Engraved Trophies and Awards

    If you are looking to buy custom trophies, look no further! TrophyCentral carries engraved trophies and recognition products at discounted prices and with fast shipping! Whether you need a single medal or custom trophy to recognize a student achievement, or many awards for corporate teamwork, we can help.

    Custom Trophies to Meet Your Needs

    We specialize in trophies and medals for schools and sports teams, businesses, charities and religious organizations. Remember, online award orders over $100 ship for FREE and all of our trophies and plaques include FREE engraving! Order your high quality custom awards now. To find the perfect engraved plaque or custom award for your needs call our experts in New York and Michigan at 1-888-809-8800. Yes, there are real people there ready and excited to help you. Thank you for visiting!

    ]]>
    custom-page11TrophyCentral - Page Not Found. We are sorry - the page your a looking for has changed or no longer exists. We apologize for any inconvenience!111Articles on employee recognition, presenting trophies and awards and more.recognition trophies, recognition trophy, recognition awards, recognition trophies and awardscustom-page11Free Trophy Coupons for Discount Awards from TrophyCentral.1custom-pagetrophy-award-guidesscholarship-awardteacher-recommendation-letter-guidecollege-essay-tipscollege-essay-mistakes-to-avoidbuilding-character-portfolioscholarship-essay-examples-templateshow-to-request-strong-recommendationswriting-recommendation-letters-frameworkwhat-scholarship-committees-want-to-seebuilding-sportsmanship-award-into-programteam-discussion-guides-characterend-of-season-recognition-ideasscholarship-application-timeline-and-checklistscholarship-interview-tips-and-practice-questionsnomination-letter-templateswhat-makes-strong-coach-recommendationdocumenting-sportsmanship-throughout-the-seasonathlete-nomination-worksheetstudent-nomination-worksheetidentifying-scholarship-worthy-characterbuilding-culture-of-recognitionteaching-students-document-character-growthrecognizing-character-in-athletesscholarship-season-timeline11Complete scholarship application resources for students, nomination guides for teachers and coaches. Essays, templates, and tools to support character-based awards.custom-pagetrophiesscholarship-thank-youscholarship-23-24scholarship-formscholarship-24-251trophies1The TrophyCentral Sportsmanship and Compassion Scholarship Award is for eligible high school seniors attending college. Click for more information regarding the scholarship.11Get your picture in the TrophyCentral Spotlight and be Star!custom-pagemusicartpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsMusic, Drama, Art, Dance1:22%,50:30%,100:33%,500:45%"Music Lapel Pins" "Band Lapel Pins" "Music Pins"Find These Trumpet Lapel Pins Discounted at TrophyCentral. Each Trumpet Pin Features a Clutch-Pin Back and Fast 1-2 Day Shipping!mp506-15-2019Music / Band / Choruscustom-pagetrophies-golf1"10 business days" "Aliquippa, PA" "UPS"trophies1500110-1410.451236.45Glass AmericaCrystal Awards1:22%,10:25%Turnbury Golf Award. Ideal for leagues, schools, and tournaments. Fast shipping.Golf, Sportscustom-pagebaseballdisplay11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.5116.5Perfect CaseDisplay Cases11:14%,5:15%Twelve Baseball Glass Display Case. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.basedisplay-1210-16-2017Baseball / T-Ball, Sportscustom-pagesports-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Cheerleader Medals" "Cheerleading Medals"502291Cheerleading, Sports
    custom-pagebaseballdisplay11"7-10 business days w/Logo, 4-6 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231117Perfect CaseDisplay Cases11:14%,5:17%basedisplay-2bc10-16-2017Baseball / T-Ball, Sportscustom-pagetrophies-track-field12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Two Runners Female Inserts (Litho) at TrophyCentral. Each Two Runners Female Insert can be used to create a unique plaque, medal or trophy.505691
    custom-pagetrophies-track-field1105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Two Runners Male Inserts (Litho) at TrophyCentral. Each Two Runners Male Insert can be used to create a unique plaque, medal or trophy.50607111Find these popular two-tier column trophies at TrophyCentral. Each two-tier trophy is available in 3 sizes to recognize different achievement levels.112-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
    498555-8.52
    custom-pageletter-shaped-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find these popular U-shaped custom mascot badges at TrophyCentral. Great for fundraising! TrophyCentral is a top-rated Yahoo merchant.letterbadges-ucustom-pagemedallion-inserts-military-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsHero1:22%Buy these U.S. Army Medical Corps Inserts discounted at TrophyCentral. Each U.S. Army Medical Corps Insert can be used to create a unique plaque, medal or trophy.517572Military, Hero, Army
    custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsHero1:22%Buy these U.S. Army Signal Corps Inserts discounted at TrophyCentral. Each U.S. Army Signal Corps Insert can be used to create a unique plaque, medal or trophy.51757012-20-2020Military, Hero, Army
    custom-pagemedallion-inserts-government-agencies-and-logos12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-40.37160096.37Classic MedallicsInsertsHero1:22%Buy these high-quality U.S. Border Patrol Inserts at TrophyCentral. Each U.S. Border Patrol Insert can be used to create a unique plaque, medal or trophy.518913Military, Hero
    custom-pagemedallion-inserts-government-agencies-and-logos12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsHero1:22%"Award Medals" "Award Medals - All Subjects" "Medals - All Others"Buy these high-quality U.S. Dept. Of Homeland Security Inserts discounted at TrophyCentral. Each U.S. Dept. Of Homeland Security Insert can be used to create a unique plaque, medal or trophy.518476Military, Hero
    custom-pagemedallion-inserts-government-agencies-and-logos12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsHero1:22%"Award Medals" "Award Medals - All Subjects" "Medals - All Others"Buy these U.S. Environmental Protection Inserts discounted at TrophyCentral. Each U.S. Environmental Protection Insert can be used to create a unique plaque, medal or trophy.517656Military, Hero
    custom-pagename-badges-tagswoyoulipr100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom U.S. Shaped Badges Discounted At TrophyCentral.namebadges-uscustom-pagetrophies-soccer1trophies105503-610.45110.85Classic MedallicsTrophiesSports, Hobby, Org, Livestock1"Soccer Awards"Ultimate Line Soccer Ball Trophy - Style 2. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sports11This page is currently under going changes. We apologize for any inconvenience.custom-pagegeneral-corporate-awards1"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"4582215111 2 3 4 5 6 7 8 9628.05Vision AwardsTrophies1:22%,26:35%"Corporate Awards"C-Note Awards with Blue Accents from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.01-05-2018trophy-and-award-buying-lists11Unique and fun contest and giveaway ideas for your wedding, including awards for best dancers, best dressed, and special gifts for your wedding party.1noindexed-items11Unique Copy Center is a TrophyCentral Partner.1custom-pageperplaq1"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"perpetual plaques4582215121 2 3 4 5 6 7 8 9220Vision AwardsTrophies1:22%,26:40%"Corporate Awards"Perpetual Slate Awards from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.See our completesection.perplaqcustom-pagegeneral-corporate-awards11"7-10 business days w/engraving" "Kentucky" "UPS (FedEx available on request)"general410187-1010.45626.85JcharlesGeneral Awards1:22%,25:25%"New Products"Steps to Success from TrophyCentral. Also see our great selection of engraved and personalized gifts!custom-pagestar-trophies11"7-10 business days w/engraving" "Chicago, Illinois" "UPS (FedEx available on request)"trophies606307-101 3 230.45515.45RS OwensTrophiesGeneral1:22%"Star Awards" "Drama Trophies" "Drama Trophy" "Star Award"Reach the stars in Triumph with this inspiring award trophy. Hand cast figure plated in one of two finishes (Satin Silver or Gold) holding a crystal star. Rests on a tall, ebony finished stonecast base.Drama, Star, Generalcustom-pagemedallion-inserts-military-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsHero1:22%Buy these quality United States Air Force (493371) Inserts (Litho) at TrophyCentral. Each United States Air Force (493371) Insert can be used to create a unique plaque, medal or trophy.493371Military, Hero, Air Force
    custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsHero1:22%Buy these quality United States Air Force (505021) Inserts (Litho) at TrophyCentral. Each United States Air Force (505021) Insert can be used to create a unique plaque, medal or trophy.505021Military, Hero, Air Force
    custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality United States Air Force Inserts (Etched, 518466) at TrophyCentral. Each United States Air Force Inserts (Etched, 518466) can be used to create a unique plaque, medal or trophy.518466Military, Hero, Air Force
    custom-pagekeychains21105502-40.39125035.39Classic MedallicsGiftsKeychains1:22%,10:25%,25:32%,50:39%,100:47%"Military Awards"Find these popular Pewter United States Air Force Key Chains at TrophyCentral; discounted prices!pk110-cmKeychainscustom-pagemedallion-inserts-military-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsHero1:22%Buy these quality United States Army Inserts (Litho) at TrophyCentral. Each United States Army Insert can be used to create a unique plaque, medal or trophy.504901Military, Hero, Army
    custom-pagekeychains21105502-40.39125035.39Classic MedallicsGiftsKeychains1:22%,10:25%,25:32%,50:39%,100:47%"Military Awards"Find these popular Pewter United States Army Key Chains at TrophyCentral; discounted prices!pk109-cmKeychainscustom-pagekeychains21105502-40.39125035.39Classic MedallicsGiftsKeychains1:22%,10:25%,25:32%,50:39%,100:47%"Military Awards"Find these popular Pewter United States Coast Guard Key Chains at TrophyCentral; discounted prices!pk107-cm04-30-2020Keychainscustom-pagemedallion-inserts-government-agencies-and-logos12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsHero1:22%"Award Medals" "Award Medals - All Subjects" "Medals - All Others" "Military Medals"Buy these high-quality United States Forest Service Inserts at TrophyCentral. Each United States Forest Service Insert can be used to create a unique plaque, medal or trophy.517034Military, Hero
    custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsHero1:22%Buy these quality United States Marine Corps (505011) Inserts (Litho) at TrophyCentral. Each United States Marine Corps (505011) Insert can be used to create a unique plaque, medal or trophy.505011Military, Hero, Marines
    custom-pagekeychains21105502-40.39125035.39Classic MedallicsGiftsKeychains1:22%,10:25%,25:32%,50:39%,100:47%"Military Awards"Find these popular Pewter United States Marines Corps Key Chains at TrophyCentral; discounted prices!pk111-cmKeychainscustom-pagemedallion-inserts-military-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsHero1:22%Buy these quality United States Navy (505001) Inserts (Litho) at TrophyCentral. Each United States Navy (505001) Insert can be used to create a unique plaque, medal or trophy.505001Military, Hero, Navy
    custom-pagekeychains21105502-40.39125035.39Classic MedallicsGiftsKeychains1:22%,10:25%,25:32%,50:39%,100:47%"Military Awards"Find these popular Pewter United States Navy Key Chains at TrophyCentral; discounted prices! Top-Rated Service!pk108-cmKeychainscustom-pagemedallion-inserts-organizations12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality United Way Inserts (Litho) at TrophyCentral. Each United Way Insert can be used to create a unique plaque, medal or trophy.492701
    custom-pageflaglapelpins1plasticpinboxvelapinbox10flaglapelpins"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsHero1:22%,50:32%,100:39%,500:46%"Flag Pin Section" "Flag Lapel Pins" "Lapel Pins - Flag" "Discount Flag Pins" "Cheap Flag Pins" "Flag Pins Cheap" "Buy Flag Pins" "Shop For Flag Pins" "U.S. Flag Pins" "American Flag Pins" "Flag Pins US" "Flag Pins American"Find this United We Stand American Flag Lapel Pin Discounted at TrophyCentral. Pins Ship in Just 1-2 Days!amflpinwiea12-10-2010Flagcustom-pagefootballdisplay11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.5116.5Perfect CaseDisplay Cases11:14%,5:18%Upright Glass Football Display Case. Ideal for leagues, schools, and tournaments. Fast shipping.10-16-2017Football, Sportscustom-pageflaglapelpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsHero1:30%,50:34%,100:46%,500:58%"Flag Pin Section" "Flag Lapel Pins" "Lapel Pins - Flag" "Discount Flag Pins" "Cheap Flag Pins" "Flag Pins Cheap" "Buy Flag Pins" "Shop For Flag Pins"usgecrflpinFlagcustom-pageflaglapelpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsHero1:22%,50:30%,100:40%,500:46%"Flag Pin Section" "Flag Lapel Pins" "Lapel Pins - Flag" "Discount Flag Pins" "Cheap Flag Pins" "Flag Pins Cheap" "Buy Flag Pins" "Shop For Flag Pins" "Military Awards" "U.S. Flag Pins" "American Flag Pins" "Flag Pins US" "Flag Pins American"Find these US Air Force Pins discounted at TrophyCentral. Each Air Force Lapel Pin features a gold finish and clutch-back. Fast 1-2 day shipping!usairfolapi11-25-2010Military, Hero, Air Forcecustom-pagetop-awards-by-category11A comprehensive look at US Amateur Golf for 2024-2025, including major contenders, their backgrounds, and past winners from the last 10 years.1custom-pagetop-awards-by-category11A comprehensive look at US Amateur Tennis for 2024-2025, including major contenders, their backgrounds, and past winners from the last 10 years.1custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsHero1:22%Buy these quality US Army (493341) Inserts (Litho) at TrophyCentral. Each 2" insert can be used to create a unique plaque, medal or trophy.493341Military, Hero, Army
    custom-pageflaglapelpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsHero1:22%,50:30%,100:40%,500:46%"Flag Pin Section" "Flag Lapel Pins" "Lapel Pins - Flag" "Discount Flag Pins" "Cheap Flag Pins" "Flag Pins Cheap" "Buy Flag Pins" "Shop For Flag Pins" "Military Awards" "U.S. Flag Pins" "American Flag Pins" "Flag Pins US" "Flag Pins American"Find these US Army Pins discounted at TrophyCentral. Each Army Lapel Pin features a gold finish and clutch-back. Fast 1-2 day shipping!usarmyflagpins11-25-2010Military, Hero, Armycustom-pagemedallion-inserts-military-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality Us Army Reserve Inserts at TrophyCentral. Each Us Army Reserve Insert can be used to create a unique plaque, medal or trophy.514070Military, Hero, Army
    custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsHero1:22%Buy these quality US Marine Corps (493381) Inserts (Litho) at TrophyCentral. Each 2" insert can be used to create a unique plaque, medal or trophy.493381Military, Hero, Marines
    custom-pageflaglapelpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsHero1:22%,50:30%,100:40%,500:46%"Flag Pin Section" "Flag Lapel Pins" "Lapel Pins - Flag" "Discount Flag Pins" "Cheap Flag Pins" "Flag Pins Cheap" "Buy Flag Pins" "Shop For Flag Pins" "Military Awards" "U.S. Flag Pins" "American Flag Pins" "Flag Pins US" "Flag Pins American"Find these US Marines Pins discounted at TrophyCentral. Each Marines Lapel Pin features a gold finish and clutch-back. Fast 1-2 day shipping!usmausflpin11-22-2012Military, Hero, Marines, Flagcustom-pagemedallion-inserts-military-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsHero1:22%Buy these quality US Navy (493361) Inserts (Litho) at TrophyCentral. Each 2" insert can be used to create a unique plaque, medal or trophy.493361Military, Hero, Navy
    custom-pageflaglapelpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsHero1:22%,50:30%,100:40%,500:46%"Flag Pin Section" "Flag Lapel Pins" "Lapel Pins - Flag" "Discount Flag Pins" "Cheap Flag Pins" "Flag Pins Cheap" "Buy Flag Pins" "Shop For Flag Pins" "Military Awards" "U.S. Flag Pins" "American Flag Pins" "Flag Pins US" "Flag Pins American"Find these US Navy Pins discounted at TrophyCentral. Each Navy Lapel Pin features a gold finish and clutch-back. Fast 1-2 day shipping!usnavyflagpinsMilitary, Hero, Navy, Flagcustom-pageflaglapelpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsHero1:22%,50:32%,100:39%,500:46%"Flag Pin Section" "Flag Lapel Pins" "Lapel Pins - Flag" "Discount Flag Pins" "Cheap Flag Pins" "Flag Pins Cheap" "Buy Flag Pins" "Shop For Flag Pins"ambrflpin08-15-2012Flagcustom-pageflaglapelpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsHero1:30%,50:34%,100:46%,500:58%"Flag Pin Section" "Flag Lapel Pins" "Lapel Pins - Flag" "Discount Flag Pins" "Cheap Flag Pins" "Flag Pins Cheap" "Buy Flag Pins" "Shop For Flag Pins"nonameFlagcustom-pageflaglapelpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsHero1:22%,50:30%,100:40%,500:46%"Flag Pin Section" "Flag Lapel Pins" "Lapel Pins - Flag" "Discount Flag Pins" "Cheap Flag Pins" "Flag Pins Cheap" "Buy Flag Pins" "Shop For Flag Pins" "U.S. Flag Pins" "American Flag Pins" "Flag Pins US" "Flag Pins American"Find These BR Series Statue of Liberty Pins Discounted At TrophyCentral. Fast 1-2 Day Shipping from our Factory in NY. Order In Bulk For Large Discounts!usflpiwistof04-20-2011Flagcustom-pagemedallion-inserts-military-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality USAF Recruiting Service Inserts at TrophyCentral. Each USAF Recruiting Service Insert can be used to create a unique plaque, medal or trophy.511941Military, Hero
    custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality USMC League Semper Fidelis Inserts at TrophyCentral. Each USMC League Semper Fidelis Insert can be used to create a unique plaque, medal or trophy.517581Military, Hero, Marines
    custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality USMC Recruiting Service Inserts at TrophyCentral. Each USMC Recruiting Service Insert can be used to create a unique plaque, medal or trophy.512771Military, Hero, Marines
    custom-pageletter-shaped-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find these popular V-shaped custom mascot badges at TrophyCentral. Great for fundraising! TrophyCentral is a top-rated Yahoo merchant.letterbadges-vcustom-pageeagle-trophies1"10 business days" "Aliquippa, PA" "UPS"trophies1500110-1410.45824.45Glass AmericaCrystal Awards1:22%,10:25%Valor Eagle from TrophyCentral. See our great selection of engraved and personalized gifts!12-20-2020custom-pagetrophies-baseball1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.711012Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,50:31%"Baseball Trophies" "Baseball Trophy" "Baseball Trophies and Medals"wvl451See our complete selection ofin a large number of styles.trophies-baseballBaseball / T-Ball, Sportscustom-pagesoccerbank1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)""PT1=Trophies" "PT1=465713-410.71012Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,50:31%"Soccer Trophies" "Soccet Trophy"value-line-soccer-ball-and-cleat-trophyReturn to the section for more great choices.trophies-soccer10-05-2022Soccer, Sportscustom-pagecorporatepinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsBusiness1:30%,50:32%,100:35%,500:39%Find these Value the Customer Pins discounted at TrophyCentral. Each pin features a gold finish and clutch-back. Fast shipping!br519Businesscustom-pagegeneral-corporate-awards1"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"458221510.45228.45Vision AwardsTrophies1:22%,26:37%Find the Vector Business Award at TrophyCentral. The Vector Award Includes Text Engraving and Ships from Ohio.noindexed-items12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
    498555-8.521
    custom-pagebr3715"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"105502-310.4513625.65Classic Medallicsaward-medals1:22%,100:46%Buy Velour Boxes to Display Your Medals and Ribbons at TrophyCentral.velour boxes, velour boxes to display medals, medal display, medal display case, velour medal display caseacpin5"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)""PT1=105502-310.45488.13Classic Medallics1:22%"Lapel Pins"Velour Covered Hinged Pin Box: Visit TrophyCentral to see this and similar Trophies and Awardscustom-pageservicepins21"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"105502-310.451488.13Classic Medallicslapel-award-pinsGeneral1:14%Shop for Velour Lapel Pins Display Boxes at TrophyCentral.custom-pagebottles-al80"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14142013Glass AmericaPromotional ProductsSports / Water Bottles1Find these Green Venice Collection Aluminum Water Bottles Discounted At TrophyCentral! Price Include One-Color Logo Imprint!Sports / Water Bottlescustom-pagebottles-al80"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14142013Glass AmericaPromotional ProductsSports / Water Bottles1Find these Blue Venice Collection Aluminum Water Bottles Discounted At TrophyCentral! Price Include One-Color Logo Imprint!Sports / Water Bottlescustom-pagebottles-al80"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14142013Glass AmericaPromotional ProductsSports / Water Bottles1"Basketball Water Bottles" "Logo Sports Bottles" "Sports Bottles" "Promotional Sports Bottles" "Aluminum Sports Bottles" "Stainless Water Bottles" "Aluminum Water Bottles" "Bike Water Bottles" "Bicycle Water Bottles" "Baseball Water Bottles" "Football Water Bottles" "Promotional Water Bottles" "Soccer Water Bottles"Find these Lime Venice Collection Aluminum Water Bottles Discounted At TrophyCentral! Price Include One-Color Logo Imprint!Sports / Water Bottlescustom-pagebottles-al80"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14142013Glass AmericaPromotional ProductsSports / Water Bottles1Find these Orange Venice Collection Aluminum Water Bottles Discounted At TrophyCentral! Price Include One-Color Logo Imprint!Sports / Water Bottlescustom-pagebottles-al80"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14142013Glass AmericaPromotional ProductsSports / Water Bottles1Find these Red Venice Collection Aluminum Water Bottles Discounted At TrophyCentral! Price Include One-Color Logo Imprint!Sports / Water Bottlescustom-pagecusflatrib1115-711 2 3 4 5 6 7 8 9Tower Ribbons1:0%Add vertical printing to your ribbons for a special touch. TrophyCentral has a great selection of ribbon design and printing options!custom-pagecusrossinstr115-711 2 3 4 5 6 7 8 9Tower Ribbons1:0%Use this option to add vertical printing to your custom rosette ribbons for a special touch. TrophyCentral offers a variety of other printing options including font size and color.1custom-pagedisplaycases211"7-10 business days" "Connelly Springs, North Carolina" "UPS (FedEx available on request)"display case286127-1011.4455.4SpartaCraftDisplay CasesSpecialty Cases1:14%Buy this Veteran Flag Case and other Engraved Flag Cases at TrophyCentral.Flag Casescustom-pageaward-medalsvitrnocovitrsicovitrwmavitrwtr1vitrwtrvitrtwotivitrtwotiwovitr1qtvicttrqtvictperpmqtvictscbcup-vict-scbcup-vict-pclasacbdg-victoryvictory-cup-place-column-trophyvictory-cup-place-trophy1achievement-trophies-awards1Find victory trophies discounted at TrophyCentral. Each victory trophy includes free personalization.Shop with Ease at TrophyCentral TrophyCentral has a large selection of victory awards and trophies, discounted prices and great customer service. Our experts in New York and Michigan have been providing suggestions and guidance since 1999! ]]>custom-pagetrophies-victory1trophies498551-310.452429Trophies1Find this popular Victory trophy discounted at TrophyCentral. Features a real marble base, free engraving and fast shipping.victory-cup-place-trophy-tccustom-pagetrophies-victory11"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesGeneral1:14%,100:25%Find this popular victory figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!vitrwtr1Generalcustom-pagetrophies-victory1trophies498552-311821.06TrophiesGeneral1Find this achievement cup trophy with victory figure discounted at TrophyCentral. Includes free text engraving!cup-vict-pGeneralcustom-pagetrophies-victory1trophies498552-312413.89TrophiesGeneral1Find these victory budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtvictscbGeneralcustom-pagetrophies-victory1498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Find this budget victory award trophy discounted at Trophy Central. Features a real marble base and plastic victory figure. Engraving is free. Fast 1-2 day shipping.bdg-victoryVictory, Generalcustom-pagetrophies-victory11"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.45415.45Quick TrophyTrophiesGeneral1:14%,3:19%,10:27%Find these fabulous two-tier Victory Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!vitrtwotiGeneralcustom-pagetrophies-victory11"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.45622.95Quick TrophyTrophiesGeneral1:14%,10:28%See this championship trophy with a Victory figure at TrophyCentral. Add up to 3 lines of Free Personalization! Be sure to see all of our Victory figure awards.vitrtwotiwocustom-pagetrophies-victory11"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452413.89Quick TrophyTrophiesGeneral1:14%,10:19%,50:28%,100:35%This popular column trophy with a victory figure features a choice of column color, a marble base, free trophy engraving and quick shipping. Perfect for any general recognition.vitrsicoGeneralcustom-pagecrystalcups1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"general410187-1010.45428.45JcharlesCrystal Awards1:22%,25:24%"crystal awards" "Team Award" "Team Awards" "Team Trophy" "Team Trophies" "Team Trophies and Awards"Find this Victory Cup at TrophyCentral. Trophies include free engraving.06-30-2014Cup, Generalcustom-pagetrophies-victory11"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesGeneral1:14%,10:18%,50:24%,100:28%These quick-ship trophies from TrophyCentral feature a Victory figure, real marble base and marble trophy figure platform, choice of column size and color.vitrwmaGeneralcustom-pagetrophies-victory11"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesGeneral1:14%,100:25%This popular Victory Figure Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!vitrwtrGeneralcustom-pagetrophies-victory1trophies498552-311218.84TrophiesGeneral1Find this unique cup trophy with Victory figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-vict-scbGeneralcustom-pagetrophies-victory11"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.4518Quick TrophyTrophiesGeneral1:14%,10:24%Find these fabulous two-tier, 3-column champion Victory Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!vitr1Generalcustom-pageholographic-insert-plaques1"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498852-310.45811.6Quick TrophyPlaquesInsert1:14%,3:14%See this stunning Victory plaque and other Holographic Plaques at TrophyCentral.qsinplaqvictoryBlank, Generalcustom-pagemedallion-inserts-general-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these quality Victory Inserts (Litho) at TrophyCentral. Each Victory Insert can be used to create a unique plaque, medal or trophy.493521General
    custom-pagemedallion-inserts-general-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these quality Victory Male Inserts (Litho) at TrophyCentral. Each Victory Male Insert can be used to create a unique plaque, medal or trophy.503991General
    custom-pageresin-trophies11"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453615.21Quick TrophyTrophiesGeneral1:14%,10:17%,25:23%,50:29%,100:34%Our Victory Participation Trophies feature a real slant-front white marble base and free personalization. Significant quantity discounts available.vitrnocoGeneralcustom-pagetrophies-victory1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.4234Quick TrophyTrophies1:14%,3:15%,10:16%Find this Perpetual Victory Trophy Discounted at TrophyCentral. Each Trophy has enough room for 32 names. Ships in just 1-2 days.qtvictperpReturn to the section for more fabulous choices.trophies-victoryGeneralcustom-pagemedallion-inserts-general-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these high-quality Victory Wreath Inserts at TrophyCentral. Each Victory Wreath Insert can be used to create a unique plaque, medal or trophy.51779712-20-2020General
    custom-pagefree-sports-templates1"Download Only"certificates4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Videography template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Videography-Certificatevideography-freeVideographycustom-pagemascot-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Hornet Mascot Badges Discounted At TrophyCentral.mascotbadges-vikingcustom-pagemascot-plaques1plaques498552-41JDSPlaques1Find this viking plaque discounted at TrophyCentral. Our viking mascot plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Mascotcustom-pagemascottrophies1"4-6 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511016.25Classic MedallicsTrophiesAcademic1:22%,5:24%,10:28%,50:32%"Mascot Awards"Buy this Viking mascot trophy and other mascot awards at TrophyCentral.mt201412-20-2020Mascotcustom-pagemascotinserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-40.3713003.37Classic MedallicsInsertsMascots1Buy these quality Vikings Mascot Medal Inserts at TrophyCentral. Each Vikings Insert can be used to create a unique plaque, medal or trophy.489942Mascot
    custom-pagequickshiptrophies-pickup1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:25%Fabulous Pick-up Truck Place Trophy with 1st, 2nd or 3rd Place Trim, Marble Base and Free Engraving. Ships in a fast 1-2 days!qtvintagepickupplcustom-pagequickshiptrophies-pickup1trophies498852-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with car show, vintage pick-up truck figure discounted at TrophyCentral. Includes free text engraving!cup-vintagepickup-pcustom-pagequickshiptrophies-pickup1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:26%Find these fabulous Vintage Pick-Up Figure Two Tier Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qtvintagepickupttcustom-pagequickshiptrophies-pickup1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:28%See this championship trophy with a Car Show, Vintage Pick-up figure at TrophyCentral. Be sure to see all of our Car Show, Vintage Pick-up figure awards.qtvintagepickupttwcustom-pagequickshiptrophies-pickup1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:21%,100:24%This popular Car Show, Vintage Pick-up Truck Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtvintagepickupsccustom-pagequickshiptrophies-pickup1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.05Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%Find This Popular Vintage Pickup Truck Deluxe Platform Series Trophy Discounted at TrophyCentral. Real Marble Base; Free Personalization!custom-pagequickshiptrophies-pickup1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Car Show, Vintage Pick-up Truck figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-vintagepickup-scbcustom-pagequickshiptrophies-pickup1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.4226Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:18%,10:23%Find these fabulous Champions Line 3-Column Vintage Pick-Up Trophies discounted at TrophyCentral. Free personalization and fast 1-2 day shipping!qtvintagepickup3ccustom-pagequickshiptrophies-pickup1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:27%,100:32%Our popular Vintage Pick-up Truck participation trophies feature a real slant-front marble base and free engraving.qtvintagepickupnccustom-pagemusic-certificate-templates1"Download Only"certificates49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Violin template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Violin-Certificateviolin-freeMusic / Band / Choruscustom-pagemusicartpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsMusic, Drama, Art, Dance1:22%,50:30%,100:33%,500:45%"Music Lapel Pins" "Band Lapel Pins" "Music Pins"Find These Violin Lapel Pins Discounted at TrophyCentral. Features a Clutch-Pin Back and Fast 1-2 Day Shipping!mp13Music / Band / Chorus11Explore vocal music recognition ideas for choirs, chorus groups, solo singers and show choirs. For music trophies, medals and awards, visit our main music awards page.custom-pageshop-by-categoryqtvollyncqtvollyscmavotrqtvollydmqtvollyyrqtvollyplqtvollyttqtvollyttwqtvolly3cqtvollytrtr7007tr7008qtvolleyperpmqtvollyscbcup-volly-scbcup-volly-pchamp-cup-volleyball-tcvolleyball-part-ivolleyball-single-ivolleyball-champ-ivolleyball-plaque-ivolleyball-e-part-ivolleyball-e-single-icup-vollyball-scb-icup-vollyball-inbdg-volleyballvolleyball-mcvolleyball-mc-prvolleyball-mge9027tm9995gvovolleyball-qcmvolleyball-jigfvolleyball-jibfvolleyball-jisfcl10ec05qsinplaqvolleyballqtdogvollvolleyball-ei503211504411493221volleyball-cup-place-column-trophyvolleyball-cup-place-trophy1trophies1"Volleyball Awards" "Sports Trophies"

    Custom Volleyball Trophies & Awards - Celebrate Every Serve, Set, and Spike

    Volleyball trophies celebrate the teamwork, athleticism, and competitive spirit that define one of the world's most popular team sports. From youth recreational leagues introducing young athletes to the fundamentals, to middle school and high school programs competing for conference titles, from club tournaments drawing elite travel teams to beach volleyball competitions played under open skies, quality volleyball awards recognize players, coaches, and teams across every level of the game. Our versatile trophies feature dynamic action figurines capturing spikers at full extension, setters delivering the perfect pass, and blockers rising above the net, traditional column designs in a range of heights and finishes with volleyball toppers and trim, premium resin sculptures depicting game-winning moments, and customizable engraving plates documenting season highlights, statistical achievements, and team accomplishments. With options for both male and female athletes and designs suited to indoor and beach play, our collection makes it easy to find the right award for every event and budget.

    Volleyball Medals

    In addition to trophies, we offer a wide selection of volleyball medals perfect for tournaments, participation awards, and team recognition. Choose from classic gold, silver, and bronze finishes, along with engraving options to highlight each athlete's achievement. Volleyball medals are a practical and budget-friendly choice for youth programs, school competitions, and large events where every player deserves recognition.

    Frequently Asked Questions About Volleyball Trophies

    What trophy sizes work best for different volleyball award categories?

    Youth participation leagues benefit from 6-inch to 9-inch economy trophies ensuring every player receives affordable recognition for completing the season, building confidence and encouraging return next year. Position-specific and individual category awards such as best setter, top server, or most improved player deserve 10-inch to 14-inch single column trophies with action figurines that reflect each athlete's role on the court. Team MVP and player of the year honors warrant 15-inch to 18-inch premium trophies with substantial presence befitting superior season-long performance. League championships and tournament titles demand 20-inch to 24-inch multi-column championship trophies with the height and weight that reflect the achievement of winning it all. Club and travel team programs often layer their award presentations, combining medals for all participants with progressively larger trophies for all-tournament selections, finalists, and champions, creating a clear visual hierarchy that communicates achievement at every level.

    What details should volleyball trophy engraving include?

    Comprehensive engraving preserves season memories beyond fading photographs. Essential elements include player name, award title, team name, league or organization, and season year. Examples: Alyssa Reyes, Tournament MVP, Lakewood Volleyball Club, Spring 2025 or Jordan Kim, Best Setter, Lincoln High School Varsity, Fall 2025. Statistical achievements gain impact through specific numbers like 142 Kills or 98% Serve Accuracy when space permits. Team championships benefit from final records such as Tournament Champions 8-0 or Conference Champions. Individual honors gain clarity through specific titles like Defensive Player of the Year or Most Improved Player. Coach awards should acknowledge tenure and impact, for example Head Coach, 8 Seasons, 4 Conference Titles. Keep text concise and readable, prioritizing the most meaningful details when space limitations require choices.

    Should youth volleyball programs give trophies to every player or only award winners?

    Youth programs serving players under 12 years old benefit significantly from universal participation trophies acknowledging every athlete who completed the season, building confidence and creating positive associations with organized sports that encourage continued participation. These affordable 6-8 inch trophies cost little but mean everything to young players displaying their first sports awards at home. However, even participation-focused programs should maintain some competitive recognition by presenting larger distinctive trophies for team MVP, most improved player, best sportsmanship, and coaches awards, teaching young athletes that exceptional effort earns special recognition. Middle school and high school programs appropriately shift toward merit-based awards where trophies recognize genuine achievement in championships, all-conference selections, statistical leaders, and team superlatives, preparing athletes for increasingly competitive environments. Club and travel programs serving mixed age groups often find the best results combining medals for all participants with trophies reserved for measurable accomplishments, maintaining inclusivity while honoring authentic achievement.

    If you need more information before deciding, see our expert resource section:
    ]]>
    custom-pagetrophies-volleyball1trophies498551-310.452429Trophies1Find this popular Volleyball trophy discounted at TrophyCentral. Features a real marble base, free engraving and fast shipping.volleyball-cup-place-trophy-tccustom-pagetrophies-volleyball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)""PT1=Trophies" "PC12=498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular volleyball trophy with 1st, 2nd or 3rd place trim, marble base and free personalization, discounted at trophyCentral. Ships in a fast 1-2 days!qtvollyplVolleyball, 1st / 2nd / 3rd / Etc., Sportscustom-pagetrophies-volleyball20498552-40.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful Volleyball 2" Epoxy-covered insert decal discounted at TrophyCentral. Fast 1-2 day shipping.Volleyball, Sportscustom-pagetrophies-volleyball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%This popular Volleyball trophy features a real marble base, column, figure and trim indicating year of award. Includes up to three lines of free engraving!qtvollyyrVolleyball, Sportscustom-pagetrophies-volleyball1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with volleyball figure discounted at TrophyCentral. Includes free text engraving!cup-volly-pVolleyball, Sportscustom-pagetrophies-volleyball1medals498552-30.525033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Volleyball Spike 2 1/4" Antique Gold Medal Discounted at TrophyCentral. Each medal features a free ribbon. Fast shipping!Volleyball, Sportscustom-pagefree-sports-templates1"Download Only"free-sports4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Volleyball template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Volleyball-Certificatevolleyball-freeVolleyball, Sportscustom-pagetrophies-volleyball11Creative volleyball award ideas with engraving examples for your team banquet. From Ace Machine to Dig Master, discover 15+ unique ways to recognize every player with actual trophy wording templates.custom-pagetrophies-volleyball1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Volleyball Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Volleyball, Sportscustom-pagetrophies-volleyball1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these volleyball budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtvollyscbVolleyball, Sportscustom-pagetrophies-volleyball1498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Find this budget volleyball award trophy discounted at Trophy Central. Features a real marble base, a volleyball player figure and free engraving.bdg-volleyballVolleyball, Sportscustom-pagesporcervolleyballfr1volleyballfrcertificates290631-31 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,25:27%,100:40%,500:50%"Volleyball Awards"Give your volleyball team the recognition they deserve with volleyball certificates from Trophy Central. Shop our discounted volleyball certificates today!1042Volleyball, Sportscustom-pagefree-sports-templates1"Download Only"certificatesfree-sports49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"See this Volleyball Certificate designed exclusively for TrophyCentral! Each Volleyball Certificate measures 11 x 8 1/2 inches and can be downloaded for free!volleyballfrVolleyball, Sportscustom-pagetrophies-volleyball1trophies498552-411229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find this volleyball champion's cup trophy discounted at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's Cup - VolleyballVolleyball, Sportscustom-pagetrophies-volleyball1trophies498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Volleyball insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-Volleyball-InsertVolleyball, Sportscustom-pagetrophies-volleyball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find this fabulous two-tier Volleyball Trophy discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtvollyttVolleyball, Sportscustom-pagetrophies-volleyball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.215Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%See this championship trophy with a Volleyball figure at TrophyCentral. Be sure to see all of our Volleyball figure awards.qtvollyttwVolleyball, Sportscustom-pagetrophies-volleyball1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Volleyball single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - VolleyballVolleyball, Sportscustom-pagetrophies-volleyball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:19%,50:28%,100:35%This popular Volleyball Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtvollyscVolleyball, Sportscustom-pagetrophies-volleyball1trophies498551-311821.06TrophyCentraltrophies1Volleyball, Sportscustom-pagetrophies-volleyball50medals9303310-May1Simba Calaward-medals1These 2 1/2 inch custom volleyball (QCM Series) medals come with an outer-ring which allows you to add your school or league name, date and location.Volleyball, Sportscustom-pagetrophies-volleyball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451623.65Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%These quick-ship trophies from TrophyCentral feature a Volleyball figure, real marble base and marble trophy figure platform, choice of column size and color.qtvollydmVolleyball, Sportscustom-pagenoname111"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.5116.5Perfect CaseDisplay Cases11:14%,5:16%Volleyball Display Cases (Glass, Octagon) from TrophyCentral.Volleyball, Sportscustom-pagenoname111"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.5116.5Perfect CaseDisplay Cases11:14%,5:15%Volleyball Display Cases (Glass, Wall-Mounted) from TrophyCentral.Volleyball, Sportscustom-pagetrophies-volleyball1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Volleyball figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-volly-scbVolleyball, Sportscustom-pagetrophies-volleyball1trophies498551-310.71217.38trophies1Volleyball, Sportscustom-pagetrophies-volleyball1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Volleyball Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Volleyball, Sportscustom-pagetrophies-volleyball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find this fabulous two-tier, 3-column champion trophy with a volleyball figure discounted online at TrophyCentral. Fast 1-2 day shipping!qtvolly3cVolleyball, Sportscustom-pagetrophies-volleyball1medals498552-30.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Colorful Volleyball insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Volleyball, Sportscustom-pagetrophies-volleyball1medals498552-40.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Volleyball insert medal With A Personalized Front Rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Volleyball, Sportscustom-pagecherry-insert-plaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these volleyball insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Volleyball, Sportscustom-pageholographic-insert-plaques1"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498852-310.45811.6Quick TrophyPlaquesInsert1:14%,3:14%"Volleyball Awards"See this stunning Volleyball plaque and other Holographic Plaques at TrophyCentral.qsinplaqvolleyballVolleyball, Sportsvolleyballmedalsvolleyball-ei50321150441149322111"Volleyball Medals"See these Volleyball Inserts at TrophyCentral; Each insert measures 2".1custom-pagetrophies-volleyballplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsSports, Hobby, Org, Livestock1:22%,50:30%,100:33%,500:47%"Volleyball Awards" "Volleyball Pins" "Volleyball Lapel Pins"Volleyball Letter Pins: EC Series Volleyball Lapel Pins feature a high-quality enameled finish and ship in just 1-2 business days!ec0510-25-2007Volleyball, Sportscustom-pagecl10151-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    "PT1=105502-30.3150030.3Classic Medallicslapel-award-pinsSports, Hobby, Org, Livestock1:30%,50:36%,100:39%,500:42%,1000:48%"Volleyball Pins" "Volleyball Lapel Pins"Find this fabulous Volleyball letter pin at TrophyCentralcl14412-20-2040Volleyball, Sports
    custom-pagesports-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these high-quality Volleyball Inserts at TrophyCentral. Each 2 inch insert can be used to create a unique plaque, medal or trophy.493221Volleyball, Sports
    custom-pagevolleyballpinsvolleyball-mcvolleyball-mc-prvolleyball-mge9027tm9995gvovolleyball-qcmvolleyball-jigfvolleyball-jibfvolleyball-jisf11Shop for volleyball medals at TrophyCentral. Volleyball medals include a neck ribbon and most ship in just 1-2 business days.Shop For Volleyball Award Medals with Ease at TrophyCentral Find a great selection of high-quality medals and awards, discounted prices and fast shipping. We also have a great customer service team that would be happy to help you!]]>trophies-volleyball volleyballpinscustom-pagetrophies-volleyball1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our volleyball insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - VolleyballVolleyball, Sportscustom-pagetrophies-volleyball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453631.77Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%,25:23%,50:29%,100:34%Our popular Volleyball participation trophies feature a real slant-front marble base and free engraving.qtvollyncVolleyball, Sportscustom-pagetrophies-volleyball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.4234Quick TrophyTrophies1:14%,3:15%,10:16%"Volleyball Awards" "Volleyball Trophies"Find this Perpetual Volleyball Trophy Discounted at TrophyCentral. Each Trophy has enough room for 32 names. Ships in just 1-2 days.qtvolleyperpReturn to oursection.Volleyball, Sportscustom-pagesports-pinscl10ec0511Shop for Volleyball Lapel Pins from TrophyCentral.volleyball pins, volleyball award pins, volleyball lapel pins, volleyball awardsVolleyball Lapel Pins TrophyCentral has a great selection of stock volleyball lapel pins. Our volleyball letter pins are available with a color or chenille gold finish and are available in several styles ("Spike" and volleyball). Volleyball pins can be proudly worn directly on a volleyball jacket or on a varsity or JV letter.
    We also carry a great selection of generic pins, such as Varsity, JV, MVP, All Star, Champs, Coach and more! All volleyball pins feature a clutch-pin back for safe and easy attachment to clothing. Pins typically ship in just 1-2business days. .

    Shop with Confidence at TrophyCentral!

    If you are looking to buy volleyball lapel pins online, look no further! TrophyCentral has a great selection that will fit any budget. Our top-rated representatives are happy to assist you with all of your volleyball pin needs. Our experts in New York and Michigan have been providing suggestions and guidance since 1999! To find the perfect volleyball lapel pin, click on an image above, or for personal service, call us toll-free at 1-888-809-8800.]]>
    trophies-volleyball trophies
    custom-pagetrophies-volleyball1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Volleyball Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Volleyball, Sportscustom-pagetrophies-volleyball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-30.38150030Quick Trophylapel-award-pinsSports, Hobby, Org, Livestock1:14%,10:15%Find this engraved volleyball dog tag discounted at TrophyCentral. Price includes engraving and 24" chain!!Shop for Sports Dog Tags at TrophyCentral. Each Sports Tag Can Be Engraved.qtdogvollVolleyball, Sportscustom-pagecl1012-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    "PT1=Medals" "PC12=105503-60.7530027.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,50:28%,100:34%,500:41%"Award Medals - All Subjects" "Sports Medals" "Volleyball Awards" "Volleyball Medals"Find our Volleyball 2" Olympic-Style J-Series Medals at a super price point at TrophyCentral. Large quantity discounts available!j958811-10-2009Volleyball, Sports
    custom-pagevolunteer-medals20medals498552-40.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful Outstanding Volunteer 2" Epoxy-covered insert decal discounted at TrophyCentral. Fast 1-2 day shipping.Volunteercustom-pagevolunteerpinsplastic-pinbox-t5498551-20.550040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find our 3D Series gold outstanding volunteer pin discounted at TrophyCentral. Each outstanding volunteer pin features a clutch back so it can be easily and safely attached to clothing. Fast 1-2 day shipping.Volunteercustom-pagetrophies-volunteer1"Download Only"free-appreciation49855011TrophyCentralCertificates / CoversAward Certificates1See this Volunteer Certificate designed exclusively for TrophyCentral! Volunteer certificates can be downloaded for free! Each volunteer award certificate measures 11 x 8 1/2 inches.volunteerfrVolunteer, Thank You, Appreciationcustom-pagevolunteer-medals1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Outstanding Volunteer Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Volunteercustom-pagetrophies-volunteer1trophies498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Volunteer insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-Volunteer-InsertVolunteercustom-pagetrophies-volunteer1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Volunteer single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - VolunteerVolunteercustom-pagetrophies-volunteer1trophies498551-311821.06TrophyCentraltrophies1Volunteercustom-pagefire-department-pins12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality Volunteer Fire Department Inserts at TrophyCentral. Each Volunteer Fire Department Insert can be used to create a unique plaque, medal or trophy.514093Firefighter, Hero
    custom-pagevolunteer-medals12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality Volunteer Fire Fighter Inserts at TrophyCentral. Each Volunteer Fire Fighter Insert can be used to create a unique plaque, medal or trophy.495759Firefighter, Hero
    custom-pagequickshiptrophies-fireman20trophies498551-30.5100021TrophyCentralInsertsSports, Hobby, Org, Livestock1Find this colorful Volunteer Firefighter 2" Epoxy-covered insert discounted at TrophyCentral. Fast 1-2 day shipping.Firefightercustom-pagequickshiptrophies-fireman1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Volunteer Firefighter Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Firefightercustom-pagequickshiptrophies-fireman1trophies498551-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Volunteer Firefighter insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Firefightercustom-pagequickshiptrophies-fireman1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Volunteer Firefighter single column insert trophy features a choice of column color, a marble base and free trophy engraving.Firefightercustom-pagequickshiptrophies-fireman1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Volunteer Firefighter Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Firefightercustom-pagequickshiptrophies-fireman1medals498551-30.525035.5TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find this colorful Volunteer Firefighter insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Firefightercustom-pagequickshiptrophies-fireman1medals498551-30.525035.5TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find this Volunteer Firefighter insert medal with a personalized front rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Firefightercustom-pagequickshiptrophies-fireman1plaques498551-311.11623.5TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these Volunteer Firefighter insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Firefightercustom-pagequickshiptrophies-fireman1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our volunteer firefighter insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Firefightercustom-pagequickshiptrophies-fireman1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Volunteer Firefighter Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Firefightercustom-pagevolunteerpinsplastic-pinbox-t10498551-30.5200040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find this Outstanding Volunteer Gold Enamel lapel pin discounted at TrophyCentral. Features a clutch-pin back for easy attachment to clothing.. Fast 1-2 day shipping.1volunteer-u-pbVolunteercustom-pagevolunteer-medals1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Outstanding Volunteer Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Volunteercustom-pagenew-tc-color-medals1medals498552-30.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Colorful Outstanding Volunteer insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Volunteercustom-pagevolunteer-medals1medals498552-40.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Outstanding Volunteer insert medal With A Personalized Front Rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Volunteercustom-pagecherry-insert-plaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these volunteer insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Volunteercustom-pageappreciation-templatesvolunteer-mcvolunteer-mc-prvolunteer-jigfvolunteer-jibfvolunteer-jisf1award-medals1Shop for volunteer medals at TrophyCentral. Volunteer medals include a neck ribbon and most ship in just 1-2 business days.

    Frequently Asked Questions (FAQ)

    🏅 What types of volunteer medals do you offer?

    We offer a variety of volunteer medals, including gold, silver, and bronze finishes. Many feature beautiful designs such as hands of service, hearts, or stars to symbolize appreciation and dedication.

    🎖 Who typically receives volunteer medals?

    Volunteer medals are awarded to individuals or groups who have demonstrated outstanding service in their communities, schools, nonprofit organizations, or charitable events.

    ✨ Can I customize volunteer medals with engraving?

    Yes! Many of our volunteer medals can be engraved with recipient names, event dates, or special messages to recognize outstanding contributions.

    📦 Do you offer bulk discounts for organizations?

    Absolutely! We provide special pricing for nonprofits, schools, and organizations ordering volunteer medals in bulk. Contact us for details on volume discounts.

    🏆 What is the best way to recognize volunteers?

    In addition to volunteer medals, consider presenting engraved plaques, certificates, or trophies to show appreciation for their hard work and dedication.

    🚚 How fast can I receive my volunteer medals?

    Most of our volunteer medals ship within 1-2 business days. Custom engraving may take slightly longer, so we recommend ordering early for award ceremonies.

    ]]>
    volunteerpins
    custom-pagetrophies-volunteer1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Volunteer insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - VolunteerVolunteercustom-pageappreciation-templatesbr312volapinbr243br559br380br655volunteer-pbvolunteer-u-pb3d9-volunteer1corporatepins1Find a great selection of volunteer pins discounted at TrophyCentral. Each volunteer lapel pin features a clutch back or safety pin for easy attachment to clothing.Lapel Pins: Volunteer TrophyCentral has a great selection of stock volunteer lapel pins in a chenille gold finish and in several styles. We also carry "thank you" pins, which can be used for teachers, donors and more. Each volunteer pin features a clutch-pin back for safe and easy attachment to clothing.

    Shop with Confidence at TrophyCentral!

    If you are looking to buy volunteer lapel pins online, look no further! TrophyCentral has a great selection that will fit any budget. Our top-rated representatives are happy to assist you with all of your pin needs. Our experts in New York and Michigan have been providing suggestions and guidance since 1999! To find the perfect pin, click on an image above, or for personal service, call us toll-free at 1-888-809-8800.]]>
    volunteer-medals engraveablepin
    custom-pagevolunteerpinsplastic-pinbox-t5lapel pins498551-20.525040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find this Outstanding Volunteer Gold Enamel lapel pin discounted at TrophyCentral. Features a clutch-pin back for easy attachment to clothing.. Fast 1-2 day shipping.volunteer-u-pbVolunteer11Comprehensive volunteer recognition guide for nonprofits, churches, and community organizations. Discover creative award ideas, service milestone celebrations, and meaningful appreciation strategies.custom-pagevolunteer-medals1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Outstanding Volunteer Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Volunteercustom-pageaward-medalsblankawardthankyoutrophyjaglscservice-award-plaquethank-you-award-plaquevolunteer-part-ivolunteer-single-ivolunteer-champ-ivolunteer-plaque-ivolunteer-e-part-ivolunteer-e-single-icup-volunteer-in1trophies1

    Volunteer Appreciation & Recognition Trophies

    TrophyCentral has an industry-leading selection of Volunteer trophies and awards. Be sure to see our popular Thank You Trophy, a perfect way to show appreciation for almost any occasion. Also see our Star Insert Trophies and add an Appreciation or Thank You insert. These same inserts can be added to many of our plaques. All of our trophies include up to three lines of FREE ENGRAVING (larger awards may include additional lines).

    Volunteer Medals and Pins

    If you are looking for a budget-friendly alternative to trophies, our award medals and lapel pins are the perfect solution. Volunteer medals come in gold, silver and bronze finishes and offer optional engraving to keep the price as low as possible. Be sure to also check out our 1 1/4" Budget Medals. All of our medals include a neck ribbon, and many offer a choice of ribbon color. Without engraving, your order will typically ship in just 1-2 business days, so no need to worry if you have waited for the last minute. Our pins include a clutch-pin back for easy and safe attachment to clothing.

    Be sure to see our Volunteer and Service Awards Guide.

    Frequently Asked Questions (FAQ)

    🏆 What types of volunteer trophies do you offer?

    We offer a wide selection of volunteer trophies, including elegant crystal awards, classic gold cup trophies, and unique resin figures featuring hands of service, stars, or appreciation symbols.

    🌟 Who are volunteer trophies designed for?

    Volunteer trophies are perfect for recognizing individuals or groups who have made a significant impact through community service, nonprofit work, or school volunteer programs.

    🖋️ Can I personalize my volunteer trophy with engraving?

    Yes! Many of our volunteer trophies include free engraving, allowing you to customize them with names, dates, and special messages to honor dedicated volunteers.

    📦 Do you offer discounts for bulk trophy orders?

    Absolutely! If you're ordering multiple volunteer trophies for a school, nonprofit, or corporate event, we offer bulk pricing. Contact us for more details.

    🏅 What is the difference between volunteer trophies and volunteer plaques?

    Volunteer trophies are free-standing awards often featuring figures or cups, while plaques are flat awards designed to be hung on walls. Both are excellent ways to recognize volunteer achievements.

    🚚 How long does it take to receive my volunteer trophies?

    Most of our volunteer trophies ship within 1-2 business days. Custom engraving may take slightly longer, so we recommend ordering in advance for your event.

    ]]>
    volunteerpins volunteer-medals
    custom-pageappreciation-templates1"Download Only"free-appreciation49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Volunteering Award template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Volunteering-Award-Certificatevolunteering-award-freeVolunteer, Thank You, Appreciationcustom-pagevolunteerpinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"Find these Volunteers Have Heart pins discounted at TrophyCentral. Each lapel pin features a beautiful finish and clutch back.br243General, Volunteer, Thank Youcustom-pagename-badges-tagswoyoulipr100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Vote (Election) Badges Discounted At TrophyCentral.namebadges-votecustom-pagehigh-end-awards1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"general410187-1010.45648.45JcharlesGeneral Awards1:22%,25:24%"crystal awards" "Business Award" "Corporate Award" See this fabulous Voyager Award at TrophyCentral. See our great selection of engraved and personalized awards!custom-pageletter-shaped-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find these popular W-shaped custom mascot badges at TrophyCentral. Great for fundraising! TrophyCentral is a top-rated Yahoo merchant.letterbadges-wcustom-pagewalmouncas14404-ck-bz14405-ck-bz14406-ck-bz14408-ck-bz14404-ck-sn14405-ck-sn14406-ck-sn14408-ck-sn14404-wb-bz14405-wb-bz14406-wb-bz14408-wb-bz14404-wb-sn14405-wb-sn14406-wb-sn14408-wb-sn11Find recessed display cases for schools and offices discounted at TrophyCentral. Each recessed display case is made in the US by Waddell.wall-mounted-champion wall-mounted-legacycustom-pagebaseballdisplay11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.5113.5Perfect CaseDisplay Cases11:14%,5:15%Museum-quality hat display case. UV-protected glass with mirrored backing. Preserve autographed caps, acid-free adhesives. Cherry wood molding. Buy now.wallmountcapBaseball / T-Ball, Sportscustom-pagebaseballdisplay11"7-10 business days w/Logo, 4-6 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.517.5Perfect CaseDisplay Cases11:14%,5:15%Wall Mounted Double Baseball Glass Display Case. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.wallmountdoublebaseballBaseball / T-Ball, Sportscustom-pagefootballdisplay11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.5113.5Perfect CaseDisplay Cases11:14%,5:20%Wall Mounted Double Mini Helmet Glass Display Cases. TrophyCentral is a Top-Rated Yahoo Merchant.Football, Sportscustom-pagehockeypuckdisplays1"7-10 business days w/Logo, 4-6 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.517.5Perfect CaseDisplay Cases11:14%,5:15%Wall Mounted Double Puck Glass Display Cases from TrophyCentral.Hockey, Sportscustom-pagebaseballdisplay11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.5131.5Perfect CaseDisplay Cases11:14%,5:15%Wall Mounted Glass Baseball Bat Display Case. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.wallmountbatBaseball / T-Ball, Sportscustom-pagebaseballdisplay11"7-10 business days w/Logo, 4-6 without" "Apopka, FL 32712" "UPS (FedEx available on request)"trophies327765-101 3 22 231.517.5Perfect CaseDisplay Cases11:14%,5:16%Wall Mounted Glass Baseball Display Case. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Baseball / T-Ball, Sportscustom-pagefootballdisplay11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.5116.5Perfect CaseDisplay Cases11:14%,5:17%Wall Mounted Glass Football Display Case. Ideal for leagues, schools, and tournaments. Fast shipping.Football, Sportscustom-pagefootballdisplay11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.5139.5Perfect CaseDisplay Cases11:14%,5:15%Wall Mounted Glass Football Helmet Display Case. Ideal for leagues, schools, and tournaments. Fast shipping.Football, Sportscustom-pagegolfballdisplay1"7-10 business days w/Logo, 4-6 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.516.5Perfect CaseDisplay Cases11:14%,5:16%Wall Mounted Glass Golf Ball Display Case. Ideal for leagues, schools, and tournaments. Fast shipping.Golf, Sportscustom-pagefootballdisplay11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.519.5Perfect CaseDisplay Cases11:14%,5:15%Wall Mounted Glass Mini Football Helmet Display Case. Ideal for leagues, schools, and tournaments. Fast shipping.Football, Sportscustom-pagefootballdisplay11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.5116.5Perfect CaseDisplay Cases11:14%,5:17%Wall Mounted Glass Upright Football Display Case. Ideal for leagues, schools, and tournaments. Fast shipping.Football, Sportscustom-pagebaseballdisplay11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.5117.5Perfect CaseDisplay Cases11:14%,5:17%Find this fabulous wall-mounting baseball glove display case discounted at TrophyCentral!wallmountgloveBaseball / T-Ball, Sportscustom-pageracingdisplays11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.5113.5Perfect CaseDisplay Cases11:14%,5:20%"Sports Display Case" "Sports Displays" "Sports Display" "Sports Display Cases" "Sport Display Cases" "Acrylic Sports Display" "Acrylics Displays" "Acrylic Display Cases" "Sports Ball Holder" "Sports Ball Holders"Wall Mounted Race Car Glass Display Cases from TrophyCentral.custom-pageracingdisplays1"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.5139.5Perfect CaseDisplay Cases11:14%,5:15%Wall Mounted Racing Helmet Glass Display Cases from TrophyCentral.custom-pagehockeypuckdisplays1"7-10 business days w/Logo, 4-6 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.516.5Perfect CaseDisplay Cases11:14%,5:16%Wall Mounted Single Puck Glass Display Cases from TrophyCentral.Hockey, Sportscustom-pagebaseballdisplay11"7-10 business days w/Logo, 4-6 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.517.5Perfect CaseDisplay Cases11:14%,5:16%Find this fabulous wall-mounting softball display case discounted at TrophyCentral!wallmountsoftballSoftball, Sportscustom-pagebaseballdisplay11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"327765-101 3 22 231.519.5Perfect CaseDisplay Cases11:14%,5:20%Wall Mounted Triple Baseball Glass Display Case. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.wallmounttriplebaseballBaseball / T-Ball, Sportscustom-pagefootballdisplay11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.5116.5Perfect CaseDisplay Cases11:14%,5:15%Wall Mounted Triple Mini Helmet Glass Display Cases. TrophyCentral is a Top-Rated Yahoo Merchant.Football, Sportscustom-pagehockeypuckdisplays1"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.519.5Perfect CaseDisplay Cases11:14%,5:20%Wall Mounted Triple Puck Glass Display Cases from TrophyCentral.Hockey, Sportscustom-pagecolor-wall-plaques1"1-2 business days" "Marquette, MI" "UPS"plaques498852-310.51017.50Quick TrophyPlaquesColor Plaques1:14%,3:17%"New Products"Find These Beautiful 8 x 10 Inch Vertical Matte Black Finish Plaques Discounted And With Free Engraving At TrophyCentral. Optional Full Color Logo.8x10blackfinishBlank, Generalcustom-pagecolor-wall-plaques1"1-2 business days" "Marquette, MI" "UPS"plaques498852-310.51034.50Quick TrophyPlaquesColor Plaques1:14%,3:17%"New Products"Find These Beautiful 9 x 12 Inch Vertical Matte Black Finish Plaques Discounted And With Free Engraving At TrophyCentral.9x12blackfinishBlank, Generalcustom-pagecolor-wall-plaques1"1-2 business days" "Marquette, MI" "UPS"plaques498852-310.51013.50Quick TrophyPlaquesColor Plaques1:14%,3:17%"New Products"Find These Beautiful 9 x 7 Inch Horizontal Matte Black Finish Plaques Discounted And With Free Engraving At TrophyCentral.9x7blackfinishBlank, Generalcustom-pageofficesigns11"1-2 business days" "Roanoke, Virginia" "UPS (FedEx available on request)"240169-1210.455015.45RoanokeOffice Signs1custom-pagedisplaycases1wall-mounted-recessedwall-mounted-championwall-mounted-legacywalmoundis1trophycases1"Retail Displays" "Retail Display Cases" "Retail Display" "Retail Cases" "Retail Store Display" "Retail Store Displays" "Retail Display Case"Browse wall-mounted and recessed trophy cases in every size and style. Get free engraving, fast shipping, and expert display advice. Display it brilliantly.

    Our Premium Display Case Collection

    Discover endless options in wall-mounted display cases. Each case features precision-crafted details, perfect for showcasing trophies, medals, and prized collectibles. These display cases are available in multiple styles and in small and large sizes. Transform any wall into your personal hall of fame.

    Shop For Wall-Mounted Display Cases and Recessed Displays With Confidence

    Trophy Central has an industry-leading selection of trophies that will fit any budget, all at discounted prices with free personalization. Our experts in New York, Michigan, and online have been providing guidance since 1999. We have served over 100,000 customers, including 370+ Fortune 500 companies and over 9,600 elementary and secondary schools, colleges, and universities.

    Why Shop Trophy Central

    We offer low prices on all wall-mounted display case sizes, making our pieces affordable for all. Most items ship in a fast 1-2 days, with same-day shipping available depending on your location. We make it as easy as possible to buy trophies and display cases online at discounted prices, ensuring a smooth shopping experience from start to finish.

    Ready to Showcase Your Achievements?

    Browse our extensive collection of wall-mounted and recessed display cases today. Shop now and save more with our bulk discounts.

    Frequently Asked Questions

    What type of lighting works best inside the display cases?

    LED strip lights or puck lights are ideal for display cases, especially large models. These lights produce minimal heat, use little energy, and last for years. Warm white enhances gold trophies, while cool white makes silver and crystal sparkle. Avoid halogen or incandescent bulbs that generate heat and can damage items or cause fading.

    How do I prevent dust from getting inside my display cases?

    Choose display cases with tight-fitting doors and weather stripping seals. Add felt strips along door edges if needed. Position your display cases on walls that are away from air vents and high-traffic areas. Some collectors use positive air pressure systems or small cabinet filters. Even sealed display cases benefit from occasional gentle cleaning.

    How do I arrange trophies of different sizes in display cases?

    Place the largest collectibles at the bottom or back, creating visual stability. Use risers or platforms to vary heights. Group similar items together or arrange chronologically. Leave breathing room between pieces as overcrowding diminishes impact. Consider diagonal arrangements for dynamic displays. Rotate seasonal items to keep displays fresh.

    What backing materials look best in trophy display cases?

    Mirror backing doubles the visual impact and makes display cases appear deeper. Options like trophy cases designed with fabric-covered cork allow for pinning ribbons or photos, and walnut wood grain adds warmth.

    Black felt creates a dramatic contrast for white or light-colored awards. Some people prefer neutral colors that won't compete with displayed items. Consider a removable backing for different styles.

    ]]>
    custom-pageask-trophy-expert11Wall-mounted trophy cases save space and display at eye level. Floor cases hold more awards and create impact. Compare advantages to choose the right display.custom-pagequickshiptrophies-fireman11plaques105503-610.451813.25Classic MedallicsPlaquesBlank Plaques1:22%Shop for Walnut Appreciation Plaques from TrophyCentral.Blank, Generalcustom-pagecertificateplaques1"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"plaques105502-313.311251.3Classic MedallicsPlaquesCertificate Plaques1:14%,10:18%,50:23%,100:27%"Certificate Plaques" "Certificate Plaque" "Plaques That Hold Certificates" "Certificate Holders" "Plaques For Certificates" "Graduation Plaques" "Diploma Holders" "Padded Diploma Covers" "School Diploma Covers" "Diploma Covers" "Custom Diploma Covers"Find This Walnut Certificate Plaque Discounted at TrophyCentral. Ships In Just 1-3 Business Days. Quantity Discounts Available.pn4642wl05-22-2009Certificates / Sealscustom-pagecertificateplaques1"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"plaques105502-31111226.2Classic MedallicsPlaquesCertificate Plaques1:14%,10:17%,50:21%,100:25%"Diploma Holders" "Padded Diploma Covers" "School Diploma Covers" "Diploma Covers" "Custom Diploma Covers" "Certificate Plaques" "Certificate Plaque" "Plaques That Hold Certificates" "Certificate Holders" "Plaques For Certificates" "Graduation Plaques"See This Popular Walnut Certificate Plaque with Silver Frame Discounted at TrophyCentral. Holds 8 1/2" x 11" Certificate. Fast 1-2 Day Shipping!pn4931wls03-26-2009Certificates / Sealscustom-pagecertificateplaques1"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"plaques105502-31111225Classic MedallicsPlaquesCertificate Plaques1:14%,10:17%,50:21%,100:25%"Diploma Holders" "Padded Diploma Covers" "School Diploma Covers" "Diploma Covers" "Custom Diploma Covers" "Certificate Plaques" "Certificate Plaque" "Plaques That Hold Certificates" "Certificate Holders" "Plaques For Certificates" "Graduation Plaques"See This Popular Walnut Finish Certificate Plaque with Gold Frame Discounted at TrophyCentral. Holds 8 1/2" x 11" Certificate. Fast 1-2 Day Shipping!Certificates / Sealscustom-pagegavelplaques11"4-6 business days" "Mount Vernon, NY" "UPS"plaques105503-610.4511627.65Classic MedallicsPlaques, GiftsGavels1:22%Popular Walnut Gavel from TrophyCentral. What is a Gavel? Gavels are used as Awards for those Serving on Committees.wafiga05-16-2011Gavelcustom-pagegavelplaques11"7-10 business days w/engraving" "Chicago, Illinois" "UPS (FedEx available on request)"plaques606307-101 3 230.452018.45RS OwensPlaquesGavels1:22%"Leadership Recognition"Removable Walnut Gavel Plaques from TrophyCentral.12-20-2020Gavel49-301149-340149-358149-764949-766450-165451-150151-341151-409351-776451-782551-782651-815551-815751-818551-818651-818851-819651-828851-fund70-702811Find Walnut Insert Plaques Discounted at TrophyCentral. Each Walnut Insert Plaque Features Free Engraving.custom-pagequickshiptrophies-fireman1"3-6 business days with engraving, Without engraving: 1-3 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"plaques105503-610.4511219.65Classic MedallicsPlaquesInsert1:22%,3:24%,5:27%"Fire Awards" "Fire Trophies" "Fire Department Awards" "Fire Department Trophies"Genuine Walnut Fire Department (FD) Plaque with 2 Inch Insert and Free Engraving.51-4093Firefighter, Herocustom-pagetrophies-golf1"3-6 business days with engraving, Without engraving: 1-3 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"plaques105503-610.4511222.05Classic MedallicsPlaquesInsert1:22%,3:23%,5:24%"Sports Awards"Walnut Plaque - Golf. Ideal for leagues, schools, and tournaments. Fast shipping.49-3011Golf, Sportscustom-pagetrophies-tennis1"3-6 business days with engraving, Without engraving: 1-3 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"plaques105503-610.4511222.05Classic MedallicsPlaquesInsert1:22%,3:23%,5:24%"Sports Awards"Genuine Walnut Tennis Plaque with 2 Inch Insert and Free Engraving.49-7649Tennis, Sportscustom-pagesports-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Water Polo Inserts (Litho) at TrophyCentral. Each Water Polo Insert can be used to create a unique plaque, medal or trophy.50341Swimming / Diving, Sports
    custom-pageglass-crystal-awards1"10-15 business days w/engraving" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"general105505-1010.451 2 3 4 5 6 7 8 91420.45Classic MedallicsCrystal Awards1:22%,25:23%Shop for Wave Crystal Awards with Black Trim from TrophyCentral. Free Engraving on Crystal Awards.Leadershipcustom-pageflaglapelpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsHero1:22%,50:30%,100:38%,500:58%"Flag Pin Section" "Flag Lapel Pins" "Lapel Pins - Flag" "Discount Flag Pins" "Cheap Flag Pins" "Flag Pins Cheap" "Buy Flag Pins" "Shop For Flag Pins" "U.S. Flag Pins" "American Flag Pins" "Flag Pins US" "Flag Pins American"frlapinReturn to thecategory for other great pins in many styles.flaglapelpinsFlags, Generalcustom-pagemedallion-inserts-general-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these high-quality Wedding Anniversary Inserts at TrophyCentral. Each Wedding Anniversary Insert can be used to create a unique plaque, medal or trophy.518199Wedding
    custom-pageshop-by-categoryweightlifting-eiweightlifting-plaque-i1trophies1Find a fabulous selection of weightlifting trophies at TrophyCentral. Each weightlifting trophy Includes free engraving. Medals feature a free medal.Custom Weightlifting Trophies

    TrophyCentral has been supplying weightlifting clubs, powerlifting meets, and strength competitions with quality trophies and medals since 1999. All weightlifting trophies include up to three lines of free engraving, and weightlifting medals include a free neck ribbon. All orders, including engraved orders, typically ship in 1-2 business days and sometimes the same day, depending on time of year and when the order is placed. Browse our complete trophies collection for additional styles and designs.

    ]]>
    custom-pagenew-trophies-21trophies498551-310.452429Trophies1Find this popular Weightlifting trophy discounted at TrophyCentral. Features a real marble base, free engraving and fast shipping.weightlifting-cup-place-trophy-tccustom-pagetrophies-weightlifting-power1"1-4 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:16%Fabulous Weightlifting Place trophy with 1st, 2nd or 3rd Place Trim, Marble Base and Free Engraving. Ships in a fast 1-2 days!qtliftplWeightlifting, 1st / 2nd / 3rd / Etc.custom-pagetrophies-weightlifting-power1medals498551-20.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful Weightlifting 2" Epoxy-covered insert sticker discounted at TrophyCentral. Fast shipping, free over $99.custom-pagetrophies-weightlifting-power1"1-4 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:16%This popular Weightlifting trophy features a real marble base, column, figure and trim indicating year of award. Includes up to three lines of free engraving!qtliftyrWeightlifting, Sportscustom-pagetrophies-weightlifting-power1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with weightlifting figure discounted at TrophyCentral. Includes free text engraving!cup-lift-pWeightlifting, Sportscustom-pagetrophies-weightlifting-power1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311820JDS-STrophiesSports, Hobby, Org, Livestock1:14%,10:19%Acrylic Weightlifting Triangle Awards with Free Engraving from TrophyCentral. Fast 1-2 Day Shipping!qtweighttrWeightlifting, Sportscustom-pagetrophies-weightlifting-power1medals498551-2120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Weightlifting Excellence Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Shipping is free over $99.Weightlifting, Sportscustom-pagetrophies-weightlifting-power1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these weightlifting budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtliftscbWeightlifting, Sportscustom-pagetrophies-weightlifting-power1trophies498551-310.453633.4trophies1Find this budget weightlifting award trophy discounted at TrophyCentral. Features a real marble base and plastic weightlifter figure. Engraving is free. Fast 1-2 day shipping.Weightlifting, Sportscustom-pagetrophies-weightlifting-power1trophies498551-211.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Weightlifting insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-Weightlifting-InsertWeightlifting, Sportscustom-pagetrophies-weightlifting-power1"1-4 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:26%Find these fabulous two-tier Weightlifting Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtliftttWeightlifting, Sportscustom-pagetrophies-weightlifting-power1"1-4 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-411.215Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:28%Find this awesome Weightlifter two tier championship trophy discounted at TrophyCentral. Add up to 3 lines of Free Personalization!qtliftttwWeightlifting, Sportscustom-pagetrophies-weightlifting-power1trophies498551-210.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Weightlifting single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - WeightliftingWeightlifting, Sportscustom-pagetrophies-weightlifting-power1"1-4 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:22%This popular Weightlifting Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtliftscWeightlifting, Sportscustom-pagetrophies-weightlifting-power1trophies498551-211821.06TrophyCentraltrophies1Weightlifting, Sportscustom-pagetrophies-weightlifting-power1"1-4 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.05Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:16%Find These Popular Weightlifting Deluxe Platform Trophies Discounted at TrophyCentral. Real Marble; Free Engraving!qtliftdmWeightlifting, Sportscustom-pagetrophies-weightlifting-power1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Weightlifting figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-lift-scbWeightlifting, Sportscustom-pagetrophies-weightlifting-power1trophies498551-210.71217.38trophies1Weightlifting, Sportscustom-pagetrophies-weightlifting-power1medals498551-2120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Weightlifting Excellence Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Shipping is free over $99.Weightlifting, Sportscustom-pagetrophies-weightlifting-power1"1-4 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-411.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:18%,10:23%Find these fabulous two-tier, 3-column champion Weightlifting Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtlift3cWeightlifting, Sportscustom-pagetrophies-weightlifting-power1medals498551-20.525035.5TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find this colorful Weightlifting insert medal discounted at TrophyCentral. Fast shipping, free over $99.Weightlifting, Sportscustom-pagetrophies-weightlifting-power1medals498551-20.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Weightlifting Excellence insert medal With A Personalized Front Rim discounted at TrophyCentral. Fast shipping, free over $99.Weightlifting, Sportscustom-pagetrophies-weightlifting-power1trophies498551-21.1plaques1Find these weightlifting insert plaques discounted at TrophyCentral. Price includes free engraving. Shipping is free over $99.Weightlifting, Sports11Find weightlifting medals discounted at TrophyCentral. Each weightlifting medal features a free ribbon.trophies-weightlifting-powercustom-pagetrophies-weightlifting-power1trophies498551-210.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our weightlifting insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - WeightliftingWeightlifting, Sportscustom-pagetrophies-weightlifting-power1"1-4 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:24%Our popular Weightlifting participation trophies feature a real slant-front marble base and free engraving.qtliftncWeightlifting, Sportscustom-pagetrophies-weightlifting-power1medals498551-2120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Weightlifting Excellence Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Shipping is free over $99.Weightlifting, Sportscustom-pageappreciation-templates1"Download Only"certificates4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Well Done! template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Well-Done!-Certificatewell-done-freeVolunteer, Thank You, Appreciation, Student, Academiccustom-pagetrophies-golf1"10 business days" "Aliquippa, PA" "UPS"trophies1500110-1412428Glass AmericaCrystal AwardsSports, Hobby, Org, Livestock1:22%,10:28%"Hole-in-One Awards"Westminster Crystal Golf Awards (3 Sizes). Ideal for leagues, schools, and tournaments. Fast shipping.Golf, Sportscustom-pagecustom-pennants-guide11Custom pennants are triangular felt/fabric banners perfect for team spirit, school pride, and fundraising. Learn uses, display options, and benefits.custom-pagecustom-pennants-guide11Explore text, logo, color, and graphic options for custom pennants. Learn design best practices and what's included in standard customization.custom-pagerunning-trophies11Elite runners share training music strategies. Curated playlists for tempo runs, long runs, and intervals plus science on when music helps vs. hurts performance.custom-pagescholarship-resource-hub11An inside look at what scholarship committees actually value in coach recommendations. Learn what committees look for, common red flags and more!custom-pagescholarship-resource-hub11Inside look at what scholarship committees actually evaluate in teacher recommendation letters. Learn what committees value most and common red flags to avoid.custom-pageask-trophy-expert11Include the recipient's name, achievement, organization, and date. Learn the essential elements and see examples for sports, corporate, and academic trophies.custom-pageexpert-baseball-trophies11Real engraving examples for youth baseball trophies. Learn what to include, formatting guidelines, and common mistakes to avoid when personalizing awards.custom-pageexpert-soccer-trophies11Real engraving examples for youth soccer trophies. Learn what to include, formatting guidelines, and common mistakes to avoid when personalizing awards.custom-pagecustom-pennants-guide11Choose from 4x9" mini pennants, 9x24" standard, or 12x30" large pennants. Get sizing recommendations for team gifts, wall displays, and gym decoration.custom-pageask-trophy-expert11Championship trophies are typically 15-24 inches tall, while participation awards are 6-10 inches. Learn how to choose the right trophy size for your event.custom-pagegift-certificate-templates1"Download Only"certificates4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Gift Certificate template (design 3) is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.gift-certificate-design-3gift-certificate-a3Gift Certificate, Holidaycustom-pageexpert-baseball-trophies11Find the perfect trophy for 9-10 year old baseball players. Expert recommendations on trophy sizes, styles, and budget options for 10U youth teams.custom-pageexpert-baseball-trophies11Understand the difference between participation and MVP trophies for youth baseball. Get sizing guidelines, budget tips, and age-appropriate recognition strategies.custom-pageask-trophy-expert11Resin trophies are budget-friendly and detailed, while crystal offers premium elegance. Learn which material is right for your awards and recognition needs.custom-pageask-trophy-expert11Rosette ribbons feature pleated circular tops for formal competitions. Flat ribbons (including pinked-edge) are economical for participation awards.custom-pageexpert-soccer-trophies11Understand the difference between participation and MVP trophies for youth soccer. Get sizing guidelines, budget tips, and age-appropriate recognition strategies.custom-pageexpert-baseball-trophies11Understand the differences between T-ball and baseball trophies. Learn age-appropriate sizing, styles, and features for players ages 4-12.custom-pagebr3715"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"105502-310.5119217.78Classic Medallicsaward-medals1:22%,10:37%Display your medals with this white cotton-filled box. These Medal Display Boxes Ship Fast.custom-pagecertificateplaques1"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"plaques105502-310.451510.45Classic MedallicsPlaquesCertificate Plaques1:14%,100:25%"Certificate Plaques" "Certificate Plaque" "Plaques That Hold Certificates" "Certificate Holders" "Plaques For Certificates" "Graduation Plaques"See This Popular White Certificate Plaque with Gold Frame Discounted at TrophyCentral. Holds 8 1/2" x 11" Certificate. Fast 1-2 Day Shipping!pn4931whgCertificates / Sealscustom-pagecertificateplaques1"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"plaques105502-310.451813.25Classic MedallicsPlaquesCertificate Plaques1:14%,10:18%,50:23%,100:27%"Diploma Holders" "Padded Diploma Covers" "School Diploma Covers" "Diploma Covers" "Custom Diploma Covers" "Certificate Plaques" "Certificate Plaque" "Plaques That Hold Certificates" "Certificate Holders" "Plaques For Certificates" "Graduation Plaques"Find this White Certificate Plaque discounted at TrophyCentral. Each certificate plaque is gift-boxed.pn4642whCertificates / Sealscustom-pageflower-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"Find white rose pins discounted at TrophyCentral. Each white rose lapel pin features a clutch-pin back. Fast 1-2 day shipping on all flower pins.br387Generalcustom-pagecospwabo50"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745315125016.5PepcoPromotional ProductsSports / Water Bottles1:14%,250:21%,500:31%,1000:45%,2500:49%White Custom Sports Bottles from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.sportsbottles-whiteSports / Water Bottlescustom-pagetrophies1trophies1TrophyCentral offers fabulous discounts on all products and also features a variety of wholesale and affiliate programs for leagues and retailers. Please contact us at 888-809-8800 for more information.custom-pageribbons-neck-drapejumpringshofordrri10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"ribbons105502-310.3612006.36Classic Medallicsribbons1:22%,100:30%,500:40%Find These Wide Neck Ribbons Discounted At TrophyCentral. Perfect for Award Medals 1 3/4" to 3" in Diameter.necrib30x138Red White Blue, Patrioticcustom-pagesoccerwaterbottles1200"7 business days from receipt of camera-ready artwork" "Oxnard, California" "UPS (FedEx available on request)"930307-810.45367.65PLPromotional ProductsWater Bottles1"Basketball Water Bottles" "Logo Sports Bottles" "Sports Bottles" "Promotional Sports Bottles" "Aluminum Sports Bottles" "Stainless Water Bottles" "Aluminum Water Bottles" "Bike Water Bottles" "Bicycle Water Bottles" "Baseball Water Bottles" "Football Water Bottles" "Promotional Water Bottles" "Soccer Water Bottles"Wide Neck Bike Bottle from TrophyCentral. Also see our great selection of engraved and personalized gifts!Sports / Water Bottlescustom-pageinsert-trophies-awards11trophies105503-610.4512424.45Classic MedallicsTrophiesGeneral1:22%Shop for Wide World Trophies from TrophyCentral. Discounted Trophies, Awards and Promotional Products.03-19-2010custom-pagemascotpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:30%,100:33%,500:47%"Mascot Awards" "Mascot Pins"Find these Wildcat Lapel Pins and other colorful mascot pins at TrophyCentral. Fast 1-2 day shipping!em02Mascotcustom-pagemascot-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Wildcat Mascot Badges Discounted At TrophyCentral.mascotbadges-wildcatcustom-pagesilver-cup-trophies11trophies105503-611.11221.1trophies1:30%Cupcustom-pagetrackpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsSports, Hobby, Org, Livestock1:22%,50:30%,100:33%,500:47%"Track Awards" "Cross Country Awards" "Track Pins" "Track Lapel Pins"Winged Foot, Torch Letter Pins: EC Series Winged Foot, Torch Lapel Pins feature a high-quality enameled finish and ship in just 1-2 business days!ec6506-23-2010custom-pagemedallion-inserts-general-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these quality Winged Victory (504271) Inserts (Litho) at TrophyCentral. Each Winged Victory (504271) Insert can be used to create a unique plaque, medal or trophy.504271
    custom-pagemedallion-inserts-general-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Find these quality Winged Victory Inserts discounted at TrophyCentral. Each Winged Victory insert can be used to create a unique plaque, medal or trophy.50701
    custom-pagequickshiptrophies-wheel1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular winged wheel figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at trophyCentral. Ships in a fast 1-2 days!qtwingedwheelpl03-15-2022custom-pagequickshiptrophies-wheel1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find these popular Winged Wheel year trim trophy discounted at trophyCentral. Available in multiple sizes and includes free engraving. Features gold year of event trim.qtwingedwheelyr03-15-2022custom-pagequickshiptrophies-wheel1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with car show, winged wheel driving figure discounted at TrophyCentral. Includes free text engraving!cup-wingedwheel-p03-15-2022custom-pagequickshiptrophies-wheel1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these car show, winged wheel budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtwingedwheelscb03-15-2022custom-pagequickshiptrophies-wheel1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:26%Find these fabulous two-tier Winged Wheel Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtwingedwheeltt03-15-2022custom-pagequickshiptrophies-wheel1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:28%Find this awesome Winged Wheel two tier championship trophy discounted at TrophyCentral. Add up to 3 lines of Free Personalization!qtwingedwheelttw03-15-2022custom-pagequickshiptrophies-wheel1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:21%,100:24%This popular Car Show, Winged Wheel Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtwingedwheelsc03-15-2022custom-pagequickshiptrophies-wheel1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.05Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%These quick-ship trophies from TrophyCentral feature a Winged Wheel figure, real marble base and marble trophy figure platform, choice of column size and color.qtwingedwheeldm03-15-2022custom-pagequickshiptrophies-wheel1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Car Show, Winged Wheel figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-wingedwheel-scb03-15-2022custom-pagequickshiptrophies-wheel1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.4226Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:18%,10:23%Find these fabulous two-tier, 3-column champion Winged Wheel Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtwingedwheel3c03-15-2022custom-pagequickshiptrophies-wheel1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:27%,100:32%Our popular Winged Wheel participation trophies feature a real slant-front marble base and free engraving.qtwingedwheelnc03-15-2022custom-pageblog-trophycentral11Baking competition prize tiers explained: gold is 1st, silver is 2nd, bronze is 3rd per category. How to structure tiers and awards for any size event.custom-pagegift-certificate-templates1"Download Only"certificates4985501Trophy CentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our winter themed template is free and designed exclusively for Trophy Central. This gift certificate measures 5" x 3" and can be easily downloaded and printed.Winter-Gift-Certificategc-winter-521Gift Certificate, Holiday11Beat winter blues with spirit awards that warm cold months. From ugly sweater contests to perfect attendance, discover 18 recognition ideas for schools and workplaces.11Discover winter sports trophy ideas for ski clubs and snowboard teams. 30+ categories from speed champions to progression awards. Budget strategies under $190 for 40 athletes. custom-pagemascot-plaques1plaques498552-41JDSPlaques1Find this wolf plaque discounted at TrophyCentral. Our wolf mascot plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Mascotcustom-pagemascottrophies1"4-6 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511016.25Classic MedallicsTrophiesAcademic1:22%,5:24%,10:28%,50:32%"Mascot Awards"Buy this Wolf mascot trophy and other mascot awards at TrophyCentral.mt200810-28-2020Mascotcustom-pagemascotinserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-40.3713003.37Classic MedallicsInsertsMascots1Buy these quality Wolverines Mascot Medal Inserts at TrophyCentral. Each Wolverines Insert can be used to create a unique plaque, medal or trophy.489936Mascot
    custom-pagemascotinserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-40.3713003.37Classic MedallicsInsertsMascots1Buy these quality Wolves Mascot Medal Inserts at TrophyCentral. Each Wolves Insert can be used to create a unique plaque, medal or trophy.489940Mascot
    custom-pagesports-inserts1105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Swimming Awards"Buy these quality Swimming (Women's Freestyle) Inserts (Litho) at TrophyCentral. Each Swimming (Women's Freestyle) Insert can be used to create a unique plaque, medal or trophy.504191Swimming / Diving, Sportscustom-pageachievement-certificates-awards1"Download Only"certificates49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Women's History Month template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Women's-History-Month-Certificatewomens-history-monthWomen's History, Academictrophies-tennisstarplaque2blankplaquelapplaqcomso7x9medalframeblprplservice-anniversary-plaque1plaques1Shop premium Wood Plaques in Cherry, Walnut and Black finishes. Perfect for academic, sports, and corporate awards. Fast 1-2 day turnaround.

    Looking for a custom engraved wood plaque that makes a lasting impression? TrophyCentral's wood plaques are handcrafted in Cherry, Walnut, Black, and Black Piano finishes - ideal for employee recognition awards, sports banquet plaques, school achievement awards, retirement gifts, and corporate milestone honors. Each plaque includes free professional engraving, ships in 1-2 business days, and is designed to display proudly on any wall or desk for years to come.

    Available in six standard sizes from 7"x9" up to 12"x15", our engraved wood plaques work equally well as a single personalized gift or for bulk orders recognizing an entire team or department. Cherry wood plaques offer a warm, classic look perfect for academic and sports awards, while Walnut plaques add a rich, dark grain favored for executive and retirement recognition. Our Black Piano finish plaques deliver a sleek, high-gloss look popular for corporate and leadership awards.

    Need help choosing the right award or finding the perfect words? Explore these helpful resources:

    FAQs - Custom Engraved Wood Plaques

    What wood finishes are available for engraved plaques?

    We offer four wood finishes to match any recognition style or setting. Cherry and Walnut are the classic choices - Cherry delivers a warm reddish-brown tone that feels timeless and approachable, making it a perennial favorite for school achievement awards, sports banquet plaques, and coach appreciation gifts. Walnut offers a deeper, darker grain with a more formal elegance, often chosen for retirement awards, years of service recognition, and executive honors. For a more contemporary look, our Black and Black Piano finishes bring a bold, modern aesthetic that stands out in corporate environments and leadership award programs. The Black finish features a sharp matte contrast, while the Black Piano finish adds a premium high-gloss lacquered surface that elevates the presentation for top-tier recognition events.

    Does engraving cost extra on wood plaques?

    Text engraving is always included free on every wood plaque order - no hidden fees, no per-character charges. You can personalize your plaque with names, job titles, dates, achievements, and custom messages at no extra cost. If you would like to add a company logo, organization seal, or custom artwork, logo engraving is available as an optional add-on. Our team reviews every order personally and will reach out if they need any artwork files or clarification before production begins.

    What sizes are available for wood plaques?

    Our wood plaques come in six sizes: 7"x9", 8"x10", 9"x7", 9"x12", 10"x8", and 12"x9". Smaller plaques like the 7"x9" work well for individual student or employee awards, while larger sizes like 12"x9" are popular for team plaques, retirement recognition, or prominent wall displays.

    Can I order wood plaques in bulk for a team or company?

    Yes. TrophyCentral specializes in bulk plaque orders for schools, youth sports leagues, corporate recognition programs, and banquet awards. Volume discounts are available - prices drop as low as $35 per plaque on qualifying orders. Every order is reviewed by a real person, not automated, to catch any issues before production.

    How long does it take to receive a custom engraved wood plaque?

    Most personalized wood plaque orders ship within 1-2 business days. Rush delivery options are available if you need your award faster. Free economy shipping is included on orders over $99.

    What occasions are wood plaques best suited for?

    Engraved wood plaques are a versatile recognition award appropriate for a wide range of occasions, including employee of the month awards, years of service milestones, retirement gifts, sports banquet plaques, academic achievement awards, coach appreciation gifts, volunteer recognition, and memorial tributes. Their traditional appearance suits both formal corporate settings and casual school or league banquets.

    ]]>
    gavelplaques perplaq photoplaques
    custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsBusiness1:22%Find these World Class Certified ISO 9000 Inserts discounted at TrophyCentral. Each ISO 9000 Insert can be used to create a unique plaque, medal or trophy.518730General
    custom-pagecrystalcups1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"general410187-1010.45214.45JcharlesCrystal Awards1:22%,25:25%"Tennis Awards"Find the World Class Cup discounted at TrophyCentral. This Champion's Cup Award includes free engraving!Leadership, Golf, Tennis, Sportscustom-pageeawardmedals12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    medals105503-60.75130033.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "School Medals" "General Award Medals"These inexpensive 1 1/4 inch World Class Performance Medals offer a high quality, but low price for those on a tight budget.e985802-01-2008General
    custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsGeneral1:22%Buy these quality World Class Performance Inserts (Litho) at TrophyCentral. Each World Class Performance Insert can be used to create a unique plaque, medal or trophy.507582General
    custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsGeneral1:22%Buy these high-quality World Class Performance Inserts at TrophyCentral. Each World Class Performance Insert can be used to create a unique plaque, medal or trophy.518371General, Business
    custom-pagefreeawardcertificates1"Download Only"certificates4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our World's Best template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-World's-Best-Certificateworlds-best-freeMost Improved, Academic, Appreciationcustom-pageglobal-crystal-awards1"10 business days" "Aliquippa, PA" "UPS"general1500110-1410.451236.45Glass AmericaCrystal Awards1:22%,10:25%Worldview Awards from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.custom-pagestar-pinsbr476gbr476sbr476b11Find These Wreath Star Pins In Three Finishes: Gold, Silver and Bronze. Each Wreath Star Is Includes a Clutch-Back and Is Discounted.stars-wreath

    Pins with Wreath and Stars

    The above wreath pins are available in three finishes: gold, silver and bronze. Each wreath and star pin features a clutch back and measures 7/8" in diameter. Most pins in this section ship from the factory in just 1-2 days. Bulk discounts are available for larger pin orders. For additional sizes and styles, please see our complete star pins section.]]>
    custom-pageshop-by-categoryqtwrestncqtwrestscqtwrestdmqtwrestyrqtwrestplqtwrestttqtwrestttwqtwrest3ctr7014tr9923wssx71qtwresperpmqtwrestscbcup-wrest-scbcup-wrest-pwrestling-part-iwrestling-single-iwrestling-champ-iwrestling-plaque-iwrestling-e-part-iwrestling-e-single-icup-wrestling-scb-icup-wrestling-inbdg-wrestlingcl140wrestling-mcwrestling-mc-prir17ir35qcm-53m162gm162sm162bj96323d-wrestling-medalstm9996gwrwrestling-jigfwrestling-jibfwrestling-jisfwrestling-inserts-medalswrestling-cup-place-column-trophywrestling-cup-place-trophy1trophies1"Wrestling Awards" "Sports Trophies"

    At TrophyCentral, we take pride in offering a wide range of wrestling trophies that recognize strength, determination, and sportsmanship on the mat. Whether you need awards for youth wrestling leagues, high school tournaments, or championship events, our collection has something for every budget and style. From classic column trophies to modern resin figures and custom engraved plaques, you will find the perfect way to honor outstanding athletes.

    Our wrestling trophies are fully customizable with free engraving to make each award personal and memorable. We also offer bulk discounts, making it easy to order for entire teams or tournaments without breaking the budget. Fast turnaround times ensure your awards arrive on schedule, so you can focus on celebrating your wrestlers' achievements.

    Choose from small, medium, and large sizes to match your event needs - whether you are recognizing every participant or spotlighting top performers. At TrophyCentral, we are committed to helping coaches, teams, and organizations create meaningful moments with quality awards that wrestlers will treasure for years to come.

    Be sure to see our expert guides: ]]>
    trophies-wrestling
    custom-pagetrophies-wrestling1trophies498551-310.452429Trophies1Find this popular Wrestling trophy discounted at TrophyCentral. Features a real marble base, free engraving and fast shipping.wrestling-cup-place-trophy-tccustom-pagetrophies-wrestling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%"Wrestling Trophies" "Trophies, Wrestling" "Wrestling Trophy"Find this popular wrestling figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at trophyCentral. Ships in a fast 1-2 days!qtwrestplWrestling, 1st / 2nd / 3rd / Etc., Sportscustom-pagewrestling-inserts-medals20498552-40.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful Wrestling 2" Epoxy-covered insert decal discounted at TrophyCentral. Fast 1-2 day shipping.Wrestling, Sportscustom-pagetrophies-wrestling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%"Wrestling Trophies" "Trophies, Wrestling" "Wrestling Trophy"This popular Wrestling trophy features a real marble base, column, figure and trim indicating year of award. Includes up to three lines of free engraving!qtwrestyrSee our complete selection ofin a wide variety of sizes and styles.trophies-wrestlingWrestling, Sportscustom-pagetrophies-wrestling1"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"medals498552-30.3716021.6TrophyCentralaward-medalsSports, Hobby, Org, Livestock1:14%,10:19%,50:28%,100:34%,500:42%"Wrestling Medals"Find These Wrestling 3D Relief Medals At A Great Low Price And With Fast Shipping At TrophyCentral. Large Quantity Discounts Available.3d-wrestling-medalsWrestling, Sportscustom-pagetrophies-wrestling1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with wrestling figure discounted at TrophyCentral. Includes free text engraving!cup-wrest-pWrestling, Sportscustom-pagetrophies-wrestling11Creative wrestling award ideas with engraving examples for tournaments and team banquets. From Pin Master to Mat General, discover 15+ unique ways to recognize wrestlers with actual trophy wording templates.custom-pagefree-sports-templates1"Download Only"certificates49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Wrestling template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Wrestling-Certificatewrestling-freeWrestling, Sportscustom-pagetrophies-wrestling1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Wrestling Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Wrestling, Sportscustom-pagetrophies-wrestling1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these wrestling budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtwrestscbWrestling, Sportscustom-pagetrophies-wrestling1498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Find this budget wrestling award trophy discounted at Trophy Central. Features a real marble base and plastic wrester figure. Engraving is free. Fast 1-2 day shipping.bdg-wrestlingWrestling, Sportscustom-pagetrophies-wrestling1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.451 2 3 4 5 6 7 8 911230.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,6:23%,12:24%,24:26%"Wrestling Awards"Shop for Cast Stone Wrestling Awards at TrophyCentral. We have a great selection of Wrestling and other recognition trophies at discounted prices.tr9923Wrestling, Sportscustom-pagetrophies-wrestling1trophies498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Wrestling insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-Wrestling-Insertcustom-pagetrophies-wrestling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%"Wrestling Trophies" "Trophies, Wrestling" "Wrestling Trophy"Find this fabulous two-tier Wrestling Trophy discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtwrestttWrestling, Sportscustom-pagetrophies-wrestling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.215Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%"Wrestling Trophies" "Trophies, Wrestling" "Wrestling Trophy"See this championship trophy with a Wrestling figure at TrophyCentral. Be sure to see all of our Wrestling figure awards.qtwrestttwWrestling, Sportscustom-pagetrophies-wrestling1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Wrestling single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - WrestlingWrestling, Sportscustom-pagetrophies-wrestling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:19%,50:28%,100:35%"Wrestling Trophies" "Trophies, Wrestling" "Wrestling Trophy"This popular Wrestling Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtwrestscSee more individual and teamin a variety of styles.trophies-wrestlingWrestling, Sportscustom-pagetrophies-wrestling1trophies498551-311821.06TrophyCentraltrophies1Wrestling, Sportscustom-pagecustommedals50"Standard Service: 8 Business Days from Receipt of Artwork, Rush Service (Extra Charge): 3 Business Days from Receipt of Artwork" "Oxnard, CA" "UPS (FedEx available on request)"medals930335-1010.630033.6Simba Calaward-medalsSports, Hobby, Org, Livestock1:22%,300:40%,500:51%,1000:54%"Wrestling Awards" "Wrestling Medals"These 2 1/2 inch custom Wrestling Medals come with an outer-ring which allows you to add your school or league name, date and location.qcm-53Wrestling, Sportscustom-pagetrophies-wrestling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451623.65Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%"Wrestling Trophies" "Trophies, Wrestling" "Wrestling Trophy"Find This Popular Wrestling Deluxe Platform Series Trophy Discounted at TrophyCentral. Real Marble Base; Free Personalization!qtwrestdmWrestling, Sportscustom-pagetrophies-wrestling1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Wrestling figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-wrest-scbWrestling, Sportscustom-pagetrophies-wrestling1trophies498551-310.71217.38trophies1Wrestling, Sportscustom-pagetrophies-wrestling1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Wrestling Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Wrestling, Sportscustom-pagetrophies-wrestling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%"Wrestling Trophies" "Trophies, Wrestling" "Wrestling Trophy"Find these fabulous two-tier, 3-column champion Wrestling Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtwrest3cWrestling, Sportscustom-pagetrophies-wrestling1medals498552-30.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Colorful Wrestling insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Wrestling, Sportscustom-pagetrophies-wrestling1medals498552-40.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find this Wrestling insert medal With A Personalized Front Rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Wrestling, Sportscustom-pagecherry-insert-plaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these wrestling insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Wrestling, Sportscustom-pagetrophies-wrestlingwrestling-ei48962350740549819150729650264111"Wrestling Medals"See these Wrestling Inserts at TrophyCentral; Each insert measures 2".1custom-pagetrophies-wrestling1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our wrestling insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - WrestlingWrestling, Sportscustom-pagetrophies-wrestling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%,25:23%,50:29%,100:34%"Wrestling Trophies" "Trophies, Wrestling" "Wrestling Trophy"Our popular Wrestling Participation Trophies feature a real slant-front white marble base and free personalization. Significant quantity discounts available.trophies-wrestlingWrestling, Sportscustom-pagetrophies-wrestling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.4234Quick TrophyTrophies1:14%,3:15%,10:16%"Wrestling Awards" "Wrestling Trophies"Find this Perpetual Wrestling Trophy Discounted at TrophyCentral. Each Trophy has enough room for 32 names. Ships in just 1-2 days.qtwresperpSee our complete section of in a variety of styles and sizes.trophies-wrestlingWrestling, Sportscustom-pagekeychains21105502-40.39125035.39Classic MedallicsGiftsKeychains1:22%,10:25%,25:32%,50:39%,100:47%"Wrestling Awards"Find these popular Pewter Wrestling Key Chains at TrophyCentral; discounted prices!pk73-cmKeychainscustom-pageblog-trophycentral11Wrestlers deserve recognition too. This guide provides 20 award categories that celebrate complete wrestlers - technique, toughness, and the character that wrestling builds. custom-pagetrophies-wrestling1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Wrestling Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Wrestling, Sportscustom-pageachievement-certificates-awards1"Download Only"certificates4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Writing template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Writing-Certificatewriting-freeWriting, Academiccustom-pageawardcertificates11certificates290631-31 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,25:25%,100:36%,500:51%Find this writing certificate discounted at TrophyCentral. Writing certificates are beautifully printed and measure 11 x 8 1/2 inches.964Writing, Academiccustom-pageletter-shaped-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find these popular X-shaped custom mascot badges at TrophyCentral. Great for fundraising! TrophyCentral is a top-rated Yahoo merchant.letterbadges-xcustom-pageofficesigns11240166-810.55183.25Roanoke1Find thi XpeDate Custom Stamp discounted at TrophyCentral.custom-pageofficesigns11240166-810.55183.25Roanoke1Xstamper Custom Round Stamps from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.custom-pageofficesigns11240166-810.5183.2Roanoke1Find this Xstamper Custom Rubber Stamps at TrophyCentral. Also see our great selection of engraved and personalized gifts!11XSURGO Home Page from TrophyCentral.1custom-pageletter-shaped-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find these popular Y-shaped custom mascot badges at TrophyCentral. Great for fundraising! TrophyCentral is a top-rated Yahoo merchant.letterbadges-y111custom-pageofficesigns11"2-3 business days" "Roanoke, Virginia" "UPS (FedEx available on request)"240162-310.451222.05RoanokeOffice Signs1Find these Custom Yard Signs (For Outdoor Use) Discounted at TrophyCentral.1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)""PT1=Trophies" "PC12=498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find Year Trim Indicator Trophies Discounted At TrophyCentral. Each Year Trim Subject Trophy Includes Free Personalization. Fast 1-2 Day Shipping!1custom-pageschool-pinsplastic-pinbox-t5498551-30.550040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Shop yearbook lapel pins for editors, staff members and student recognition. Great for schools, journalism programs and yearbook clubs with fast shipping and custom engraving options.6072024Yearbook, Academiccustom-pagelapel-award-pinsservicepinsservicepins2servicepins3opmxhp21br345service-anniversary-plaqueopm100rt5-year-pb10-year-pb15-year-pb20-year-pb25-year-pb1corporatepins1"Award for Business" "Awards for Business"Find years of service pins in a variety of sizes and styles at TrophyCentral. Each pin is available in 5 year increments and is perfect for an employee service anniversary. Fast 1-2 day shipping.

    Years of Service Pins - Recognize Employee Loyalty at Every Milestone

    Years of service pins are one of the most enduring forms of employee recognition, combining the personal nature of a wearable award with the symbolic weight of a milestone acknowledgment that reinforces loyalty, tenure, and organizational belonging. Available in 5-year increments starting with the 5-year service pin and continuing through 10, 15, 20, and 25 years and beyond, each pin clearly displays the milestone year so recipients and colleagues alike can see at a glance the depth of commitment being honored. The clutch back attachment makes service pins easy to wear on suit lapels, uniform jackets, lanyards, and name badge holders, keeping the recognition visible in everyday professional settings rather than stored in a drawer. Volume pricing makes it practical for HR departments and recognition coordinators to order across multiple milestone levels at once, ensuring every eligible employee at every service anniversary receives acknowledgment at the same time during annual recognition programs or companywide ceremonies.

    Frequently Asked Questions About Years of Service Pins

    What milestone increments are years of service pins available in?

    Service pins are available in 5-year increments beginning with the 5-year pin and continuing through 10, 15, 20, and 25 years, with options for longer tenure milestones as well. The 5-year increment is the most widely used recognition interval in corporate and nonprofit programs because it balances meaningful acknowledgment with manageable program costs, honoring employees at regular intervals without requiring annual pin purchases for every employee. Some organizations supplement the standard 5-year intervals with 1-year or 3-year pins for newer employees, particularly in industries with high turnover where early-tenure recognition matters for retention. The 10-year and 25-year milestones tend to receive the most ceremonial attention within recognition programs, often paired with a more substantial award such as a plaque or gift alongside the pin to reflect the significance of a decade or quarter-century of service.

    How should years of service pins be presented to employees?

    The presentation moment matters as much as the pin itself when it comes to making service recognition meaningful. Presenting service pins publicly, whether at a companywide meeting, a department gathering, or an annual recognition dinner, signals to the entire organization that tenure is valued and creates a shared acknowledgment of the employee's contribution. A brief personal statement from a direct manager or senior leader about the employee's specific impact during their years of service elevates the moment well beyond a generic handshake and pin exchange. For employees who prefer lower-profile recognition or work remotely, a thoughtful written note accompanying the pin delivered to their home or desk provides the personal touch without requiring a public ceremony. Pairing the pin with a certificate, a personalized card, or a modest gift appropriate to the milestone level adds weight to the recognition without significantly increasing program costs. The most effective service recognition programs treat each milestone as a genuine organizational moment rather than an administrative checkbox, and the pin serves as a lasting wearable symbol of that moment.

    Should years of service pins be the only recognition at milestone anniversaries?

    Service pins work best as part of a layered recognition approach rather than as a standalone award, particularly for longer milestones where the depth of contribution warrants more than a small wearable item. For 5-year and 10-year anniversaries, a service pin paired with a personalized certificate and a public acknowledgment covers most programs well and keeps costs manageable across a large employee base. For 15-year and 20-year milestones, adding a desk plaque, an engraved gift, or a more substantial award alongside the pin reflects the increasing significance of the tenure being recognized. The 25-year milestone and beyond represent exceptional loyalty that most organizations treat as a major recognition event, often pairing a premium pin with a custom plaque, a gift selection program, or a formal presentation at a leadership-attended event. The pin itself serves a specific purpose in this layered structure: it is the wearable, everyday symbol that the employee carries forward after the ceremony, making it a complement to larger awards rather than a substitute for them. Browse our leadership and corporate pins and corporate awards for additional recognition options that pair well with service pin programs.

    If you need more information before deciding, see our expert resource section:
    ]]>
    corporatepins
    custom-pagebadgeribbonsholders1"7-10 business days from receipt of camera-ready artwork" "City of Industry, CA" "UPS (FedEx available on request)"917457-10146022.6BNRibbonsBadge Holders1Find these yellow neck wallets discounted at TrophyCentral. Price includes a free one-color imprint!nw-3633yelcustom-pagecoaching-teaching-guides11Complete baseball coaching resource covering coach-pitch through tournament play. Features hitting, fielding, and base running drills plus motivational award strategies.custom-pagecoaching-teaching-guides11Complete youth basketball coaching resource with age-specific drills, game strategies, and motivational award systems. Transform your team with proven practice plans for ages 5-14.unused-products11"Quick-Ship Item!: 1-2 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"105502-31313030Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,200:44%Youth Trophy - Basketball. Ideal for leagues, schools, and tournaments. Fast shipping.trophies-basketballSee alltrophies-basketballBasketball, Sports11Recognition strategies that genuinely motivate kids ages 5-18. Combine specific praise with strategic awards to build growth mindset and confidence. Free certificates included.custom-pagecoaching-teaching-guides11Everything first-time soccer coaches need: age-appropriate drills, formation basics, and team building strategies. Includes free award certificates and recognition ideas.11Recognition ideas for spring youth soccer leagues covering MVP, Golden Boot, goalkeeper, sportsmanship, and participation. Budget breakdown for 20-player rosters and practical ceremony tips for coaches.custom-pagesports-resource-hub11Essential guide for youth sports parents covering age-appropriate awards, budget planning, recognition strategies, and seasonal sports calendars for successful young athlete development.custom-pageletter-shaped-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find these popular Z-shaped custom mascot badges at TrophyCentral. Great for fundraising! TrophyCentral is a top-rated Yahoo merchant.letterbadges-zcustom-pagegeneral-corporate-awards1"14 business days" "Erlanger, KY" "UPS"general410187-1010.451 2 3 4 5 6 7 8 9432.45JcharlesGeneral Awards1:22%,25:25%See this Zephyr Award at TrophyCentral. Also see our great selection of engraved and personalized gifts!Return to ourcategory for other fabulous choices.general-corporate-awards06-02-2014custom-pagecrystalgifts1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"general410187-1010.45420.45JcharlesCrystal AwardsClocks1:22%,100:23%"crystal awards"Zilo Desk Clock from TrophyCentral. See our great selection of engraved and personalized gifts!test12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
    498555-8.521