custom-pagepersonalizedleather-leathergifts1"4 to 7 business days w/initials or name, 10 to 14 w/logo , 3 to 5 for stock items, (rush service available – please call)" "Teaneck, NJ" "UPS (FedEx available on request)"498554-710.451611.65JDS IndustriesGiftsLeather Gifts1"Executive Gifts"Find this personalized gift clock discounted at TrophyCentral. Features choice of color and free custom engraving for a special touch!custom-pagecertificate-diploma-covers11diploma covers498553-611The leatherette diploma covers are perfect when you only need a small quantity. Includes text imprint. Optional logo available.custom-pagegroomsmengifts1"4-7 w/initials or name, 10-14 w/logo , 3-5 business days for stock items, (rush service available for additional charge - please call)" "Secaucus, NJ" "UPS (FedEx available on request)"personalized gifts498554-710.45510.45JDS IndustriesGiftsLeather Gifts1Find this Flask Gift Set discounted at TrophyCentral. Features 1 flask, 2 shot glasses and 1 funnel.Groomsmencustom-pagepersonalizedleather-leathergifts1"4-7 w/initials or name, 10-14 w/logo , 3-5 business days for stock items, (rush service available for additional charge - please call)" "Secaucus, NJ" "UPS (FedEx available on request)"498554-710.453610.53JDS IndustriesGiftsLeather Gifts1"Leather Gifts" "Executive Gifts"Find this flexible leatherette business card holder discounted at TrophyCentral. Features choice of color and free custom engraving!custom-pagepersonalizedleather-leathergifts1"4-7 w/initials or name, 10-14 w/logo , 3-5 business days for stock items, (rush service available for additional charge - please call)" "Secaucus, NJ" "UPS (FedEx available on request)"498554-710.453610.53JDS IndustriesGiftsLeather Gifts1Find this Personalized Business Card Case discounted at TrophyCentral. Features choice of color and free custom engraving for a special touch!custom-pagepersonalizedleather-leathergifts1"4-7 w/initials or name, 10-14 w/logo , 3-5 business days for stock items, (rush service available for additional charge - please call)" "Secaucus, NJ" "UPS (FedEx available on request)"498554-710.453623.85JDS IndustriesGiftsLeather Gifts1"Leather Gifts"Find this personalized money clip discounted at TrophyCentral. Features choice of color and free personalization!Leather Walletscustom-pagegifts-bridesmaid1"4-7 w/initials or name, 10-14 w/logo , 3-5 business days for stock items, (rush service available for additional charge - please call)" "Secaucus, NJ" "UPS (FedEx available on request)"personalized gifts498554-710.451611.65JDS IndustriesGiftsLeather Gifts1"Leather Gifts" "Executive Gifts"Find these zippered portfolios discounted at TrophyCentral. Each portfolio features choice of color and can be laser engraved for a personal touch!custom-pagepersonalizedleather-leathergifts1"4-7 w/initials or name, 10-14 w/logo , 3-5 business days for stock items, (rush service available for additional charge - please call)" "Secaucus, NJ" "UPS (FedEx available on request)"498554-710.451611.65JDS IndustriesGiftsLeather Gifts1"Leather Gifts" "Executive Gifts" "Leather Portfolio Cases" "Portfolio Cases" "Leather Portfolio Case"Leatherette Round Coaster Set with Metallic Edgingcustom-pagepersonalizedleather-leathergifts1"4-7 w/initials or name, 10-14 w/logo , 3-5 business days for stock items, (rush service available for additional charge - please call)" "Secaucus, NJ" "UPS (FedEx available on request)"498554-710.451611.65JDS IndustriesGiftsLeather Gifts1"Leather Gifts" "Leather Portfolio Cases" "Portfolio Cases" "Leather Portfolio Case"Leatherette Square Coaster Set with Metallic Edge .custom-pagewall-mounted-legacy145123128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell legacy bulletin board wall case w/ cork back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 36"H x 48"W x 4"D.1Wall-Mountedcustom-pagewall-mounted-legacy145123128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell legacy bulletin board wall case w/ cork back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 36"H x 60"W x 4"D.1Wall-Mountedcustom-pagewall-mounted-legacy145123128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell legacy bulletin board wall case w/ cork back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 36"H x 72"W x 4"D.1Wall-Mountedcustom-pagewall-mounted-legacy145123128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell legacy bulletin board wall case w/ cork back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 48"H x 48"W x 4"D.1Wall-Mountedcustom-pagewall-mounted-legacy145123128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell legacy bulletin board wall case w/ cork back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 48"H x 60"W x 4"D.1Wall-Mountedcustom-pagewall-mounted-legacy145123128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell legacy bulletin board wall case w/ cork back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 48"H x 72"W x 4"D.1Wall-Mountedcustom-pagewall-mounted-legacy145123128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell legacy bulletin board wall case w/ lighted header discounted at TrophyCentral. This high quality display is made in the US. Measures: 42"H x 50"W x 4"D . Model: 885-hb-ck.1Wall-Mountedcustom-pagewall-mounted-legacy145123128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell legacy bulletin board wall case w/ lighted header discounted at TrophyCentral. This high quality display is made in the US. Measures: 42"H x 50"W x 4"D . Model: 885-hb-pb.1Wall-Mountedcustom-pagewall-mounted-legacy145123128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell legacy bulletin board wall case w/ plaque fabric back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 36"H x 48"W x 4"D.1Wall-Mountedcustom-pagewall-mounted-legacy145123128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell legacy bulletin board wall case w/ plaque fabric back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 36"H x 60"W x 4"D.1Wall-Mountedcustom-pagewall-mounted-legacy145123128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell legacy bulletin board wall case w/ plaque fabric back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 36"H x 72"W x 4"D.1Wall-Mountedcustom-pagewall-mounted-legacy145123128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell legacy bulletin board wall case w/ plaque fabric back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 48"H x 48"W x 4"D.1Wall-Mountedcustom-pagewall-mounted-legacy145123128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell legacy bulletin board wall case w/ plaque fabric back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 48"H x 60"W x 4"D.1Wall-Mountedcustom-pagewall-mounted-legacy145123128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell legacy bulletin board wall case w/ plaque fabric back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 48"H x 72"W x 4"D.1Wall-Mountedcustom-pagewalmouncas885-hb-ck88-3648ck-gd88-3660ck-gd88-3672ck-gd88-4848ck-gd88-4860ck-gd88-4872ck-gd885-hb-pb88-3648pb-gd88-3660pb-gd88-3672pb-gd88-4848pb-gd88-4860pb-gd88-4872pb-gd11floor-standing-keepsake wall-mounted-championcustom-pageenclosed-bulletin-boards1Bulletin Boards4512310-171 3 5 6 7 8 9 10 22 2311Bulletin Boards11Find the Ghent Letter Board Letters and Numbers, Gothic Font, 3/4", White discounted at TrophyCentral.custom-pagelapel-award-pins1"1-2 business days" "Topeka, IN"lapel pins465711-21 260.48036.4Tower Ribbonlapel-award-pinsAcademic1:22%,40:58%Find a great selection of letter pins at TrophyCentral. Each letter pin features a gold finish and clutch back to be worn on a jacket.custom-pageribbons1letterbadges-aletterbadges-bletterbadges-cletterbadges-dletterbadges-eletterbadges-fletterbadges-gletterbadges-hletterbadges-iletterbadges-jletterbadges-kletterbadges-lletterbadges-mletterbadges-nletterbadges-oletterbadges-pletterbadges-rletterbadges-sletterbadges-tletterbadges-uletterbadges-vletterbadges-wletterbadges-xletterbadges-yletterbadges-z11trophies-mascot mascot-medals mascot-badgescustom-pageenclosed-bulletin-boards1Bulletin Boards4512310-171 3 5 6 7 8 9 10 22 2311Bulletin Boards11Find the Ghent Letter Board Letter Storage Box discounted at TrophyCentral.custom-pageeagle-trophies1"10 business days" "Aliquippa, PA" "UPS"trophies1500110-1410.45824.45Glass AmericaCrystal Awards1:22%,10:25%Liberty Eagle from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.custom-pageenclosed-bulletin-boardscpa13624kcpa23648kcpa23660kcpa33672kcpa34896k111custom-pagebadgeribbonsholders1"7-10 business days from receipt of camera-ready artwork" "City of Industry, CA" "UPS (FedEx available on request)"917457-10146022BNRibbonsBadge Holders1nw-3613lmgrcustom-pagemascotpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:36%,100:46%,500:52%"Mascot Awards"Find These Lion Lapel Pins with Antique Finish Discounted at TrophyCentral! Also See Our Other Fabulous School Mascot Pins. Fast 1-2 Day Shipping!pm1905-15-2013Mascotcustom-pagemascot-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Lion Mascot Discounted At TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.mascotbadges-lioncustom-pagemascot-plaques1plaques498552-41JDSPlaques1Find this lion plaque discounted at TrophyCentral. Our lion mascot plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Mascotcustom-pagemascottrophies1"4-6 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511016.25Classic MedallicsTrophiesAcademic1:22%,5:24%,10:28%,50:32%"Mascot Awards"Find Lion Trophies Discounted at TrophyCentral. Each Lion Mascot Trophy Includes Engraving. Fast Shipping!mt20014-15-18Mascotcustom-pagemascotinserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsMascots1Buy these quality Lions Mascot Medal Inserts at TrophyCentral. Each Lions Insert can be used to create a unique plaque, medal or trophy.489925Mascot
custom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these quality Literature Inserts (Litho) at TrophyCentral. Each Literature Insert can be used to create a unique plaque, medal or trophy.504421Reading
custom-pagetrophies-baseball12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-31130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Baseball (Male) Litho Medal Insert. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.507192Baseball / T-Ball, Sports
custom-pagetrophies-baseball12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-31130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Baseball Batter (502811) Litho Medal Insert. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.502811Baseball / T-Ball, Sports
custom-pagetrophies-baseball12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-31130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Baseball Batter (507584) Litho Medal Insert. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.507523Baseball / T-Ball, Sports
custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these high-quality Little League Inserts at TrophyCentral. Each Little League Insert can be used to create a unique plaque, medal or trophy.50153Baseball / T-Ball, Sports
custom-pagetrophiesquickshiptrophies-bullquickshiptrophies-chickenquickshiptrophies-cowquickshiptrophies-goatquickshiptrophies-pigquickshiptrophies-rabbitquickshiptrophies-sheepquickshiptrophies-steer1trophies1Find livestock trophies and animal trophies discounted at TrophyCentral. Each farm animal and livestock trophy includes free engraving. Custom Farm & Livestock Trophies TrophyCentral has a great selection of livestock awards and animal trophies to meet all of your needs. Also be sure to see our Farm Tractor Trophies featuring a choice of column color and size, and our Sheep Trophies - perfect for your next county fair or event. We have a large number of farm animal and livestock figures, including cows, steers, chickens and many more. Each livestock award includes up to three lines of FREE ENGRAVING (larger awards include additional lines).]]>quickshiptrophies-tractor county-fair-awardscustom-pagedo-not-erase112906314-2111 2 3 4 5 6 7 8 9Certificate SourceDiploma Covers1:0%Personalized with Gold Stamp: Logo Proof from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.1custom-pageribbons11muimse1100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Texas" "UPS (FedEx available on request)"7745310-1410.45214.85PepcoPromotional ProductsSpirit1Buy these Custom Logo Megaphones and other Cheerleader Spirit Awards at TrophyCentral.Spirit11Find our Logo Series plaques discounted at TrophyCentral. Each plaque features a beautiful stock logo and free text engraving.custom-pagedo-not-erase112906314-2111 2 3 4 5 6 7 8 9Certificate Source1:0%1custom-pageflower-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"Find red rose pins discounted at TrophyCentral. Each red rose lapel pin features a clutch-pin back. Fast 1-2 day shipping on all flower pins.br277Generalcustom-pageflower-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"br388Generalcustom-pagemascotinserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsMascots1Buy these quality Longhorns Mascot Medal Inserts at TrophyCentral. Each Longhorns Insert can be used to create a unique plaque, medal or trophy.489941Mascot
custom-pagetrophies-basketball1trophies-funny-horses-rearplaques498552-41JDSPlaques1Find this loser plaque discounted at TrophyCentral. Our loser plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Losercustom-pagecrystalcups1"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"4582215138.6Vision AwardsTrophies11:22%,26:32%"New Products"Lunar Tides Vase from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.custom-pageletter-shaped-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find these popular M-shaped custom mascot badges at TrophyCentral. Great for fundraising! TrophyCentral is a top-rated Yahoo merchant.letterbadges-mcustom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality M.P. Regimental Crest Inserts at TrophyCentral. Each M.P. Regimental Crest Insert can be used to create a unique plaque, medal or trophy.517293Military, Hero
custom-pagecrystalcups1"12-15 business days w/engraving" "Celina,OH" "UPS (FedEx available on request)"458227-1010.45624.45VisionsTrophies1 "General Recognition Awards"Find This Spectacular Magma Bowl Award Discounted At TrophyCentral! Price Includes Etched Logo!custom-pageghent-new-whiteboardsdfmbk34dfmch34dfmgy34dfmlm34dfmmh34dfmnv34dfmrd34dfmry34dfmbk44dfmch44dfmgy44dfmlm44dfmmh44dfmnv44dfmrd44dfmry44dfmbk46dfmch46dfmgy46dfmlm46dfmmh46dfmnv46dfmrd46dfmry46dfmbk48dfmch48dfmgy48dfmlm48dfmmh48dfmnv48dfmrd48dfmry48dfmbk410dfmch410dfmgy410dfmlm410dfmmh410dfmnv410dfmrd410dfmry410dfmbk412dfmch412dfmgy412dfmlm412dfmmh412dfmnv412dfmrd412dfmry412m1-23-1m1w-23-1m1-34-1m1w-34-1m1-44-4m1w-44-4m1-45-4m1-46-4a2m46m1w-45-4m1w-46-4a2m46-mm1-48-4m1w-48-4a2m48a2m48-ma2m410m1-410-4m1w-410-4a2m410-mm1-412-4m1w-412-4m4-23-1m4-34-1m4-44-4m4-45-4m4-46-4m4-48-4imm23wchimm23wespimm23wmpimm23wwnimm34wchimm34wespimm34wmpimm34wwnimm44wchimm44wespimm44wmpimm44wwnimm45wchimm45wespimm45wmpimm45wwnimm46wchimm46wespimm46wmpimm46wwnimm48wchimm48wespimm48wmpimm48wwnprm1-34-4prm1-44-4prm1-46-4prm1-48-4nex146wmbnex134wmbm1-416-4a2m412a2m412-ma2m416-mm1-35-4a2m41611Find magnetic dry erase boards discounted at TrophyCentral. Each magnetic dry erase board is made of quality porcelain. Start browsing our large selection now!1

Shop at Ease with TrophyCentral

If you are looking to buy online for your office or school classroom, you have come to the right place. We have a huge selection to meet your needs, all at discounted prices. Yes, we sell online, but we have real people who would love to help you! Whether you have a question about a product or are ready to order, feel free to call us toll-free at 1-888-809-8800.
]]>
custom-pagemagnetic-dry-erase-boards14512310-171 3 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Magnetic Hygienic Porcelain Whiteboard with Aluminum Frame, 2'H x 3'W discounted at TrophyCentral.1Not Enclosedcustom-pagemagnetic-dry-erase-boards145123110-171 3 4 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Magnetic Hygienic Porcelain Whiteboard with Aluminum Frame, 3'H x 4'W discounted at TrophyCentral.1Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 2301Bulletin Boards11Find the Ghent Magnetic Hygienic Porcelain Whiteboard with Aluminum Frame, 4'H x 4'W discounted at TrophyCentral.1Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Hygienic Porcelain Whiteboard with Aluminum Frame, 4'H x 5'W discounted at TrophyCentral.1m1w-45-4Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Hygienic Porcelain Whiteboard with Aluminum Frame, 4'H x 6'W discounted at TrophyCentral.1m4-46-4Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Hygienic Porcelain Whiteboard with Aluminum Frame, 4'H x 8'W discounted at TrophyCentral.1m4-48-4Not Enclosedcustom-pageperplaq1"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"perpetual plaques458221510.45214.15Vision AwardsPlaquesPerpetual Plaques1:22%, 26:33%Find the Perpetual Fascination Plaque discounted at TrophyCentral. Never settle for boring again! Etched metal plates can be added as needed (magnetically attached).See other greatin a variety of styles.perplaqcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard Cabinet with Cork Interior Doors, 4'H x 4'W, Mahogany discounted at TrophyCentral.1Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Aluminum Box Tray and 1" Maprail, 4'H x 10'W discounted at TrophyCentral.1Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Aluminum Box Tray and 1" Maprail, 4'H x 12'W discounted at TrophyCentral.1Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Aluminum Box Tray and 1" Maprail, 4'H x 16'W discounted at TrophyCentral.1Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Aluminum Box Tray and 1" Maprail, 4'H x 6'W discounted at TrophyCentral.1Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Aluminum Box Tray and 1" Maprail, 4'H x 8'W discounted at TrophyCentral.1Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Aluminum Frame and Box Tray, 4'H x 10'W discounted at TrophyCentral.1Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Aluminum Frame and Box Tray, 4'H x 12'W discounted at TrophyCentral.1Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Aluminum Frame and Box Tray, 4'H x 16'W discounted at TrophyCentral.1Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Aluminum Frame and Box Tray, 4'H x 6'W discounted at TrophyCentral.1Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Aluminum Frame and Box Tray, 4'H x 8'W discounted at TrophyCentral.1m4-48-4Not Enclosedcustom-pagemagnetic-dry-erase-boards14512310-171 3 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Aluminum Frame, 2'H x 3'W discounted at TrophyCentral.1Not Enclosedcustom-pagemagnetic-dry-erase-boards145123110-171 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Aluminum Frame, 3'H x 4'W discounted at TrophyCentral.1Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Aluminum Frame, 3'H x 5'W discounted at TrophyCentral.1Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Aluminum Frame, 4'H x 10'W discounted at TrophyCentral.1Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Aluminum Frame, 4'H x 12'W discounted at TrophyCentral.1Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Aluminum Frame, 4'H x 16'W discounted at TrophyCentral.1Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 2301Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Aluminum Frame, 4'H x 4'W discounted at TrophyCentral.1Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Aluminum Frame, 4'H x 5'W discounted at TrophyCentral.1Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Aluminum Frame, 4'H x 6'W discounted at TrophyCentral.1Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Aluminum Frame, 4'H x 8'W discounted at TrophyCentral.1Not Enclosedcustom-pagemagnetic-dry-erase-boards145123110-171 3 4 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with DecoAurora Aluminum Frame, 3'H x 4'W, Black discounted at TrophyCentral.1Not Enclosedcustom-pagemagnetic-dry-erase-boards145123110-171 3 4 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with DecoAurora Aluminum Frame, 3'H x 4'W, Cherry discounted at TrophyCentral.1dfmlm34Not Enclosedcustom-pagemagnetic-dry-erase-boards145123110-171 3 4 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with DecoAurora Aluminum Frame, 3'H x 4'W, Gray discounted at TrophyCentral.1dfmlm34Not Enclosedcustom-pagemagnetic-dry-erase-boards145123110-171 3 4 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with DecoAurora Aluminum Frame, 3'H x 4'W, Light Maple discounted at TrophyCentral.1dfmlm34Not Enclosedcustom-pagemagnetic-dry-erase-boards145123110-171 3 4 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with DecoAurora Aluminum Frame, 3'H x 4'W, Mahogany discounted at TrophyCentral.1dfmry34Not Enclosedcustom-pagemagnetic-dry-erase-boards145123110-171 3 4 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with DecoAurora Aluminum Frame, 3'H x 4'W, Navy Blue discounted at TrophyCentral.1dfmry34Not Enclosedcustom-pagemagnetic-dry-erase-boards145123110-171 3 4 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with DecoAurora Aluminum Frame, 3'H x 4'W, Red discounted at TrophyCentral.1dfmry34Not Enclosedcustom-pagemagnetic-dry-erase-boards145123110-171 3 4 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with DecoAurora Aluminum Frame, 3'H x 4'W, Royal Blue discounted at TrophyCentral.1dfmry34Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with DecoAurora Aluminum Frame, 4'H x 10'W, Black discounted at TrophyCentral.1dfmry410Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with DecoAurora Aluminum Frame, 4'H x 10'W, Cherry discounted at TrophyCentral.1dfmry410Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with DecoAurora Aluminum Frame, 4'H x 10'W, Gray discounted at TrophyCentral.1dfmry410Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with DecoAurora Aluminum Frame, 4'H x 10'W, Light Maple discounted at TrophyCentral.1dfmry410Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with DecoAurora Aluminum Frame, 4'H x 10'W, Mahogany discounted at TrophyCentral.1dfmry410Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with DecoAurora Aluminum Frame, 4'H x 10'W, Navy Blue discounted at TrophyCentral.1dfmry410Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with DecoAurora Aluminum Frame, 4'H x 10'W, Red discounted at TrophyCentral.1dfmry410Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with DecoAurora Aluminum Frame, 4'H x 10'W, Royal Blue discounted at TrophyCentral.1dfmry410Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with DecoAurora Aluminum Frame, 4'H x 12'W, Black discounted at TrophyCentral.1dfmlm412Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with DecoAurora Aluminum Frame, 4'H x 12'W, Cherry discounted at TrophyCentral.1dfmlm412Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with DecoAurora Aluminum Frame, 4'H x 12'W, Gray discounted at TrophyCentral.1dfmlm412Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with DecoAurora Aluminum Frame, 4'H x 12'W, Light Maple discounted at TrophyCentral.1dfmlm412Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with DecoAurora Aluminum Frame, 4'H x 12'W, Mahogany discounted at TrophyCentral.1dfmnv412Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with DecoAurora Aluminum Frame, 4'H x 12'W, Navy Blue discounted at TrophyCentral.1dfmnv412Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with DecoAurora Aluminum Frame, 4'H x 12'W, Red discounted at TrophyCentral.1dfmnv412Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with DecoAurora Aluminum Frame, 4'H x 12'W, Royal Blue discounted at TrophyCentral.1dfmnv412Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 2301Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with DecoAurora Aluminum Frame, 4'H x 4'W, Black discounted at TrophyCentral.1m4-46-4Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 2301Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with DecoAurora Aluminum Frame, 4'H x 4'W, Cherry discounted at TrophyCentral.1dfmgy44Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 2301Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with DecoAurora Aluminum Frame, 4'H x 4'W, Gray discounted at TrophyCentral.1dfmgy44Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 2301Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with DecoAurora Aluminum Frame, 4'H x 4'W, Light Maple discounted at TrophyCentral.1Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 2301Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with DecoAurora Aluminum Frame, 4'H x 4'W, Mahogany discounted at TrophyCentral.1dfmnv44Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 2301Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with DecoAurora Aluminum Frame, 4'H x 4'W, Navy Blue discounted at TrophyCentral.1dfmnv44Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 2301Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with DecoAurora Aluminum Frame, 4'H x 4'W, Red discounted at TrophyCentral.1dfmry44Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 2301Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with DecoAurora Aluminum Frame, 4'H x 4'W, Royal Blue discounted at TrophyCentral.1dfmry44Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with DecoAurora Aluminum Frame, 4'H x 6'W, Black discounted at TrophyCentral.1Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with DecoAurora Aluminum Frame, 4'H x 6'W, Cherry discounted at TrophyCentral.1dfmnv46Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with DecoAurora Aluminum Frame, 4'H x 6'W, Gray discounted at TrophyCentral.1dfmnv46Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with DecoAurora Aluminum Frame, 4'H x 6'W, Light Maple discounted at TrophyCentral.1dfmnv46Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with DecoAurora Aluminum Frame, 4'H x 6'W, Mahogany discounted at TrophyCentral.1dfmnv46Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with DecoAurora Aluminum Frame, 4'H x 6'W, Navy Blue discounted at TrophyCentral.1dfmnv46Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with DecoAurora Aluminum Frame, 4'H x 6'W, Red discounted at TrophyCentral.1dfmry46Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with DecoAurora Aluminum Frame, 4'H x 6'W, Royal Blue discounted at TrophyCentral.1dfmry46Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with DecoAurora Aluminum Frame, 4'H x 8'W, Black discounted at TrophyCentral.1Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with DecoAurora Aluminum Frame, 4'H x 8'W, Cherry discounted at TrophyCentral.1dfmgy48Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with DecoAurora Aluminum Frame, 4'H x 8'W, Gray discounted at TrophyCentral.1dfmgy48Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with DecoAurora Aluminum Frame, 4'H x 8'W, Light Maple discounted at TrophyCentral.1dfmmh48Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with DecoAurora Aluminum Frame, 4'H x 8'W, Mahogany discounted at TrophyCentral.1dfmmh48Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with DecoAurora Aluminum Frame, 4'H x 8'W, Navy Blue discounted at TrophyCentral.1Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with DecoAurora Aluminum Frame, 4'H x 8'W, Red discounted at TrophyCentral.1dfmry48Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with DecoAurora Aluminum Frame, 4'H x 8'W, Royal Blue discounted at TrophyCentral.1dfmry48Not Enclosedcustom-pagemagnetic-dry-erase-boards14512310-171 3 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Modern Cherry Impression Frame, 2'H x 3'W discounted at TrophyCentral.1imm23wchNot Enclosedcustom-pagemagnetic-dry-erase-boards145123110-171 3 4 5 6 7 8 9 10 22 2301Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Modern Cherry Impression Frame, 3'H x 4'W discounted at TrophyCentral.1imm34wespNot Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Modern Cherry Impression Frame, 4'H x 4'W discounted at TrophyCentral.1imm44wwnNot Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Modern Cherry Impression Frame, 4'H x 5'W discounted at TrophyCentral.1imm45wchNot Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Modern Cherry Impression Frame, 4'H x 6'W discounted at TrophyCentral.1imm46wwnNot Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Modern Cherry Impression Frame, 4'W x 8'W discounted at TrophyCentral.1imm48wwnNot Enclosedcustom-pagemagnetic-dry-erase-boards14512310-171 3 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Modern Espresso Impression Frame, 2'H x 3'W discounted at TrophyCentral.1imm23wchNot Enclosedcustom-pagemagnetic-dry-erase-boards145123110-171 3 4 5 6 7 8 9 10 22 2301Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Modern Espresso Impression Frame, 3'H x 4'W discounted at TrophyCentral.1imm34wespNot Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Modern Espresso Impression Frame, 4'H x 4'W discounted at TrophyCentral.1imm44wwnNot Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Modern Espresso Impression Frame, 4'H x 5'W discounted at TrophyCentral.1imm45wchNot Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Modern Espresso Impression Frame, 4'H x 6'W discounted at TrophyCentral.1imm46wwnNot Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Modern Espresso Impression Frame, 4'W x 8'W discounted at TrophyCentral.1imm48wwnNot Enclosedcustom-pagemagnetic-dry-erase-boards14512310-171 3 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Modern Maple Impression Frame, 2'H x 3'W discounted at TrophyCentral.1Not Enclosedcustom-pagemagnetic-dry-erase-boards145123110-171 3 4 5 6 7 8 9 10 22 2301Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Modern Maple Impression Frame, 3'H x 4'W discounted at TrophyCentral.1imm34wespNot Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Modern Maple Impression Frame, 4'H x 4'W discounted at TrophyCentral.1imm44wwnNot Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Modern Maple Impression Frame, 4'H x 5'W discounted at TrophyCentral.1imm45wchNot Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Modern Maple Impression Frame, 4'H x 6'W discounted at TrophyCentral.1imm46wwnNot Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Modern Maple Impression Frame, 4'W x 8'W discounted at TrophyCentral.1imm48wwnNot Enclosedcustom-pagemagnetic-dry-erase-boards14512310-171 3 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Modern Walnut Impression Frame, 2'H x 3'W discounted at TrophyCentral.1Not Enclosedcustom-pagemagnetic-dry-erase-boards145123110-171 3 4 5 6 7 8 9 10 22 2301Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Modern Walnut Impression Frame, 3'H x 4'W discounted at TrophyCentral.1Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Modern Walnut Impression Frame, 4'H x 4'W discounted at TrophyCentral.1imm44wwnNot Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Modern Walnut Impression Frame, 4'H x 5'W discounted at TrophyCentral.1imm45wchNot Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Modern Walnut Impression Frame, 4'H x 6'W discounted at TrophyCentral.1imm46wwnNot Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Modern Walnut Impression Frame, 4'W x 8'W discounted at TrophyCentral.1imm48wwnNot Enclosedcustom-pagemagnetic-dry-erase-boards14512310-171 3 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Wood Frame, 2'H x 3'W discounted at TrophyCentral.1Not Enclosedcustom-pagemagnetic-dry-erase-boards145123110-171 3 4 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Wood Frame, 3'H x 4'W discounted at TrophyCentral.1Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Wood Frame, 4'H x 10'W discounted at TrophyCentral.1hmyrn45frNot Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Wood Frame, 4'H x 12'W discounted at TrophyCentral.1Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 2301Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Wood Frame, 4'H x 4'W discounted at TrophyCentral.1Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Wood Frame, 4'H x 5'W discounted at TrophyCentral.1m1w-45-4Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Wood Frame, 4'H x 6'W discounted at TrophyCentral.1Not Enclosedcustom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Magnetic Porcelain Whiteboard with Wood Frame, 4'H x 8'W discounted at TrophyCentral.1Not Enclosedcustom-pageofficesigns11"2-3 business days" "Roanoke, Virginia" "UPS (FedEx available on request)"240162-310.45617.25RoanokeOffice Signs1Magnetic Signs from TrophyCentral. Also see our great selection of engraved and personalized gifts!custom-pagegifts-desk-general11"7-10 business days w/engraving" "Chicago, Illinois" "UPS (FedEx available on request)"personalized gifts606307-101 3 230.453632.85RS OwensGiftsDesk Sets1:22%,5:24%"Corporate Gifts" "Custom Gifts" "Unique Holiday Gifts" "Unique Personalized Gifts" "Unique Custom Gifts"Mahogany Finished Note / Pen Set from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.12-20-2020Engraved Giftscustom-page11Help TrophyCentral understand your email preferences. Use this form to let use know what email segment you prefer.1custom-pagetop-awards-by-category11Explore major sports championships around the world, including trophies, awards, and top athletes with the most championships.custom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock Bottles1:22%,100:28%,500:34%,1000:45%"Track Medals"These inexpensive 1 1/4 inch Dash (Male) Medals offer a high quality, but low price for those on a tight budget.e904207-12-2015
custom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock Bottles1:22%,100:28%,500:34%,1000:45%"Track Medals"These inexpensive 1 1/4 inch High Jump (Male) Medals offer a high quality, but low price for those on a tight budget.e9240
custom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock Bottles1:22%,100:28%,500:34%,1000:45%"Track Medals"These inexpensive 1 1/4 inch Hurdles (Male) Medals offer a high quality, but low price for those on a tight budget.e9076
custom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock Bottles1:22%,100:28%,500:34%,1000:45%"Track Medals"These inexpensive 1 1/4 inch Male Discus Medals offer a high quality, but low price for those on a tight budget.e265112-20-2020
custom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock Bottles1:22%,100:28%,500:34%,1000:45%"Track Medals"These inexpensive 1 1/4 inch Distance (Male) Medals offer a high quality, but low price for those on a tight budget.e910511-15-2011
custom-pagetrophies-gymnastics12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Gymnastics Awards" "Gymnastics Medals"Your athletes will love these colorful Mylar Men's Gymnastics Medals from TrophyCentral. Each Men's Gymnastics medal includes a neck ribbon!tm9981gGymnastics, Sports
custom-pagesports-inserts1105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Volleyball Male Inserts (Litho) at TrophyCentral. Each Volleyball Male Insert can be used to create a unique plaque, medal or trophy.503211Volleyball, Sportscustom-pagetrophies-soccer1trophies465713-410.45169.5Tower RibbonTrophies1Male Rock N Jox Soccer Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagetrophies-soccer1trophies465713-410.7169.14Tower RibbonTrophiesSports, Hobby, Org, Livestock1"Soccer Trophy" "Soccer Trophies" "Soccer Awards" "Soccer Medals and Trophies" "Soccer Trophies and Medals"Male Soccer Burst-Thru Series Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagesports-inserts1105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Male Soccer Litho Medal Insert - Style 1. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.502031Soccer, Sportscustom-pagesports-inserts1105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Male Soccer Litho Medal Insert - Style 2. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.507174Soccer, Sportscustom-pagetrophies-soccer1trophies105503-610.4511224.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1"Soccer Awards"Male Soccer Resin Trophy - Style 1. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sports1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)""PT1=Trophies" "PC12=105503-610.451 2 3 4 5 6 7 8 911224.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,6:24%,12:26%,24:29%,48:31%"Soccer Awards"Male Soccer Resin Trophy - Style 2. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.tr6098Soccer, Sportscustom-pagemedals-j-series12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
"PT1=Medals" "PC12=105503-60.515014Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,50:28%,100:34%,500:41%"Swimming Awards" "Award Medals - All Subjects" "Sports Medals" "Swimming Medals" "Swimming Ribbons"Find our Male Swimmers 2" Olympic-Style J-Series Medals at a super price point at TrophyCentral. Large quantity discounts available!j903612-20-2040
custom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these high-quality Male Track Inserts (505751) at TrophyCentral. Each Male Track Inserts (505751) can be used to create a unique plaque, medal or trophy.505751
custom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these high-quality Male Track Inserts (506201) at TrophyCentral. Each Male Track Inserts (506201) can be used to create a unique plaque, medal or trophy.506201
custom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,10:27%,100:36%"Track Medals" "Track Awards"These 1 1/2 Inch Track Runners w/Scroll, Male medals come in gold, silver and bronze finishes and are perfect for recognizing different place winners.ir37
custom-pagemedals-diamond-cut-edge12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,25:29%,100:38%"Wrestling Awards" "Wresling Medals"See Our Wrestling Medals With A Diamond-Cut Edge. Also See Our Other High-Quality Wrestling Awards At TrophyCentral!z9049Wrestling, Sports
custom-pagequickshiptrophies-fireman1"4-6 business days " "Mount Vernon, NY" "UPS"plaques105503-610.4511656.45Classic MedallicsPlaquesBlank Plaques1:22%"Hero Awards" "Fire Awards" "Fire Trophies" "Fire Department Awards" "Fire Department Trophies"Find the Maltese Cross Fireman Plaque at TrophyCentral. Fireman Plaque Measures 12" X 12".03-15-2011Firefighter11Teachers are responsible for creating a conducive learning environment for students. Effective classroom management is integral to achieving that goal.classroom-managementcustom-pageacademic-resource-hub11Effective classroom management is integral to achieving positive student behaviors. Teachers who learn classroom management strategies see positive results.custom-pagepersonalizedleather-leathergifts1"4 to 7 business days w/initials or name, 10 to 14 w/logo , 3 to 5 for stock items, (rush service available – please call)" "Teaneck, NJ" "UPS (FedEx available on request)"498554-710.45819.65JDS IndustriesGiftsLeather Gifts1"Executive Gifts" "Graduation Gifts" "Business Promotional Gifts" "Corporate Promotional Gifts" "Executive Business Gifts" "Business Holiday Gifts" "Leather Portfolio Cases" "Portfolio Cases" "Leather Portfolio Case" "New Products" "Graduation Gift"Find this custom manicure set discounted at TrophyCentral. Each manicure set is personalized with your message. No minimum quantities!custom-pagegifts-desk-general1"1-2 business days" "Marquette, MI" "UPS"personalized gifts498852-310.4510016.45Quick TrophyGiftsCustom Pens1:14%"New Products"Find these fabulous Maple Pen Cases discounted at TrophyCentral. TrophyCentral is known for its top-rated customer serviceCustom Penscustom-pagerunning-trophies1medals498552-40.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find these colorful Marathon 2" Epoxy-covered insert decals discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.custom-pagefree-sports-templates1"Download Only"free-academic4985501Trophy CentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Marathon template is free and designed exclusively for Trophy Central. Marathon certificate templates measure 11" x 8 1/2" and can be easily downloaded and printed.marathon-certificatemarathon-m-frMarathoncustom-pagetrophies-track-field1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Marathon Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.custom-pagetrophies-track-field1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Marathon Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.custom-pagetrophies-track-field1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Marathon Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.custom-pagetrophies-track-field1medals498552-30.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these colorful Marathon insert medals discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.custom-pagetrophies-track-field1medals498552-30.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Marathon insert medals with a personalized front rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.custom-pagecherry-insert-plaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these marathon insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.custom-pagerunning-trophies12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Marathon Inserts (Litho) at TrophyCentral. Each Marathon Insert can be used to create a unique plaque, medal or trophy.507037
ir36e9083e7037marathon-mcmarathon-mc-prmarathon-jigfmarathon-jisfmarathon-jibf1sports-medals1Shop premium marathon medals in various sizes and styles. Choose from insert medals, framed designs, and custom options. Perfect for race organizers and marathon events.Recognize marathon runners' dedication and perseverance with our specialized collection of marathon medals. Whether you're organizing a local 5K, half marathon, or full 26.2-mile race, our medals provide the perfect way to honor participants' accomplishments. Our marathon medal selection includes versatile insert medals, elegant framed designs in gold, silver, and bronze finishes, and personalized options with custom rim engraving. Available in multiple sizes and featuring detailed marathon-themed designs, these medals are suitable for both male and unisex categories. TrophyCentral makes it easy to reward every runner who crosses your finish line with a lasting memento of their achievement. Browse our complete selection of marathon medals and find the perfect recognition for your next race event.custom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock Bottles1:22%,100:28%,500:34%,1000:45%"Track Medals"These inexpensive 1 1/4 inch Marathon (Male) Medals offer a high quality, but low price for those on a tight budget.e908311-20-2012
custom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock Bottles1:22%,100:28%,500:34%,1000:45%"Track Medals"These inexpensive 1 1/4 inch Marathon, Unisex Medals offer a high quality, but low price for those on a tight budget.e703708-05-2011
custom-pagesports-resource-hub11Real marathon bonking stories with lessons learned. Discover what causes the wall, common pacing mistakes, and smart racing strategies to avoid implosions at mile 20.custom-pagerunning-trophies1498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our marathon insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - Marathoncustom-pagetrophies-track-field1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy marathon insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.custom-pagerunning-trophies1498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Marathon single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - Marathoncustom-pagetrophies-military-hero1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511230.45Classic MedallicsTrophiesHero1:22%,6:23%,12:24%,24:26%"Hero Awards"Shop for Cast Stone Marine Corps Emblem Awards at TrophyCentral. We have a great selection of Marine Corps Emblem and other recognition trophies at discounted prices.tr9928Military, Marines, Herocustom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality Marine Corps Semper Fidelis Inserts at TrophyCentral. Each Marine Corps Semper Fidelis Insert can be used to create a unique plaque, medal or trophy.518211Military, Hero, Marines
custom-pagetrophies-archeryqtmarksmanncqtmarksmanscqtmarksmandmqtmarksmanplqtmarksmanyrqtmarksmanttqtmarksmanttwqtmarksman3cmqtmarksmanscbcup-marksman-pcup-marksman-scbshooting-part-ishooting-single-ipistols-part-ipistols-single-ipistols-champ-irifle-champ-ipistols-plaque-irifle-plaque-ihunting-e-part-ihunting-e-single-ipistol-e-part-ipistol-e-single-icup-hunting-scb-icup-pistols-scb-icup-pistols-incup-shooting-inbdg-marksmanqttrapperp1trophies1Find hunting and rifle trophies discounted at TrophyCentral. Each hunting trophy includes three lines of engraving. Medals feature a free ribbon. Custom Marksman Trophies TrophyCentral has a great online selection of discounted marksman trophies. Our single column trophy with a marksman shooting figure is a customer favorite. Be sure to see our perpetual rifle and shooting trophies for your next championship. All of our trophies include up to three lines of free personalization (larger awards include additional lines).

Shooting Sports Trophies for Gun Clubs and Hunting Organizations

Recognition drives excellence in shooting sports organizations and hunting clubs. Whether you manage a local gun club, coordinate trap shooting leagues and skeet competitions, or organize competitive rifle marksmanship events, unique quality trophies and plaques strengthen your program by honoring marksmanship skill development, celebrating shooting achievements, and reinforcing the firearm safety and sportsmanship values central to shooting sports traditions. From trap and skeet competitions to rifle shooting tournaments and sporting clays events, the right trophy awards create memorable moments that keep gun club members engaged season after season.

Our unique shooting sports trophies and plaques collection features designs specifically crafted for hunting clubs, gun clubs, and marksmanship organizations. Each trophy and plaque includes free personalized engraving to recognize individual shooting achievements, competition results, or club milestones. With quality construction, fast shipping, and budget-friendly options for ordering multiple awards, you can build a complete recognition program that celebrates everyone from first-time trap shooters to expert marksmen. Be sure to check our hunting and shooting medals with free neck ribbons. Also see our view our comprehensive shooting sports awards guide for detailed recommendations on the best unique trophies and awards for your hunting club or gun club organization.

]]>
hunting-shooting-medals trophies
custom-pagefree-sports-templates1"Download Only"free-sports49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Marksman template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Marksman-Certificatemarksman-freeMarksmancustom-pagetrophies-marksman-shooting-rifle1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:38%Our popular Marksman participation trophies feature a real slant-front marble base and free engraving.qtmarksmannccustom-pagetrophies-marksman-shooting-rifle1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular marksman figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!qtmarksmanplcustom-pagetrophies-marksman-shooting-rifle1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%This popular Marksman Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!qtmarksmanyrcustom-pagetrophies-marlin-fishing1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with marlin fish figure discounted at TrophyCentral. Includes free text engraving!cup-marlin-pFishing, Sportscustom-pagequickshiptrophies-marlin1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular marlin figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!qtmarlinplFishing, 1st / 2nd / 3rd / Etc., Sportscustom-pagequickshiptrophies-marlin1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:38%Our popular Marlin Fish participation trophies feature a real slant-front marble base and free engraving.qtmarlinncFishing, Sportscustom-pagetrophies-marlin-fishing1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these marlin fish budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtmarlinscbFishing, Sportscustom-pagequickshiptrophies-marlin1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find these popular Marlin Fish Figure year trim trophies discounted at TrophyCentral. Available in multiple sizes and includes free engraving.qtmarlinyrFishing, Sports100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)""PT2=7745310-14125016.5PepcoPromotional ProductsSports / Water Bottles1:14%,250:21%,500:31%,1000:45%,2500:49%Maroon Custom Sports Bottles from TrophyCentral. Discounted Trophies, Awards and Promotional Products.sportsbottles-maroon12-20-2020Sports / Water Bottlescustom-pagefreeawardcertificates1"Download Only"certificates4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Marriage Award template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Marriage-Award-Certificatemarriage-award-freeMarriagecustom-pagefree-sports-templates1"Download Only"sports4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Martial Arts template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Martial-Arts-Certificatemartial-arts-freeMartial Artscustom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Martial Arts Inserts (Litho) at TrophyCentral. Each Martial Arts Insert can be used to create a unique plaque, medal or trophy.507501Karate / Martial Arts, Sports
custom-pageribbons1mascotbadges-pawmascotbadges-paw2mascotbadges-arrowheadmascotbadges-bearmascotbadges-bulldogmascotbadges-bulldog2mascotbadges-cardinalmascotbadges-eaglemascotbadges-hornetmascotbadges-mustangmascotbadges-indianmascotbadges-indian2mascotbadges-knightmascotbadges-lionmascotbadges-panthermascotbadges-piratemascotbadges-rammascotbadges-tigermascotbadges-spartanmascotbadges-vikingmascotbadges-wildcat11Shop for Mascot Badges at TrophyCentral. Each Mascot Badge Can be Customized with Your School Name!mascotpins mascot-medals trophies-mascotcustom-pageinserts148991948992948993948995148992248992148995248994448994748995048992448994648993548994348993848993448992548994148994548994848992748992648994948992848992348992048993048994248994048993611Browse our selection of mascot inserts to enhance school spirit. Each 2" inserts fits in a medal frame, trophy or plaque.1mascot-medalscustom-pageacademic-general-medalstm9919gtm9929gtm9939gtm9951gtm9922gtm9952gtm9944gtm9947gtm9950gtm9924gtm9935gtm9943gtm9938gtm9934gtm9925gtm9945gtm9948gtm9927gtm9926gtm9949gtm9921gtm9946gtm9941gtm9928gtm9923gtm9735gtm9730gtm9742gtm9940gtm9936gpaw-qcmmascotinserts1award-medals1"Soccer Medals and Trophies" "Soccer Trophies and Medals" "Baseball Trophies and Medals" "Baseball Medals and Trophies"We have a great selection of mascot medals, including Bull Dogs, Panthers and much more! Find your school mascot medals today!School & Sports Mascot Medals TrophyCentral has a fabulous selection of colorful mascot medals and mascot trophies to meet your needs. Choose from popular mascots, such as bulldogs, bears, gators, panthers and many more. Each mascot medal measures 2 1/4" in diameter and includes a neck ribbon. Ribbons are even available in a large number of color combinations to match your team or school colors! We offer FREE SHIPPING on mascot medal orders over $99 shipping to the contiguous U.S.]]>mascotpins trophies-mascotcustom-pagesports-pinsem08em17em05em14em13em15em12em02em01em09em06em16pm11pm26pm14pm25pm28pm20pm22pm23pm15pm27pm19pm24pm13pm12pm10pm18pm17mp1xxbr639xx11"Hockey Awards" "Gymnastics Awards" "School Awards" "Lapel Pins" "Custom Lapel Pins" "Trading Pins" "Custom Trading Pins" "Lapel Trading Pins" "Cheerleading Pins" "Dance Pins" "Cheerleader Pins"Shop with Ease at TrophyCentral! If you are looking to buy school mascot lapel pins online, look no further! TrophyCentral has a great selection that will fit any budget. Our top-rated representatives are happy to assist you with all of your pin needs. Our experts in New York and Michigan have been providing suggestions and guidance since 1999! To find the perfect mascot pin, click on an image above, or for personal service, call us toll-free at 1-888-809-8800.]]>custom-pageplaquesbear-plaque-slblue-jay-plaque-slbulldog-plaque-slcardinal-plaque-slcobra-plaque-slcougar-plaque-slcowboy-plaque-sleagle-plaque-slfalcon-plaque-slhawk-plaque-slindian-plaque-sljaguar-plaque-slknight-plaque-sllion-plaque-slmustang-plaque-slowl-plaque-slpirate-plaque-slram-plaque-slrattlesnake-plaque-slraven-plaque-sltiger-plaque-sltrojan-plaque-slviking-plaque-slwolf-plaque-slmascot-award-plaque1plaques1Find mascot plaques discounted at TrophyCentral. Each plaque features a mascot image and free engraving. Chose from bear, bull bog, rattlesnake and other popular mascots.

Shop with Ease at TrophyCentral!

If you are looking to buy mascot plaques or trophies online, look no further! TrophyCentral has an industry-leading selection that will fit any budget, all at discounted prices. Our experts in New York and Michigan have been providing help and suggestions since 1999! For more information, please call us at 1-888-809-8800.

]]>
mascotpins mascot-medals
mascot-plaquesmt2011mt2002mt2001mt2009mt2006mt2012mt2015mt2014mt2021mt2016mt2020mt2008mt2035mt2034mt2030mt2026mt2027mt2028ts102311Shop for mascot trophies at TrophyCentral. Each mascot trophy and award features free personalization. See our large selection of school mascots!mascot trophies, mascot trophy, mascot awards, mascot trophies and awardsMascot Recognition Trophies TrophyCentral has an industry-leading selection of school mascot trophies. Popular mascots include: Bull Dogs, Trojans, Tigers, Cougars, Bob Cats, Panthers and many more. All of our mascot awards are made of hand-painted resin and include up to three lines of FREE ENGRAVING. We also offer FREE SHIPPING on award orders over $100 shipping to the continental U.S.

Mascot Medals

If you are looking for a budget-friendly alternative to trophies, our medals are the perfect solution. Each mascot medal includes a neck ribbon and optional engraving to keep the price as low as possible. School mascot medals are available in color with gold trim. Be sure to check out our Colorful Mascot Medals! Without engraving, your order will typically ship in just 1-2 business days, so no need to worry if you have waited for the last minute. ]]>
custom-pageshop-by-categorymt2011mt2002mt2001mt2009mt2012mt2015mt2014mt2021mt2016mt2020mt2008mt2035mt2034mt2030mt2026mt2027mt2028ts1023mascot-award-plaquemasc2001trophies1Shop for mascot trophies at TrophyCentral. Each mascot trophy and award features free personalization. See our large selection of school mascots!mascot trophies, mascot trophy, mascot awards, mascot trophies and awards

Mascot Recognition Trophies

TrophyCentral has an industry-leading selection of school mascot trophies. Popular mascots include: Bull Dogs, Trojans, Tigers, Cougars, Bob Cats, Panthers and many more. All of our mascot awards are made of hand-painted resin and include up to three lines of FREE ENGRAVING.

Mascot Medals

If you are looking for a budget-friendly alternative to trophies, our medals are the perfect solution. Each mascot medal includes a neck ribbon and optional engraving to keep the price as low as possible. School mascot medals are available in color with gold trim. Be sure to check out our Colorful Mascot Medals! Without engraving, your order will typically ship in just 1-2 business days, so no need to worry if you have waited for the last minute.
]]>
mascot-plaques mascot-medals
custom-pagemedallion-inserts-fraternal-organizational-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "Clubs, Organizations, Charities"Buy these quality Masonic Inserts (Litho) at TrophyCentral. Each Masonic Insert can be used to create a unique plaque, medal or trophy.491506
custom-pageacademic-general-medalscup-math-pmath-part-imath-single-icup-math-scb-imath-e-part-imath-e-single-imath-plaque-imath-champ-imath-jigfmath-jisfmath-jibfmath-mc-prmath-mc1trophies-academic1Find a great selection of math trophies discounted at TrophyCentral. Each math trophy includes free engraving. Math medals include a ribbon.math trophies, math trophy, math awards, math trophies and awardsFind Math Recognition Trophies and Awards with Ease TrophyCentral has a great selection of math recognition awards for your students in a variety of different styles, including certificates, medals, trophies and pins. Our colorful math certificates and pins are an inexpensive way to reward and motivate students. Mathematics trophies and medals are also great as end of semester and end of year awards. Whether you want to recognize a special achievement in an algebra or geometry course, reward a student for doing their math homework, or motivate participation in class, you have come to the right place! We offer quality products, low prices, bulk discounts and great customer service!]]>math-medals trophiescustom-pagetrophies-math1medals498551-20.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find these colorful Math 2" Epoxy-covered insert stickers discounted at TrophyCentral. Fast shipping, free over $99.custom-pagemath-lapel-pinsplastic-pinbox-t5498551-20.550040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find our 3D Series gold mathematics pins discounted at TrophyCentral. Fast 1-2 day shipping.05282024Mathcustom-pagetrophies-math1trophies498551-211821.06TrophyCentraltrophies1Mathcustom-pagecoaching-teaching-guides11Discover creative math award ideas with clever engraving examples for competitions and classroom recognition. From Mathlete to Number Ninja, find unique ways to celebrate mathematical achievement with free engraving.custom-pageachievement-certificates-awards17027 905"Download Only"free-academic49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"See this Math Certificate designed exclusively for TrophyCentral! Math Certificates can be downloaded for free!mathfrMath, Academiccustom-pagetrophies-math1medals498551-20.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Math Excellence Insert Medals With A Personalized Front Rim Discounted at TrophyCentral. Fast shipping, free over $99.Mathcustom-pageawardcertificates115905 noname6 mathfr br382"1-3 business days" "Columbia, South Carolina; Marquette, Michigan" "UPS (FedEx available on request)"certificates290631-21 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,50:38%,100:42%"Math Awards" "Mathematics Awards" "Math Award"Find these Math certificates discounted at TrophyCentral. Each Math certificate measures 8 1/2 x 11 inches and typically ships in 1-2 days.7027Mathcustom-pageawardcertificates11mathfr 7027certificates290631-31 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,25:24%,100:40%,500:50%"Math Awards" "Mathematics Awards" "Math Award"Find this math certificate and other awards discounted at TrophyCentral. Math certificates are beautifully printed; template measures 11 x 8 1/2 inches.905Mathcustom-pageachievement-certificates-awards1"Download Only"free-academic49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Math Excellence template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Math-Excellence-Certificatemath-excellenceMath, Academiccustom-pagetrophies-math1trophies498551-21.1plaques1Find these math insert plaques discounted at TrophyCentral. Price includes free engraving. Shipping is free over $99.Math1academic-general-medals1Find math medals discounted at TrophyCentral. Each math medal features a free ribbon. Fast 1-2 day shipping.Shop with Ease at TrophyCentral TrophyCentral has a large selection of math medals, low prices and great customer service. Remember, each math medal features a free neck ribbon. Be sure to see our star and personalized rim frames with a math subject insert. Their unique designs make them popular choices with our customers. ]]>trophies-mathcustom-pagetrophies-math1trophies498551-210.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our math insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - MathMathcustom-pageschool-pinshp16br3823d-math1school-pins1Find Math Pins at TrophyCentral. Each Math Pin has a clutch back for easy and safe attachment to clothing. See all of our Math Awards.Lapel Pins: Math If you are looking for an inexpensive, yet quality way to recognize the achievements of your top math students, you have come to the right place! Whether you are looking to award students at the end of the year ceremony or motivate them throughout the year, we have a math pin for you. Math lapel pins for math typically ship in a quick 1-2 business days.]]>math-medalscustom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceCertificates / CoversEmbosser Seals1:22%,3:28%,5:31%Find these Math Certificate Seals discounted at TrophyCentral.803mathMathcustom-pagemath-lapel-pinsplasticpinboxvelapinbox10hp16"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"Math Awards" "Mathematics Awards" "Math Award" "Music Pins" "School Pins"Find these Math Whiz Pins discounted at TrophyCentral. Math pins feature a quality clutch back and ship in 1-2 days.br38206-15-2013Mathcustom-pagemath-lapel-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:30%,100:35%,500:48%"Math Awards" "Mathematics Awards" "Math Award" "Music Pins" "School Pins"hp1606-15-2013Mathcustom-pagetrophies-math1medals498551-20.525035.5TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these colorful Math insert medals discounted at TrophyCentral. Fast shipping, free over $99.Mathcustom-pagetrophies-math12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105502-41130025Classic MedallicsInsertsAcademic1:22%"Math Awards" "Mathematics Awards" "Math Award" "Award Medals" "School Medals" "Award Medals - All Subjects"Buy these high-quality Mathematics Inserts at TrophyCentral. Each Mathematics Insert can be used to create a unique plaque, medal or trophy.518198Math
custom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these quality Mylar Mathematics Decal Inserts at TrophyCentral. Each decal can be used to create a unique plaque, medal or trophy.489790Math
custom-pagenoindexed-items11This page includes sample pictures of boxes to display award medals. TrophyCentral carries a variety of different medal display box styles and sizes.1custom-page11Click here to see sample images of our Medal Display Boxes. Add a special touch to your award ceremony that your recipient is sure to love!custom-pagedisplaycases211"7-10 business days" "Connelly Springs, North Carolina" "UPS (FedEx available on request)"display case286127-1010.45660.45SpartaCraftDisplay CasesSpecialty Cases1:14%Medal Display Cases from TrophyCentral. Discounted Trophies, Awards and Promotional Products.Ribbons / Medals Displayscustom-page11Find medal insert frames discounts at TrophyCentral. Choose from gold, silver and bronze finishes. Each frame is sized to fit a 2" medal insert.1custom-pageeawardmedals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsGeneral1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "School Medals" "General Award Medals"These inexpensive 1 1/4 inch Medal of Excellence Medals offer a high quality, but low price for those on a tight budget.e998805-22-2019Academic
custom-pageeawardmedals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsGeneral1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "School Medals" "General Award Medals"These inexpensive 1 1/4 inch Medal of Merit Medals offer a high quality, but low price for those on a tight budget.e9993General, Academic
custom-pagemedallion-inserts-general-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Mylar Medal Of Special Achievement Decal Inserts at TrophyCentral. Each Medal Of Special Achievement Decal can be used to create a unique plaque, medal or trophy.489902Achievement
custom-page11Click here to see sample colors for your medal's ribbons. We have a huge selection to match your school's colors or company's branding.1personalized-medals-all111custom-pagedisplaycases21111rowchcora secodira secodi6ti mihodica chcoshdica"5-10 business days" "Connelly Springs, North Carolina" "UPS (FedEx available on request)"display case286125-1010.45690.45SpartaCraftDisplay CasesSpecialty Cases1:14%"Military Awards"Challenge Coin / Shadowboxes Display Cases from TrophyCentral.Challenge Coin Displayscustom-pagename-badges-tagswoyoulipr100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Megaphone Badges Discounted At TrophyCentral.namebadges-megaphonecustom-page11Enjoy fabulous membership discounts for your organization. Great for schools, not-for-profits and more. Also see our fundraising program. Click to learn more!custom-pagesports-inserts1105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Swimming Awards"Buy these quality Swimming (Men's Freestyle) Inserts (Litho) at TrophyCentral. Each Swimming (Men's Freestyle) Insert can be used to create a unique plaque, medal or trophy.504281Swimming / Diving, Sportscustom-pagefloor-standing-merchandiser145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Merchandiser light oak display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 48"W x 20"D. Model: 2010-4-gd-lv.12010-4-bz-lvTabletop, Floor-Standingcustom-pagefloor-standing-merchandiser145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Merchandiser light oak display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 60"W x 20"D. Model: 2010-5-gd-lv.12010-5-bz-lvTabletop, Floor-Standingcustom-pagefloor-standing-merchandiser1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Merchandiser light oak display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 72"W x 20"D. Model: 2010-6-gd-lv.2010-6-gd-lvTabletop, Floor-Standingcustom-pagefloor-standing-merchandiser1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Merchandiser light oak display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 48"W x 20"D. Model: 2010-4-bz-lv.2010-4-bz-lvTabletop, Floor-Standingcustom-pagefloor-standing-merchandiser1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Merchandiser light oak display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 60"W x 20"D. Model: 2010-5-bz-lv.2010-5-bz-lvTabletop, Floor-Standingcustom-pagefloor-standing-merchandiser145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Merchandiser light oak display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 72"W x 20"D. Model: 2010-6-bz-lv.12010-6-gd-lvTabletop, Floor-Standingcustom-pagefloor-standing-merchandiser145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Merchandiser light oak display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 48"W x 20"D. Model: 2010-4-sn-lv.12010-4-bz-lvTabletop, Floor-Standingcustom-pagefloor-standing-merchandiser145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Merchandiser light oak display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 60"W x 20"D. Model: 2010-5-sn-lv.12010-5-bz-lvTabletop, Floor-Standingcustom-pagefloor-standing-merchandiser145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Merchandiser light oak display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 72"W x 20"D. Model: 2010-6-sn-lv.12010-6-gd-lvTabletop, Floor-Standingcustom-pagedisplaycases12010-4-gd-lv2010-4-gd-wv2010-5-gd-lv2010-5-gd-wv2010-6-gd-lv2010-6-gd-wv2010-4-bz-lv2010-4-bz-wv2010-5-bz-lv2010-5-bz-wv2010-6-bz-lv2010-6-bz-wv2010-4-sn-lv2010-4-sn-wv2010-5-sn-lv2010-5-sn-wv2010-6-sn-lv2010-6-sn-wv11Find Merchandiser Series display cases discounted at TrophyCentral. Made in the US by Waddell, these quality displays are ideal for schools, libraries, retail locations and offices.displaycases1floor-standing-reliant floor-standing-edgecustom-pagefloor-standing-merchandiser145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Merchandiser walnut vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 48"W x 20"D. Model: 2010-4-gd-wv.12010-4-bz-lvTabletop, Floor-Standingcustom-pagefloor-standing-merchandiser145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Merchandiser walnut vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 60"W x 20"D. Model: 2010-5-gd-wv.12010-5-bz-lvTabletop, Floor-Standingcustom-pagefloor-standing-merchandiser1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Merchandiser walnut vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 72"W x 20"D. Model: 2010-6-gd-wv.2010-6-gd-wvTabletop, Floor-Standingcustom-pagefloor-standing-merchandiser145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Merchandiser walnut vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 48"W x 20"D. Model: 2010-4-bz-wv.12010-4-bz-lvTabletop, Floor-Standingcustom-pagefloor-standing-merchandiser145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Merchandiser walnut vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 60"W x 20"D. Model: 2010-5-bz-wv.12010-5-bz-lvTabletop, Floor-Standingcustom-pagefloor-standing-merchandiser145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Merchandiser walnut vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 72"W x 20"D. Model: 2010-6-bz-wv.12010-6-gd-wvTabletop, Floor-Standingcustom-pagefloor-standing-merchandiser145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Merchandiser walnut vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 48"W x 20"D. Model: 2010-4-sn-wv.12010-4-bz-lvTabletop, Floor-Standingcustom-pagefloor-standing-merchandiser145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Merchandiser walnut vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 60"W x 20"D. Model: 2010-5-sn-wv.12010-5-bz-lvTabletop, Floor-Standingcustom-pagefloor-standing-merchandiser145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Merchandiser walnut vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 72"W x 20"D. Model: 2010-6-sn-wv.12010-6-gd-wvTabletop, Floor-Standingcustom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceCertificates / CoversEmbosser Seals1:22%,3:28%,5:31%Find these Merit Embossed Certificate Seals discounted at TrophyCentral. Seals are easy to apply with a pressure-sensitive backing.803mGeneralcustom-pageschool-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:28%,100:32%,500:42%"School Pins" "School Lapel Pins"Find these popular Merit AP Series Lapel Pins discounted at TrophyCentral. Fast 1-2 day shipping!ap09General, Academiccustom-pagetrophies-basketball1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.45110.85Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%"Basketball Awards"Metal Basketball Award w/Trim. Ideal for leagues, schools, and tournaments. Fast shipping.metbasktrophytrimBasketball, Sportscustom-pagegifts-desk-general115-7 business days" "Marquette, Michigan" "UPS498554-7.45016TrophyCentral11:22%Metal Bottle Opener Key Chain. Bottle Opener with optional engraving.custom-pagegifts-desk-general11"3-4 business days" "Marquette, Michigan" "UPS"498552-4.414014TrophyCentral11:22%2 1/2 x 3 3/4 Business Card Holder. Made of Stainless Steel and hold approximately 10 business cards.custom-pagetrophies-football1trophies105503-610.45110.85Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:30%"Football Awards"Metal Football Award. Ideal for leagues, schools, and tournaments. Fast shipping.Football, Sportscustom-pagetrophies-soccer1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.45110.85Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%"Soccer Awards"Fabulous metal soccer trophy. Ideal for leagues, schools, and tournaments. Free Engraving. Fast shipping.Soccer, Sportscustom-pagecup-trophies-large-and-small1"3-4 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)""PT1=Trophies" "PC12=498552-311.2857.2TrophyCentralTrophies1:14%"Special Picks" "General Recognition Awards" "Golf Awards" "Popular Trophies" "Buy Trophies" "Discount Trophies" "Trophies : Fast" "New Products"Find these Metal Trophy Cups discounted at TrophyCentral. Choose from 3 popular sizes, each with a marble base and free personalization.1cup-trophies-large-and-smallCupsilver-cup-trophiescustom-pageclocks11"6-10 business days w/engraving, 1-3 without" "Chicago, Illinois" "UPS (FedEx available on request)"personalized gifts6063010-141 3 231.2426RS OwensGiftsClocks1:22%Find the Michelangelo Desk Clock at TrophyCentral; Includes Engraving!Engraved Clockscustom-pagemusicartpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsMusic, Drama, Art, Dance1:22%,50:30%,100:33%,500:45%"Music Lapel Pins" "Band Lapel Pins" "Music Pins"Find These Microphone Pins Discounted at TrophyCentral. Each Microphone Lapel Pin Features a Clutch-Pin Back and Fast 1-2 Day Shipping!mp15Music / Band / Choruscustom-pageachievement-certificates-awards1"Download Only"free-academic4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Middle School Diploma template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Middle-School-Diploma-Certificatemiddle-school-diploma-freeDiploma, Academic, Graduationcustom-pageemployee-resource-hub11Complete military and veterans recognition guide with proper protocol, flag ceremony procedures, retirement awards, and meaningful ways to honor military service and sacrifice.11Find a great selection of discounted Military and Hero Awards and at TrophyCentral. Each Military Trophy and Award includes free engraving!trophies-military-hero

Firefighter Trophies

TrophyCentral has a fabulous selection of trophies for firemen, firewomen and for police offices. Our popular Firefighter Trophies section includes a variety of awards that will be displayed proudly in any firehouse. And don’t miss our Cup Trophies, very popular with police and fire stations. All of our hero awards include FREE ENGRAVING. We also offer FREE SHIPPING on award orders over $100 shipping to the continental U.S.

Military Trophies and Awards

No one deserves more recognition than our military heroes; they serve our country so that we can all enjoy freedom. We have trophies to recognize Army, Air Force, Navy, Marines and Coast Guard achievements. We also carry a huge selection of 2” inserts that can be used to create unique trophies, plaques and medals. We have Inserts for fireman, police offices, EMT workers and all branches of the military!

Shop with Confidence at TrophyCentral!

If you are looking to buy military trophies online, look no further! TrophyCentral has an industry-leading selection that will fit any budget, all at discounted prices. Our top-rated representatives are happy to assist you with all of your military trophy and award needs. Our experts in New York and Michigan have been providing suggestions and guidance since 1999! To find the perfect military trophy, click on an image above, or for personal service, call us toll-free at 1-888-809-8800.
]]>
custom-pagetrophies-military-hero515159515148515409517511518136518193518141515303514069518140514068515410517545516025515207515049517523515038512761515643513771515412517023495891519215129415128215181355153125158995159575159685176035150965150635150855152835172935182115154085137815071385140325127215175815151125127715175725175705182104933715050215184664933415049014933815050114933615050015140705119411inserts11"Military Award" "Military Awards" "Military Trophies" "Military Medals"Find military inserts discounted at TrophyCentral. Each 2" inserts fits in a medal frame, plaque or trophy to create a unique recognition item.custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality Military Intelligence Inserts at TrophyCentral. Each Military Intelligence Insert can be used to create a unique plaque, medal or trophy.515408Military, Hero
custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality Military Police Inserts at TrophyCentral. Each Military Police Insert can be used to create a unique plaque, medal or trophy.513781Military, Hero
custom-pageshop-by-categoryherepltr5643tr9931tr9929tr9928681111x14framwdo1trophies1Find military trophies discounted at TrophyCentral. Each military trophy includes free engraving!

Firefighter Trophies

TrophyCentral has a fabulous selection of trophies for firemen, firewomen and for police offices. Our popular Firefighter Trophies section includes a variety of awards that will be displayed proudly in any firehouse. And don't miss our Cup Trophies, very popular with police and fire stations. All of our hero awards include FREE ENGRAVING.

Military Trophies and Awards

No one deserves more recognition than our military heroes; they serve our country so that we can all enjoy freedom. We have trophies to recognize Army, Air Force, Navy, Marines and Coast Guard achievements. We also carry a huge selection of 2" inserts that can be used to create unique trophies, plaques and medals. We have Inserts for fireman, police offices, EMT workers and all branches of the military!

Shop with Confidence at TrophyCentral!

If you are looking to buy military trophies online, look no further! TrophyCentral has an industry-leading selection that will fit any budget, all at discounted prices. Our top-rated representatives are happy to assist you with all of your military trophy and award needs. Our experts in New York and Michigan have been providing suggestions and guidance since 1999! To find the perfect military trophy, click on an image above, or for personal service, call us toll-free at 1-888-809-8800.
]]>
trophies-victory simenplaq
custom-pageribbons-neck-drapejumpringshofordrri25"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"105502-30.3612006.36Classic Medallicsribbons1:22%,100:30%,500:37%Find a large selection of Military Drape Ribbons at TrophyCentraldrape ribbons, ribbon drape, award ribbons, drape award ribbonsReturn to thesection for more great choices.Red White Blue, Patrioticcustom-pagefreeawardcertificates1"Download Only"certificates4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our mindfulness template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-mindfulness-Certificatemindfulness-freeMindfulnesscustom-pagerosetteribbons1"1-2 business days" "Topeka, Indiana" "UPS (Post Office Priority Mail may also be available)"465711-21 260.3630021.36Tower RibbonRibbonsStock Ribbons1:22%,50:25%,100:31%"Rosette Ribbons"Find Mini Patriot Printed Rosettes at TrophyCentral. Fast shipping on patriotic ribbons and rosettes.Academic, Patriotic, 1st / 2nd / 3rd / Etc.noindexed-items11Minuteman Awards from TrophyCentral. Discounted Trophies, Awards and Promotional Products.1custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these quality Minuteman Inserts (Litho) at TrophyCentral. Each Minuteman Insert can be used to create a unique plaque, medal or trophy.507138Military, Hero
noindexed-items11Minuteman Press - Norwich: Visit our TrophyCEntral partner1noindexed-items11Minuteman Press - St. Louis: Visit TrophyCentral to see this and similar Trophies and Awards1custom-pageacrylicawards11"1-2 business days" "Marquette, MI" "UPS"general498552-310.452425.6Quick TrophyCrystal Awards1:14%"New Products" "Special Picks"The Mirage Award is 1" thick with reflective gold base. Price includes engraving. This award is a quick-ship item and leaves the factory in just 1-2 business days.mirage5x7acrylicReturn to oursection for more great choices.general-corporate-awardsLeadership923-10200-11bevickersawardbapatr1ajax-test560-6924-10200-11705-5quick-holographic-plaques1]]>1custom-pageghent-new-mobile-boards1Bulletin Boards4512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Nexus Easel+, Mobile 2-Sided Porcelain Magnetic Whiteboard with Tablet Storage, 4 Tablets, 39"H x 26"W discounted at TrophyCentral.nex204ep4-frMobile, Easelcustom-pageghent-new-mobile-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Nexus Easel+, Mobile 2-Sided Porcelain Magnetic Whiteboard with Tablet Storage, 8 Tablets , 39"H x 26"W discounted at TrophyCentral.1nex204ep4-frMobile, Easelcustom-pageenclosed-bulletin-boardsnex203me-frnex206mw-frnex204ep4-frnex204ep8-frnex204ep-frgarm1m134-ms1garm1m134-ms2garm1m146-ms1garm1m146-ms2arm4m434arm4m446arm4m448c4rkk34arkk43arkk34armk34armk43rmk34rkk46arm1m143arkk46arm1m134armm43armm34rmm34armk46rmk46rmm46arm1m146armm46arm1m148rm36sawhn1school1Shop for Mobile Bulletin Boards with Ease at TrophyCentral. We have great customer service, low prices and bulk discounts. Need help finding mobile or cork boards? We sell online, but we have real people who would love to assist you!1Shop for Mobile Bulletin Boards with Ease at TrophyCentral We have great customer service, discounted prices and bulk discounts. Do you need help with a product or ordering? Yes, we sell online, but we have real people who would love to assist you! Feel free to call our customer service experts in Michigan, New York and online. TrophyCentral - delivering smiles since 1999!]]>enclosed-whiteboardscustom-pageghent-new-mobile-boards1Bulletin Boards45123110-171 3 4 5 6 7 8 9 10 22 2341Bulletin Boards11Find the Ghent Reversible Cork Bulletin Board with Aluminum Frame, 3'H x 4'W discounted at TrophyCentral.arkk34Not Enclosed, Reversiblecustom-pageghent-new-mobile-boards145123110-171 3 4 5 6 7 8 9 10 22 2341Bulletin Boards11Find the Ghent Reversible Cork Bulletin Board with Aluminum Frame, 4'H x 3'W discounted at TrophyCentral.1arkk34Not Enclosedcustom-pagestar-pinsplasticpinboxvelapinbox1"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsGeneral1:30%,50:34%,100:38%"Star Pins" "Star Lapel Pins" "Star Award Pins"Find these Modern Star with Sparkle Finish Pins discounted at TrophyCentral. Each pin features a beautiful copper finish and clutch-back.br592bStar, Generalcustom-pagestar-pinsplasticpinboxvelapinbox1"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsGeneral1:30%,50:34%,100:38%"Star Pins" "Star Lapel Pins" "Star Award Pins"Find this Modern Silver Sparkle Star Award Pin at TrophyCentral. Modern Silver Sparkle Star Award and other pins ship in just 1-2 business days!br592sStar, Generalcustom-pagestar-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsGeneral1:30%,50:34%,100:38%"Star Pins" "Star Lapel Pins" "Star Award Pins"Find this Modern Star Pin with Sparkle Finish Discounted at TrophyCentral. Fast 1-2 Day Shipping.br592gStar, Generalcustom-pagestar-pinsplasticpinboxvelapinbox1"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsGeneral1:30%,50:34%,100:38%"Star Pins" "Star Lapel Pins" "Star Award Pins"Find this 1-inch Molded Star pin discounted at TrophyCentral. Molded Star pins feature a quality clutch-back.br29211-25-2010Star, Generalcustom-pageengraved-frames1"3-4 business days" "Medina, MN" "UPS"personalized gifts553404-70.51832.9JDSGiftsEngraved Frames1:22%Find These Unique Mom in Flowers Picture Frames Discounted at TrophyCentral.gc468Engraved Framescustom-pageengraved-frames1"3-4 business days" "Medina, MN" "UPS"personalized gifts553404-70.51832.9JDSGiftsEngraved Frames1:22%Mom in Translation Picture Frames from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.Engraved Framescustom-pageengraved-frames1"3-4 business days" "Medina, MN" "UPS"personalized gifts553404-70.51832.9JDSGiftsEngraved Frames1:22%Find These Unique Mom-Mother Engraved Frames Discounted at TrophyCentral.gc469Engraved Frames11"3 1/2 - 4 1/2 weeks" "Greenfield, Ohio" "Truck (please allow 2-7 days for shipping)""PT4=45123128-541 3 4 5 6 7 8 9 10 22 230.451WaddellDisplay CasesTrophy Cases11"Glass Display Case" "Glass Display Cases" "Glass Trophy Cases" "Glass Trophy Case"Find a quality Monarch Series Display Case at TrophyCentral; Lowest Prices Guaranteed.mosedica573Floor-Standingcustom-pagegavelplaques11"7-10 business days w/engraving" "Chicago, Illinois" "UPS (FedEx available on request)"plaques606307-101 3 230.451616.45RS OwensPlaquesGeneral1:22%,2:26%Money Bags Plaques from TrophyCentral. Discounted Trophies, Awards and Promotional Products.12-20-2020custom-pagecalendar-whiteboards14512310-171 3 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Monthly Planner Whiteboard with Radius Corners, 2'H x 3'W discounted at TrophyCentral.1984515Not Enclosed, Plannercustom-pagelapel-award-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"105502-30.31150030.3Classic Medallicslapel-award-pins1:22%,50:30%,100:38%,500:58%"Math Awards" "Mathematics Awards" "Math Award" "School Awards" "Spelling Bee Award" "Spelling Bee Awards" "Awards, Spelling Bee" "Spelling Bee Trophies" "Spelling Bee Trophy" "Spelling Awards" "Spelling Award" "Spelling Trophies" "Spelling Bee Medals" "Spelling Medals"Art, Business, Citizenship, Computer, Creative Writing, Debate, Drama, Effort, English, Honor Roll, Effort, Improvement, Journalism, Language Arts, Leadership, Library, Math, Merit, Perfect Attendance, Physical Education, Reading, Safety Patrol, Salutatorian, Science, Scholarship, Scholastic, Service, Social Studies, Spanish, Speech, Spelling, Student Council, Valedictorian, Yearbookcustom-pagemedals-general20medals498551-30.5100021TrophyCentralInsertsSports, Hobby, Org, Livestock1Find these colorful Most Improved 2" Epoxy-covered inserts discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Most Improvedcustom-pagefree-sports-templates1"Download Only"free-sports4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Most Improved Athlete template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Most-Improved-Athlete-Certificatemost-improved-athleteMost Improvedcustom-pagetrophies-general1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy most improved column insert trophy features a choice of column color, a marble base and free trophy engraving.Most Improvedcustom-pagemedals-general1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Most Improved Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Most Improvedcustom-pagemedals-general1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Most Improved Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Most Improvedcustom-pagemedals-general1medals498551-30.525035.5TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these colorful Most Improved insert medals discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Most Improvedcustom-pagemedals-general1medals498551-30.525035.5TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Most Improved insert medals with a personalized front rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Most Improvedcustom-pagetrophies-general1plaques498551-311.11623.5TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these Most Improved insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Most Improvedcustom-pageschool-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"Baseball Pins" "Soccer Pins" "Basketball Pins" "Football Pins" "Volleyball Pins" "Swimming Pins" "Track Pins" "Wrestling Pins"Find these Most Improved pins discounted at TrophyCentral. Each Most Improved lapel pin features a clutch back. Perfect for athletes and students.br37707-15-2012General, Academic (General)custom-pagemedals-general12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Sports Medals"Your athletes will love these colorful Mylar Most Improved Medals from TrophyCentral. Each Most Improved medal includes a neck ribbon!tm9964gSports
custom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these high-quality Most Improved Inserts at TrophyCentral. Each Most Improved Insert can be used to create a unique plaque, medal or trophy.518180General
custom-pagemedals-general102-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.5115014Classic Medallicsaward-medalsAcademic1:22%,25:24%,50:30%,100:36%,500:42%"School Medals" "School Award Medals" "Scholastic Medals" "Scholastic Award Medals" "Academic Medals" "Academic Award Medals" "Medals, School"Your students will love these colorful Mylar Most Improved Medals from TrophyCentral. Each Most Improved medal includes a neck ribbon!tm9886Academic
custom-pageeawardmedals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsGeneral1:22%,100:28%,500:34%,1000:45%"Band Awards" "Award Medals - All Subjects" "School Medals" "General Award Medals" "Sports Awards" "Sports Medals"These inexpensive 1 1/4 inch Most Improved Medals offer a high quality, but low price for those on a tight budget.e993212-20-2020Academic (General)
custom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these quality Mylar Most Improved Decal Inserts at TrophyCentral. Each decal can be used to create a unique plaque, medal or trophy.489886Achievement
custom-pagetrophies-general1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our most improved insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Most Improvedcustom-pagetrophies-general1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy most improved insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Most Improvedcustom-pagestar-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:34%,100:39%,500:43%"School Pins" "School Lapel Pins"Find this Most Improved with Stars Pin at TrophyCentral. Most Improved with Stars and other pins ship in just 1-2 business days!br583Sports, Academiccustom-pagetrophies-general1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Most Improved single column insert trophy features a choice of column color, a marble base and free trophy engraving.Most Improvedcustom-pageachievement-certificates-awards1"Download Only"free-academic49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Most Improved Student template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Most-Improved-Student-Certificatemost-improved-student-freeMost Improved, Academiccustom-pageachievement-certificates-awards1"Download Only"free-sports49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Most Improved Student template is free and designed exclusively for TrophyCentral. Award certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Most-Improved-Certificatemost-improved-freeMost Improved, Academiccustom-pagetrophies-general1trophies498551-311821.06TrophyCentraltrophies1custom-pagefree-sports-templates1"Download Only"free-sports49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Most Valuable Player Award template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Most-Valuable-Player-Award-Certificatemost-valuable-freeMost Improvedcustom-pagemedals-general1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Most Improved Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Most Improvedcustom-pageengraved-frames1"3-4 business days" "Medina, MN" "UPS"personalized gifts553404-70.51832.9JDSGiftsEngraved Frames1:22%Find These Unique Mothers Poem Engraved Frames Discounted at TrophyCentral.Engraved Framescustom-pagedramatrophies21"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)""PT1=Trophies" "PC12=465713-410.45810.3Tower RibbonTrophiesMusic, Drama, Art, Dance1:22%,25:35%"Drama Trophies" "Drama Awards"Find These Motion Xtreme 500 Theater Trophies Discounted at TrophyCentral. Price Includes Free Engraving. Large Quantity Discounts Available.drmatrSee more greatin a variety of styles.trophies-drama12-20-2040Dramacustom-pagetrophies-baseball1trophies465713-410.451613.1Tower RibbonTrophiesSports, Hobby, Org, Livestock1Motion Xtreme (700 Series Trophy) - Female Baseball Batter. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Baseball / T-Ball, Sportscustom-pagetrophies-baseball1trophies465713-410.451613.1Tower RibbonTrophiesSports, Hobby, Org, Livestock1Motion Xtreme (700 Series Trophy) - Male Baseball Batter. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.motion-700-trophies-male-baseball-batterBaseball / T-Ball, Sportscustom-pagetrophies-track-field111041 cl50 cl42"2-3 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.451613.1Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,100:29%These Unique Girls Track Motion Xtreme 700 Trophies Ship In Just 1-2 Business Days And Include Free Engraving!moxtfetrtrSee additionalin a large variety of styles.trophies-track-fieldcustom-pagetrophies-lacrosse11"2-3 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-4141613.1Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,100:29%"Lacrosse Awards"These Unique Motion Xtreme 700 Lacrosse (Female) Ship In Just 1-2 Business Days And Include Engraving.felatrLooking for something different? See morein other great styles.trophies-lacrosse05-23-2009Lacrosse, Sportscustom-pagetrophies-soccer1trophies465713-410.451613.1Tower RibbonTrophiesSports, Hobby, Org, Livestock1Motion Xtreme (700 Series) Boy's Soccer Figure Trophies. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-page11"2-3 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)""PT1=Trophies" "PC12=465713-410.45613.1Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,100:29%These Unique Motion Xtreme 700 Tennis (Female) Trophies Ship In Just 1-2 Business Days And Include Free Engraving!noname712-20-2040Tennis, Sports1"2-3 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.451613.1Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,10:28%,25:33%,100:40%Motion Xtreme (700 Series) Trophy - Basketball (Female). Ideal for leagues, schools, and tournaments. Fast shipping.mx70806-15-2013Basketball, Sportscustom-pagetrophies-softball1"2-3 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.451613.1Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,100:29%"Softball Awards" "Baseball Awards" "Softball Awards"These Unique Motion Xtreme 700 Girls Softball Trophies Ship In Just 1-2 Business Days And Include Engraving.mxx02Softball, Sportscustom-pagetrophies-soccer1trophies465713-410.451613.1Tower RibbonTrophiesSports, Hobby, Org, Livestock1Motion Xtreme (700 Series) Girl's Soccer Figure Trophies. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagetrophies-swimming-diving11"2-3 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.451616.5Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,25:30%These Unique Motion Xtreme 700 Boys Swimming Trophies Ship In Just 1-2 Business Days And Include Engraving! Significant Quantity Discounts Available!maswtrSee our complete selection of boy's and girl'sin a large variety of styles for all of your individual, team and swim meet needs.trophies-swimming-divingSwimming / Diving, Sportscustom-pagetrophies-lacrosse11"2-3 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-4141613.1Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,100:29%"Lacrosse Awards"These Unique Motion Xtreme 700 Lacrosse (Male) Ship In Just 1-2 Business Days And Include Engraving.malatr9-12-2009Lacrosse, Sportscustom-pagetrophies-volleyball11"2-3 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)""PT1=Trophies" "PC12=465713-410.451613.1Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,100:29%These Unique Motion Xtreme 700 Volleyball (Male) Ship In Just 1-2 Business Days And Include Engraving.1trophies-volleyballVolleyball, Sports1"2-3 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)""PT1=Trophies" "PC12=465713-410.451613.1Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,10:28%,25:33%,100:40%Motion Xtreme (700 Series) Trophies - Football. Ideal for leagues, schools, and tournaments. Fast shipping.mx709Football, Sports1"2-3 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)""PT1=Trophies" "PC12=465713-410.45613.1Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,100:29%"Golf Trophies"Motion Xtreme (700 Series) Trophies - Woman's Golf. Ideal for leagues, schools, and tournaments. Fast shipping.mx70412-20-2040Golf, Sportscustom-pagetrophies-swimming-diving11"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.451810.3Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,10:28%,25:34%moxtmaswtr09-30-2024Swimming / Diving, Sports1"PT1=Trophies" "G=Him" "SC2=465713-410.45810.3Tower RibbonTrophiesSports, Hobby, Org, Livestock1"Baseball Trophies" "T-Ball Trophies" "T-Ball Awards" "Baseball Trophies and Medals" "Baseball Medals and Trophies"Motion Xtreme 5" (500 Series) Boy's Baseball Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.12-31-2054Baseball / T-Ball, Sports11gibatr wge457 tr7000 tr7001"1-2 business days + shipping time" "Topeka, Indiana" "UPS (FedEx available on request)"trophies465713-410.451810.3Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,25:35%"Basketball Awards" "Basketball Trophies"Motion Xtreme 5" (500 Series) Trophy - Basketball (Boys). Ideal for leagues, schools, and tournaments. Fast shipping.bobatrBasketball, Sportscustom-pagetrophies-soccer1trophies465713-410.451810.3Tower RibbonTrophiesSports, Hobby, Org, Livestock1"Soccer Trophies"Motion Xtreme 5" (500 Series) Boy's Soccer Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagetrophies-tennis11"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.451810.3Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,10:28%,25:34%Find These Popular Motion Xtreme 500 Boy's Tennis Trophies At TrophyCentral. The Price Of Each Motion Xtreme 500 Boy's Tennis Trophy Includes Free Personalization.moxtmatetrTennis, Sportscustom-pagetrophies-track-field11"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.451810.3Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,10:28%,25:34%Find This Popular Motion Xtreme 500 Track (Boys) Trophy At TrophyCentral. The Price Of Each Motion Xtreme 500 Track (Boys) Trophy Includes Engraving.motionSee our completesection for more choices.trophies-track-fieldcustom-pagetrophies-football11"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.451810.46Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,25:35%"Football Awards"Motion Xtreme 5" (500 Series) Trophies - Football. Ideal for leagues, schools, and tournaments. Fast shipping.moxtfotr06-14-2026Football, Sportscustom-pagetrophies-track-field11"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.451810.3Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,100:29%Find This Popular Motion Xtreme 500 Girls Track Trophy At TrophyCentral. The Price Of Each Motion Xtreme 500 Track (Girls) Trophy Includes Engraving.moxtfetrtr1bobatr11"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.451810.3Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,25:35%"Basketball Awards" "Basketball Trophies"Motion Xtreme 5" (500 Series) Trophies - Female Girl's Basketball. Ideal for leagues, schools, and tournaments. Fast shipping.gibatrBasketball, Sportscustom-pagetrophies-swimming-diving11"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.451810.3Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,10:28%,25:34%moxtfeswtrBe sure to see our other greatin a variety of styles.trophies-swimming-diving9-30-24Swimming / Diving, Sportscustom-pagetrophies-music11"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.451810.3Tower RibbonTrophiesMusic, Drama, Art, Dance1:22%,10:28%,25:34%"Band Awards"Find This Popular Motion Xtreme 500 Music Trophy At TrophyCentral. The Price Of Each Motion Xtreme 500 Trophy Includes Engraving.moxtmutr12-31-25Music / Band / Choruscustom-page11"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.451810.3Tower RibbonTrophiesAcademic1:22%,10:28%,25:34%Find This Popular Motion Xtreme 500 Pinewood Derby Trophy At TrophyCentral. The Price Of Each Motion Xtreme 500 Pinewood Derby Trophy Includes Engraving.pidetr06-10-2026Pinewood Derbycustom-pagereligioustrophies11"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.451810.3Tower RibbonTrophiesReligious1:22%,25:26%Find This Popular Motion Xtreme 500 Religious School Cross Trophy At TrophyCentral. The Price Of Each Motion Xtreme 500 Religious School Cross Trophy Includes Engraving.recrsctr09-25-2012Religiouscustom-page11"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.451810.3Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,10:28%,25:34%Find This Popular Motion Xtreme 500 Wrestling Trophy At TrophyCentral. The Price Of Each Motion Xtreme 500 Wrestling Trophy Includes Engraving.moxtwrtr04-10-2015Wrestling, Sportscustom-pagetrophies-soccer1trophies465713-410.451810.3Tower RibbonTrophiesSports, Hobby, Org, Livestock1"Soccer Trophies"Motion Xtreme 5" Girl's Soccer Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sports11Shop for Motion 500 Series Trophies at TrophyCentral. Each trophy measures 5" tall and includes personalization. Fast 2-3 day shipping!111Shop for Motional Xtreme 700 Series trophies at TrophyCentral. Each trophy includes free personalization. Fast 2-3 day shipping!1custom-pagetrophies-golf1"2-3 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.451613.1Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,100:29%"Golf Trophies"Motion Xtreme Series Trophy - Golf (Male). Ideal for leagues, schools, and tournaments. Fast shipping.mxx0304-20-2021Golf, Sportscustom-pagefield-day-templatesgreat-job-mcgreat-job-mc-prexcellence-mcexcellence-mc-prexcellence-jigfgreat-job-jigfexcellence-jibfgreat-job-jibfexcellence-jisfgreat-job-jisftm9964gmost-improved-jigfmost-improved-jisfmost-improved-jibfmost-improved-mcmost-improved-mc-prtm9789tm9886tm9711tm97001achievement-medals1Find motivational medals discounted at TrophyCentral. Choose from subjects such as Great Job, Most Improved and many more. Each medal features a free neck ribbon.medals-generalShop With Ease for Custom Motivational Medals Motivational award medals serve as powerful symbols of recognition and encouragement, inspiring individuals to reach new heights of achievement. The Excellence medal celebrates outstanding performance, emphasizing the pursuit of perfection and dedication to one's craft. The MVP medal, on the other hand, honors the most valuable player, acknowledging the exceptional contributions and leadership that elevate a team. Lastly, the Great Job medal commends consistent hard work and commitment, reminding recipients that even small victories and daily efforts are deserving of acclaim. These medals, with their unique significance, not only boost morale but also ignite a desire to excel and continually strive for greatness. If you have any question regarding our motivational medals and awards, please contact our experts in Michigan and New York.]]>custom-pagecertificatesbstick8bstick9bstick10bstick2bstick5bstick4bstick7bstick3bstick1bstick611Find Motivational Stickers discounted at TrophyCentral. Each sticker features a unique colorful design and is available in rolls of 500.medals-general1"1 - 2 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"290631-2816.4511school-stickers-allcustom-pagetrophies-go-kartmost-improved-part-imost-improved-single-imost-improved-champ-imost-improved-plaque-imost-improved-e-single-imost-improved-e-part-igreat-job-plaque-igreat-job-part-igreat-job-single-iblank-part-iblank-single-iblank-champ-igreat-job-champ-igreat-job-e-part-igreat-job-e-single-iexcellence-e-part-iexcellence-single-iexcellence-e-single-iexcellence-part-icup-great-job-scb-icup-excellence-incup-great-job-incup-most-improved-inexcellence-champ-i1achievement-trophies-awards1Find motivational trophies discounted at TrophyCentral. Here you will find subjects such as most improved, excellence and great job. Each motivational trophy includes personalization.star-trophies first-place-ribbonscustom-pagetrophies-bicycle-cyclingqtmotorncqtmotorscqtmotordmqtmotoryrqtmotorplqtmotorttqtmotorttwqtmotor3cqtmotoperpmqtmotorscbcup-motor-scbcup-motor-p1trophies1Find motocross trophies discounted at TrophyCentral. Each motocross trophy includes free engraving. Fast 1-2 day shipping.

Custom Motocross Trophies and Awards

TrophyCentral has an industry-leading selection of Motocross Trophies. Our motocross racing trophies are available in many styles, including: our popular Motocross Participation Trophies and Champion Award with a Motocross Figure. All of our trophies include up to three lines of FREE PERSONALIZATION (larger motocross awards include additional lines).
]]>
custom-pageholographic-insert-plaques1"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498852-310.45811.6Quick TrophyPlaquesInsert1:14%,3:14%See this stunning Motocross plaque and other Holographic Plaques at TrophyCentral.qsinplaqmotocrossMotocross, Sportscustom-pagetrophies-motocross1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%,25:23%,50:29%,100:34%Our popular Motocross participation trophies feature a real slant-front marble base and free engraving.qtmotorncMotocross, Sportscustom-pagetrophies-motocross1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular motocross figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!qtmotorplMotocross, 1st / 2nd / 3rd / Etc., Sportscustom-pagetrophies-motocross1trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find these popular Motocross year trim trophies discounted at TrophyCentral. Available in multiple sizes and includes free personalization.qtmotoryrMotocross, Sportscustom-pagebottles-st80"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14144023.2Glass AmericaPromotional ProductsSports / Water Bottles1:14%,640:38%Mountaineer Collection - Green from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.71079Sports / Water Bottlescustom-pagebottles-st80"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14144018Glass AmericaPromotional ProductsSports / Water Bottles1:14%,640:38%"Basketball Water Bottles" "Logo Sports Bottles" "Sports Bottles" "Promotional Sports Bottles" "Aluminum Sports Bottles" "Stainless Water Bottles" "Aluminum Water Bottles" "Bike Water Bottles" "Bicycle Water Bottles" "Baseball Water Bottles" "Football Water Bottles" "Promotional Water Bottles" "Soccer Water Bottles"Mountaineer Collection - Red from TrophyCentral.71076Sports / Water Bottlescustom-pagebottles-st80"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14144018Glass AmericaPromotional ProductsSports / Water Bottles1:14%,640:38%"Basketball Water Bottles" "Logo Sports Bottles" "Sports Bottles" "Promotional Sports Bottles" "Aluminum Sports Bottles" "Stainless Water Bottles" "Aluminum Water Bottles" "Bike Water Bottles" "Bicycle Water Bottles" "Baseball Water Bottles" "Football Water Bottles" "Promotional Water Bottles" "Soccer Water Bottles"Mountaineer Collection - Silver from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.71070Sports / Water Bottlescustom-pagebottles-st80"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14144023.2Glass AmericaPromotional ProductsSports / Water Bottles1:14%,640:38%Find these Blue Mountaineer Collection Custom Water Bottles discounted at TrophyCentral. Price includes a 1-color, 1-side imprint.71084Sports / Water Bottlescustom-pageawri11"5-7 business days" "Topeka, Indiana" "UPS (Priority Mail also available)"medals465715-71 260.4620016.46Tower RibbonRibbonsAwareness Ribbons1:22%,50:36%"Customized Ribbons" "Black Ribbons"Find mourning ribbons discounted at TrophyCentral. Each black mourning ribbon features choice of backing and optional imprint.blmoriMourningcustom-page11Multi Add Test at TrophyCentral.1custom-pagecustompennants1110-1411 2 3 4 5 6 7 8 9PepcoCustom Pennants1Use this link if your pennant flag artwork has more than one color. Artwork and logos can include up to 4 colors. TrophyCentral is a Top-Rated Yahoo Merchant.1111Displays to GoDisplay CasesAcrylic Displays1Multi-Tier Advertising Holders: Setup Charge For Imprint/Logo1custom-pagecrystalcups1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"general410187-1010.45448.45JcharlesCrystal Awards1:22%,25:24%"Team Award" "Team Awards" "Team Trophy" "Team Trophies" "Team Trophies and Awards"Generalcustom-pagemusic-certificate-templatesscoolribbonsfunribbonsqtdogmusc1trophies1"Music Awards" "Trophies"Shop for Custom Music Trophies and Awards with Ease at Trophy Central

Trophy Central has a great selection, low prices, and top-rated customer service. Our experts in New York and Michigan have provided help and guidance since 1999! They are would be happy to help you, too.

If you need help before deciding, see our expert resource section:

Also see:

FAQ's

What types of music awards do you offer?

We offer music medals, trophies, plaques, and certificates for all instruments and performers’ achievements, including piano, choir, band, and general musician recognition. Many trophies feature a music note to highlight musical excellence, and they’re perfect for recital moments and year-end ceremonies.

What metal finishes are available for these medals?

Most music plaques and medals come in gold, silver, and bronze finishes to denote 1st to 3rd places. Some medals come in antique gold and black nickel for a vintage look.

Do you offer bulk discounts for large music programs?

Absolutely. We offer bulk discounts for schools, studios, and organizations ordering multiple awards for bands, choirs, or music competitions.

How quickly can my music awards be shipped?

Most trophies ship within 1-2 business days from our U.S. facilities, with expedited options available for urgent ceremony deadlines.

]]>
music-award-certificates star-trophies trophies
custom-pagetrophies-music12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105502-41130025Classic MedallicsInsertsMusic, Drama, Art, Dance1:22%"Award Medals" "Art / Dance / Drama Medals" "Award Medals - All Subjects" "Music Awards" "Music Medals"Buy these quality Music (497664) Inserts (Litho) at TrophyCentral. Each 2" insert can be used to create a unique plaque, medal or trophy.497664Music / Band / Chorus
custom-pagetrophies-music12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105502-41130025Classic MedallicsInsertsMusic, Drama, Art, Dance1:22%"Award Medals" "Art / Dance / Drama Medals" "Award Medals - All Subjects" "Music Awards" "Music Medals"Buy these quality Music (506605) Inserts (Litho) at TrophyCentral. Each Music (506605) Insert can be used to create a unique plaque, medal or trophy.506605Music / Band / Chorus
custom-pagetrophies-music20medals498552-40.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find these colorful Music 2" Epoxy-covered insert decals discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Music / Band / Choruscustom-pagemusicartpins1plasticpinboxvelapinbox10cl27 11diecut cl28 br572"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsMusic, Drama, Art, Dance1:22%,50:28%,100:32%,500:42%"Music Lapel Pins" "Band Lapel Pins" "Band Awards" "School Pins"Find Lyre Music pins at TrophyCentral. Each AP Series Music pin features a Lyre design and includes a clutch back.ap28Music / Band / Choruscustom-pagemusic-certificate-templates1"Download Only"free-music4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our music certificate of award template is free and designed exclusively for TrophyCentral. Measures 11 x 8 1/2 inches and can be easily downloaded and printed.music-award-templatemusic-award-521Musiccustom-pagetrophies-music12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsMusic, Drama, Art, Dance1:22%,100:28%,500:34%,1000:45%"Music Awards" "Award Medals - All Subjects" "School Medals" "Music Medals"These inexpensive 1 1/4 inch Music Medals offer a high quality, but low price for those on a tight budget.e900707-30-2021Music / Band / Chorus
custom-pagemusic-certificate-templates1"Download Only"free-music4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our music achievement certificate is a great way to recognize a talented musician or student! It's free and designed exclusively for TrophyCentral. Music achievement templates measure 11 x 8 1/2".music-templatemusic-521Achievement, Musiccustom-pagemusicartpins1plasticpinboxvelapinbox1"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsMusic, Drama, Art, Dance1:30%,50:34%,100:38%"Music Lapel Pins" "Band Lapel Pins" "Band Awards" "School Pins"Find Music Award pins discounted at TrophyCentral. Each lapel pin features a quality finish and clutch back. Be sure to browse all of our music pins and awards.br473Music / Band / Chorus11Who is the youngest Grammy winner? Not sure? Check out this fun music infographic for the answer to this and other music trivia questions.custom-pagetrophies-music12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105502-41130025Classic MedallicsInsertsMusic, Drama, Art, Dance1:22%"Band Awards" "Award Medals" "Art / Dance / Drama Medals" "Award Medals - All Subjects" "Music Awards"Buy these quality Music Band Inserts (Litho) at TrophyCentral. Each Music Band Insert can be used to create a unique plaque, medal or trophy.503131Music / Band / Chorus
custom-pagemusicartpins191070341awardcertificates11Find music certificates at TrophyCentral. Each music certificate measures 8 1/2" x 11" and is beautifully printed. Also find band, choir and other popular certificate awards.trophies-music musicartpins1custom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceCertificates / CoversEmbosser Seals1:22%,3:28%,5:31%Find these Music Certificate Seals discounted at TrophyCentral. Seals are easy to apply with a pressure-sensitive backing.803musicMusic / Band / Choruscustom-pagetrophies-music12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105502-41130025Classic MedallicsInsertsMusic, Drama, Art, Dance1:22%"Award Medals" "Art / Dance / Drama Medals" "Award Medals - All Subjects" "Music Awards" "Music Medals"Buy these quality Music Choir Inserts (Litho) at TrophyCentral. Each Music Choir Insert can be used to create a unique plaque, medal or trophy.503121Music / Band / Chorus
11Find Music Column Trophies Discounted at TrophyCentral. Each Music Column Trophy Offers a Choice of Size and Color, and Also Features Free Personalization!custom-pagemusicartpins1plasticpinboxvelapinbox1"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsMusic, Drama, Art, Dance1:30%,50:34%,100:38%"Music Lapel Pins" "Band Lapel Pins" "Band Awards" "School Pins"Find this Music Excellence pin discounted at TrophyCentral. Music Excellence and other lapel pins ship in just 1-2 business days!br572Music / Band / Choruscustom-pagekeychains21105502-40.39125035.39Classic MedallicsGiftsKeychains1:22%,10:25%,25:32%,50:39%,100:47%Find these popular Pewter Music G-Clef Key Chains at TrophyCentral; discounted prices!pk99-cmKeychainscustom-pagetrophies-music12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105502-41130025Classic MedallicsInsertsMusic, Drama, Art, Dance1:22%"Award Medals" "Art / Dance / Drama Medals" "Award Medals - All Subjects" "Music Awards"Buy these quality Music GENERAL Inserts (Litho) at TrophyCentral. Each Music GENERAL Insert can be used to create a unique plaque, medal or trophy.507394Music / Band / Chorus
custom-pagetrophies-music1medals498552-30.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Colorful Music Insert Medals Discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Music / Band / Choruscustom-pagetrophies-music1medals498552-40.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Music Insert Medals With A Personalized Front Rim Discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Music / Band / Choruscustom-pagecherry-insert-plaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these music insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Music / Band / Choruscustom-pagetrophies-music12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105502-41130025Classic MedallicsInsertsMusic, Drama, Art, Dance1:22%"Award Medals" "Art / Dance / Drama Medals" "Award Medals - All Subjects" "Music Awards"Buy these quality Music Jazz Inserts (Litho) at TrophyCentral. Each Music Jazz Insert can be used to create a unique plaque, medal or trophy.50447105-27-2011Music / Band / Chorus
custom-pagemusicartpins1plastic-pinbox-t5lapel pins498551-20.550040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find these Music Gold Enamel Lapel Pins discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.music-u-pbMusic / Band / Choruscustom-pagetrophies-music20medals498551-30.5100021TrophyCentralInsertsSports, Hobby, Org, Livestock1Find these colorful Music Lyre 2" Epoxy-covered inserts discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Music / Band / Choruscustom-pagetrophies-music50"4-6 business days" "Mount Vernon, NY" "UPS"medals105502-50.75130033.75Classic Medallicsaward-medalsMusic, Drama, Art, Dance1:22%,100:33%,300:41%"Music Medals"Find these fabulous Personalized Music Lyre Front Imprint Medals at TrophyCentral. Price includes the name of your school or organization imprinted on the front of the medal!m161Music / Band / Choruscustom-pagetrophies-music1medals498551-30.525035.5TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these colorful Music Lyre insert medals discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Music / Band / Choruscustom-pagetrophies-music1medals498551-30.525035.5TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Music Lyre insert medals with a personalized front rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Music / Band / Choruscustom-pagetrophies-music1plaques498551-311.11623.5TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these music lyre insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Music / Band / Choruscustom-pagemusicartpins1plasticpinboxvelapinbox151-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsMusic, Drama, Art, Dance1:30%,50:36%,100:39%,500:42%,1000:48%"Music Lapel Pins" "Band Lapel Pins" "Band Awards" "School Pins"Find this fabulous Music Lyre Lapel letter pin at TrophyCentralcl2806-22-2012Music / Band / Chorus
custom-pagetrophies-music12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105502-41130025Classic MedallicsInsertsMusic, Drama, Art, Dance1:22%"Award Medals" "Art / Dance / Drama Medals" "Award Medals - All Subjects" "Music Awards"Buy these quality Music Lyre Inserts (Litho) at TrophyCentral. Each Music Lyre Insert can be used to create a unique plaque, medal or trophy.50495106-25-2012Music / Band / Chorus
custom-pagetrophies-music12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105502-40.3713003.37Classic MedallicsInsertsMusic, Drama, Art, Dance1:22%"Award Medals" "Art / Dance / Drama Medals" "Award Medals - All Subjects" "Music Awards" "Music Medals"Buy these quality Mylar Music Lyre Decal Inserts at TrophyCentral. Each Music Lyre Decal can be used to create a unique plaque, medal or trophy.489768Music / Band / Chorus
custom-pagetrophies-music1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our music lyre insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Music / Band / Choruscustom-pagetrophies-music1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy music lyre insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Music / Band / Choruscustom-pagetrophies-music50"Standard Service: 8 Business Days from Receipt of Artwork, Rush Service (Extra Charge): 3 Business Days from Receipt of Artwork" "Oxnard, CA" "UPS (FedEx available on request)"medals930335-1010.630033.6Simba Calaward-medalsMusic, Drama, Art, Dance1:22%,300:40%,500:51%,1000:54%"Music Medals" "Music Awards" "Band Awards"These 2 1/2 inch custom Music Medals come with an outer-ring which allows you to add your school or league name, date and location.qcm-20Music / Band / Chorusacademic-general-medals1award-medals1Music medals in a variety of designs including musical notes and instruments. Each music medal includes a free ribbon and is a great way to recognize music students and musicians of all kinds.trophies-musicShop for Music Award Medals with Ease at TrophyCentral!

Celebrate musical excellence with our high-quality music medals and awards. Whether you are recognizing top performers in a school band, choir competition, or music festival, we have the perfect medal for every occasion.

Why Choose Our Music Medals?

  • 🏆 High-Quality, Exclusive Designs:
  • 🎼 Custom Engraving: Personalize your medal for a special touch
  • 🚚 Fast Shipping: Quick processing times to ensure you receive your awards on time.
If you need more information before deciding, see our expert resource section: Also see: ]]>
music-award-certificates
custom-pagetrophies-music1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453633.4Quick TrophyTrophiesMusic, Drama, Art, Dance1:14%,10:17%,25:23%,50:29%,100:34%"Music Trophies" "Music Trophy" "Band Awards"Our popular music participation trophies feature a real slant-front marble base and free engraving. Fast 1-2 day shipping.qtmusicncReturn to oursection for our complete selection of awards.trophies-musicMusic / Band / Choruscustom-pagetrophies-music12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105502-41130025Classic MedallicsInsertsMusic, Drama, Art, Dance1:22%"Award Medals" "Art / Dance / Drama Medals" "Award Medals - All Subjects" "Music Awards"Buy these quality Music Piano Inserts (Litho) at TrophyCentral. Each Music Piano Insert can be used to create a unique plaque, medal or trophy.504941Music / Band / Chorus
custom-pagetrophies-musicmusic-pbap28ap22ap23ap25mp2mp3mp4mp6mp7mp8mp10mp5mp9mp11mp22mp13mp12mp14mp15br571br573br473br572br570br576br586br575br578br577cl283d12-bandband-pbep81br574cl46ap61ep82ep861lapel-award-pins1"Music Awards" "Art Awards" "School Awards" "Lapel Pins" "High School Awards" "Awards For School" "Elementary School Awards" "Middle School Awards" "School Academic Awards" "Awards For Elementary School" "Awards for Middle School" "Awards for High School" "End of School Year Awards" "High School Academic Awards" "High School Awards Ceremony"Find a great selection of discounted music pins at Trophy Central. Each music pin features a clutch-back for safe attachment to clothing.trophies-musicChorus, Choir and Other Music Subject Pins Music subject pins come in a wide variety of shapes, styles and subjects. Each music lapel pin features a clutch-pin back for easy and safe attachment to clothing.

Musical Instrument Pins

If you are looking for a specific musical instrument, you have come to the right place. Above you will find Piano, Trumpet, Guitar, Violin Pins and much more. We offer FAST 1-2 day processing.

Shop for Music Pins and Awards with Confidence at TrophyCentral!

If you are looking to buy music lapel pins online, look no further! TrophyCentral has a great selection that will fit any budget. Our top-rated representatives are happy to assist you with all of your music pin needs. Our experts in New York and Michigan have been providing suggestions and guidance since 1999! To find the perfect music lapel pin, click on an image above, or for personal service, call us toll-free at 1-888-809-8800.]]>
star-pins trophies-music
custom-pagewalnut-insert-plaques1"3-6 business days with engraving, Without engraving: 1-3 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"plaques105503-610.4511222.05Classic MedallicsPlaquesInsert1:22%,3:23%,5:24%Genuine Walnut Music Plaque with 2 Inch Insert and Free Engraving.49-7664Music / Band / Choruscustom-pagecalendar-whiteboards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Music Staff Porcelain Magnetic Whiteboard with Aluminum Box Tray, 4'H x 6'W discounted at TrophyCentral.1Not Enclosed, Linedcustom-pagecalendar-whiteboards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Music Staff Porcelain Magnetic Whiteboard with Aluminum Box Tray, 4'H x 8'W discounted at TrophyCentral.1Not Enclosed, Linedcustom-pagecalendar-whiteboards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Music Staff Porcelain Magnetic Whiteboard, 4'H x 6'W discounted at TrophyCentral.1Not Enclosed, Linedcustom-pagecalendar-whiteboards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Music Staff Porcelain Magnetic Whiteboard, 4'H x 8'W discounted at TrophyCentral.1Not Enclosed, Linedcustom-pagetrophies-music1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-30.38150030Quick TrophyDog TagsMusic, Drama, Art, Dance1:14%,10:15%Find these music dog tags discounted at TrophyCentral. The price of each music dog tag includes custom engraving and chain!qtdogmuscMusic / Band / Choruscustom-pagetrophies-music1498551-324751Music Place Trim Trophy (1st, 2nd, 3rd). Ideal for school events and competitions. Fast shipping.custom-pagetrophies-music1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesMusic, Drama, Art, Dance1:14%,10:18%,50:22%,100:25%"Music Trophies" "Music Trophy"This popular Music Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!qtmusicyrMusic / Band / Choruscustom-pagecoaching-teaching-guides11Creative music award ideas with engraving examples for bands, choirs, and music programs. From Maestro in Training to Practice Room Champion, discover 15+ unique ways to recognize musicians with actual trophy wording templates.custom-pagetrophies-music1498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Find this budget musical note award trophy discounted at Trophy Central. Features a real marble base and plastic musical note figure. Engraving is free. Fast 1-2 day shipping.1trophies-musicMusic / Band / Choruscustom-pagetrophies-music1trophies498551-311821.06TrophyCentraltrophies1Music / Band / Choruscustom-pagemascotpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:30%,100:33%,500:47%"Mascot Awards" "Mascot Pins"Find these Mustang Lapel Pins and other colorful mascot pins at TrophyCentral. Fast 1-2 day shipping!em0811-20-2013Mascotcustom-pagemascotpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:36%,100:46%,500:52%"Mascot Awards"Find These Mustang Lapel Pins with Antique Finish Discounted at TrophyCentral! Also See Our Other Fabulous School Mascot Pins. Fast 1-2 Day Shipping!pm24Mascotcustom-pagemascot-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Mustang Mascot Badges Discounted At TrophyCentral.mascotbadges-mustangcustom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceCertificates / CoversEmbosser Seals1:22%,3:28%,5:31%Find these Mustang Certificate Seals discounted at TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.803mstgMascotcustom-pagemascottrophies1"4-6 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511016.25Classic MedallicsTrophiesAcademic1:22%,5:24%,10:28%,50:32%"Mascot Awards"Buy this Mustang mascot trophy and other mascot awards at TrophyCentral.mt201204-01-2018Mascotcustom-pagemascot-plaques1plaques498552-41JDSPlaques1Find this mustang plaque discounted at TrophyCentral. Our mustang mascot plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Mascotcustom-pagemascotinserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsMascots1Buy these quality Mustangs Mascot Medal Inserts at TrophyCentral. Each Mustangs Insert can be used to create a unique plaque, medal or trophy.489945Mascot
custom-pagemvp-medals1trophies498551-30.5100021TrophyCentralInsertsSports, Hobby, Org, Livestock1Find these colorful MVP 2" Epoxy-covered insert stickers discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.MVP, Sportscustom-pagemvp-trophies1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy MVP column insert trophy features a choice of column color, a marble base and free trophy engraving.MVP, Sportscustom-pagemvp-medals1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these MVP Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.MVP, Sportscustom-pagemvp-medals1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these MVP Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.MVP, Sportscustom-pagemvp-medals1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these MVP Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.MVP, Sportscustom-pagemvp-medals1medals498551-30.525035.5TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these colorful MVP insert medals discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Most Improvedcustom-pagemvp-medals1medals498551-30.525035.5TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these MVP insert medals with a personalized front rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Most Improvedcustom-pagemvp-trophies1plaques498551-311.1Plaques1Find these MVP insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.MVP, Sportscustom-pagemvp-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Sports Medals"Your athletes will love these colorful Mylar MVP Medals from TrophyCentral. Each MVP medal includes a neck ribbon!tm9965gSports
custom-pagemvp-trophiesmvp-jigfmvp-jisfmvp-jibfmvp-mcmvp-mc-prtm9965g11Find MVP medals discounted at TrophyCentral. Each medal features a free neck ribbon. Browse our most valuable player medals now!mvp-trophies all-star-trophiescustom-pagemvp-trophies1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our MVP insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.MVP, Sportscustom-pagemvp-trophies1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our MVP single column insert trophy features a choice of column color, a marble base and free trophy engraving.MVP, Sportscustom-pagetrophies-hockey-goaliemvp-part-imvp-single-imvp-champ-imvp-e-part-imvp-e-single-imvp-plaque-icup-mvp-scb-icup-mvp-in1achievement-trophies-awards1Find MVP trophies discounted at TrophyCentral. Each MVP trophy features 3 lines of personalization. Fast 1-2 day shipping.mvp-medals all-star-medalscustom-pagemvp-trophies1trophies498551-311821.06TrophyCentraltrophies1MVP, Sportscustom-pagekeychains21105502-40.39125035.39Classic MedallicsGiftsGeneral Gifts1:22%,10:25%,25:32%,50:39%,100:47%Find these popular Pewter My Guardian Angel Key Chains at TrophyCentral; discounted prices!pk82-cm12-20-2040General Giftscustom-pagetrophies-bowling12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Mylar Bowling Inserts Medal Decal Inserts at TrophyCentral. Each Mylar Bowling Inserts Medal Decal can be used to create a unique plaque, medal or trophy.48969003-21-2014Bowling
custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Mylar Softball Decal Inserts at TrophyCentral. Each decal can be used to create a unique plaque, medal or trophy.489634Softball, Sports
custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Swimming Awards"Buy these quality Mylar Swimming Medal Decal Inserts at TrophyCentral. Each decal can be used to create a unique plaque, medal or trophy.489645Swimming / Diving, Sports
custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Mylar Wrestling Decal Inserts at TrophyCentral. Each wrestling decal can be used to create a unique plaque, medal or trophy.489623Wrestling, Sports
custom-pagetrophies-music102-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.5115014Classic Medallicsaward-medalsAcademic1:22%,25:24%,50:30%,100:36%,500:42%"School Medals" "School Award Medals" "Scholastic Medals" "Scholastic Award Medals" "Academic Medals" "Academic Award Medals" "Medals, School"Your students will love these colorful Mylar Music Medals from TrophyCentral. Each Mylar Music medal includes a neck ribbon!tm9768Music / Band / Chorus
custom-pageglass-crystal-awards1"14 business days" "Erlanger, KY" "UPS"general410187-1010.451 2 3 4 5 6 7 8 9438.45JcharlesGeneral Awards1:22%,25:24%Find these Mythic Recognition Awards at TrophyCentral. See all of TrophyCentral's Awards and Personalized Gifts.custom-pageletter-shaped-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find these popular N-shaped custom mascot badges at TrophyCentral. Great for fundraising! TrophyCentral is a top-rated Yahoo merchant.letterbadges-ncustom-pagename-desk-signsplasennambadnamebadges1etsatbrasnametluggolbagtname-badges-tags1tagsbadges1Find name badges discounted at TrophyCentral. Each name badge features beautiful custom engraving.

Uniform & Name Tags Your Employees Will Love!

Each badge & tag above features free text engraving. You can even add a logo to improve your brand image! Many also offer a choice of size, color and lettering. Choose from a pin or magnet back.

Shop Online with Ease at TrophyCentral

If you need help with a design, our experts in Michigan and New York would be thrilled to assist you. They have been serving happy customers since 1999!


]]>
name-desk-signs
flplwflexiplates1flexiplates21498551Find engraved name plates discounted at TrophyCentral. Each name plate is personalized with your text engraving. Choose from a variety of sizes and colors. 1

Custom Engraved Plates for Every Occasion

If you need to create, design or replace a name plate, you have come to the right place! Our engraving experts in New York and Michigan have been giving suggestions and guidance since 1999!

Our Beautiful Plates are Laser Engraved

Most customers prefer the darker nature of what looks like direct printing, but is really laser engraving. In this process, a two color plate is used. The outer color, and a second color that is behind it, which is only revealed when the first layer is removed by a laser.

Shop with Trust and Ease at TrophyCentral!

If you are shopping online, look no further! TrophyCentral has a great selection that will fit any budget, all at discounted prices.

]]>
custom-pageribbons-neck-drapejumpringshofordrri10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"ribbons105502-30.3612006.36Classic Medallicsribbons1:22%,100:29%,500:36%See all of ourin a variety of styles.Red White Blue, Patrioticcustom-pageracingdisplays1"7-10 business days w/Logo, 4-6 without" "Apopka, FL 32712" "UPS (FedEx available on request)"327765-101 3 22 23118Perfect CaseDisplay Cases11:14%,5:20%Nascar 1/24th Glass Display Cases from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality National Guard Inserts at TrophyCentral. Each National Guard Insert can be used to create a unique plaque, medal or trophy.514032Military, Hero, National Guard
custom-pageblog-trophycentral11custom-pagemascot-plaques1plaques498552-41JDSPlaques1Find this Native American plaque discounted at TrophyCentral. Our mascot plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Mascotcustom-pageeagle-trophies1"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"trophies458221510.45639.45Vision AwardsTrophies1:22%,26:33%Find The Natural Leadership Eagle Award Discounted At TrophyCentral. Available In 3 Sizes; Price Includes Engraving!1001custom-pageengraved-frames1"3-4 business days" "Medina, MN" "UPS"personalized gifts553404-70.51832.9JDSGiftsEngraved Frames1:22%Custom Frames, Nature's Song Picture Frames from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.gc738Engraved Frames100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)""PT2=7745310-14125016.5PepcoPromotional ProductsSports / Water Bottles1:14%,250:21%,500:31%,1000:45%,2500:49%Navy Blue Custom Sports Bottles from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.sportsbottles-navySports / Water Bottlescustom-pagetrophies-military-hero1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511230.45Classic MedallicsTrophiesHero1:22%,6:23%,12:24%,24:26%"Hero Awards"Shop for Cast Stone Navy Emblem Awards at TrophyCentral. We have a great selection of Navy Emblem and other recognition trophies at discounted prices.tr9931Military, Navy, Herocustom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality Navy Recruiting Command Inserts at TrophyCentral. Each Navy Recruiting Command Insert can be used to create a unique plaque, medal or trophy.512721Military, Hero, Navy
custom-pageaward-ribbons-rosettesnecrib30x78necrib30x138draprib138x1jumpringshofordrri11Find neck ribbons and drape ribbons for award medals discounted at TrophyCentral. Choose from many colors and sizes. Fast 1-2 day shipping.custom-pagebadgeribbonsholders1"7-10 business days from receipt of camera-ready artwork" "City of Industry, CA" "UPS (FedEx available on request)"917457-10146022.6BNRibbonsBadge Holders1nw-3633nblcustom-pagebadgeribbonsholders1"7-10 business days from receipt of camera-ready artwork" "City of Industry, CA" "UPS (FedEx available on request)"ribbons917457-10146022.6BNRibbonsBadge Holders1custom-page11custom-pagecrystalgifts1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"general410187-1010.45436.45JcharlesCrystal AwardsClocks1:22%,25:24%"crystal awards" "sales awards" "service awards" "corporate sales awards" "corporate service awards" "sales award" "service award" "corporate sales award" "corporate service award" "Desk Clocks" "Retirement Awards" "Retirement Plaques, Awards and Gifts"Neo-Metro Clock from TrophyCentral. See our great selection of engraved and personalized gifts!60611custom-pagemedallion-inserts-government-agencies-and-logos12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%"Award Medals" "Award Medals - All Subjects" "Medals - All Others"Buy these high-quality New York City Seal Inserts at TrophyCentral. Each New York City Seal Insert can be used to create a unique plaque, medal or trophy.517635General
11custom-pagecalendar-whiteboards14512310-171 3 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Nexus Double Sided Portable Whiteboard Tablet, 1 Board, 28"H x 28"W discounted at TrophyCentral.1custom-pagecalendar-whiteboards14512310-171 3 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Nexus Double Sided Portable Whiteboard Tablet, 4 Boards, 28"H x 28"W discounted at TrophyCentral.1custom-pageghent-new-mobile-boards1Bulletin Boards4512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Nexus Easel+, Mobile 2-Sided Porcelain Magnetic Whiteboard with Tablet Storage, 39"H x 26"W discounted at TrophyCentral.Mobile, Easelcustom-pageghent-new-mobile-boards1Bulletin Boards4512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Nexus Easel, Mobile 2-Sided Porcelain Magnetic Whiteboard, 46"H x 34"W discounted at TrophyCentral.Mobile, Easelcustom-pageghent-new-mobile-boards1Bulletin Boards4512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Nexus IdeaWall, Mobile 2-Sided Porcelain Magnetic Whiteboard, 46"H x 70"W discounted at TrophyCentral.Mobile, Easelcustom-pageghent-new-partitions14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Nexus Jr. Partition, Mobile 2-Sided Fabric Bulletin Board, 46"H x 34"W, Beige discounted at TrophyCentral.1nex223ffp-91Mobilecustom-pageghent-new-partitions14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Nexus Jr. Partition, Mobile 2-Sided Fabric Bulletin Board, 46"H x 34"W, Black discounted at TrophyCentral.1nex223ffp-91Mobilecustom-pageghent-new-partitions14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Nexus Jr. Partition, Mobile 2-Sided Fabric Bulletin Board, 46"H x 34"W, Blue discounted at TrophyCentral.1nex223ffp-91Mobilecustom-pageghent-new-partitions14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Nexus Jr. Partition, Mobile 2-Sided Fabric Bulletin Board, 46"H x 34"W, Gray discounted at TrophyCentral.1nex223ffp-91Mobilecustom-pageghent-new-partitions14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Nexus Jr. Partition, Mobile 2-Sided Fabric Bulletin Board, 46"H x 34"W, Red discounted at TrophyCentral.1nex223ffp-91Mobilecustom-pageghent-new-partitions14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Nexus Jr. Partition, Mobile 2-Sided Fabric Bulletin Board, 46"H x 34"W, Taupe discounted at TrophyCentral.1nex223ffp-91Mobilecustom-pageghent-new-partitions14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Nexus Jr. Partition, Mobile 2-Sided Fabric Bulletin Board, 46"H x 34"W, Teal discounted at TrophyCentral.1nex223ffp-91Mobilecustom-pageghent-new-partitions14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Nexus Jr. Partition, Mobile 2-Sided Porcelain Magnetic Whiteboard, 46"H x 34"W discounted at TrophyCentral.1Mobilecustom-pageghent-new-partitions14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Nexus Jr. Partition, Mobile 2-Sided Porcelain Magnetic Whiteboard/ Fabric Bulletin Board, 46"H x 34"W, Beige discounted at TrophyCentral.1nex223mfp-90Mobilecustom-pageghent-new-partitions14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Nexus Jr. Partition, Mobile 2-Sided Porcelain Magnetic Whiteboard/ Fabric Bulletin Board, 46"H x 34"W, Black discounted at TrophyCentral.1nex223mfp-90Mobilecustom-pageghent-new-partitions14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Nexus Jr. Partition, Mobile 2-Sided Porcelain Magnetic Whiteboard/ Fabric Bulletin Board, 46"H x 34"W, Blue discounted at TrophyCentral.1nex223mfp-90Mobilecustom-pageghent-new-partitions14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Nexus Jr. Partition, Mobile 2-Sided Porcelain Magnetic Whiteboard/ Fabric Bulletin Board, 46"H x 34"W, Gray discounted at TrophyCentral.1nex223mfp-90Mobilecustom-pageghent-new-partitions14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Nexus Jr. Partition, Mobile 2-Sided Whiteboard/Fabric Bulletin Board, 46"H x 34"W, Red discounted at TrophyCentral.1nex223mfp-90Mobilecustom-pageghent-new-partitions14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Nexus Jr. Partition, Mobile 2-Sided Whiteboard/Fabric Bulletin Board, 46"H x 34"W, Taupe discounted at TrophyCentral.1nex223mfp-90Mobilecustom-pageghent-new-partitions14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Nexus Jr. Partition, Mobile 2-Sided Whiteboard/Fabric Bulletin Board, 46"H x 34"W, Teal discounted at TrophyCentral.1nex223mfp-90Mobilecustom-pageghent-new-partitions14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Nexus Partition, Mobile 2-Sided Fabric Bulletin Board, 46"H x 34"W, Red discounted at TrophyCentral.1nex224ffp-96Mobilecustom-pageghent-new-partitions14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Nexus Partition, Mobile 2-Sided Fabric Bulletin Board, 46"H x 34"W, Taupe discounted at TrophyCentral.1nex224ffp-96Mobilecustom-pageghent-new-partitions14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Nexus Partition, Mobile 2-Sided Fabric Bulletin Board, 46"H x 34"W, Teal discounted at TrophyCentral.1nex224ffp-96Mobilecustom-pageghent-new-partitions14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Nexus Partition, Mobile 2-Sided Fabric Bulletin Board, 65"H x 46"W, Beige discounted at TrophyCentral.1nex224ffp-96Mobilecustom-pageghent-new-partitions14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Nexus Partition, Mobile 2-Sided Fabric Bulletin Board, 65"H x 46"W, Black discounted at TrophyCentral.1nex224ffp-96Mobilecustom-pageghent-new-partitions14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Nexus Partition, Mobile 2-Sided Fabric Bulletin Board, 65"H x 46"W, Blue discounted at TrophyCentral.1nex224ffp-96Mobilecustom-pageghent-new-partitions14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Nexus Partition, Mobile 2-Sided Fabric Bulletin Board, 65"H x 46"W, Gray discounted at TrophyCentral.1nex224ffp-96Mobilecustom-pageghent-new-partitions14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Nexus Partition, Mobile 2-Sided Porcelain Magnetic Whiteboard, 65"H x 46"W discounted at TrophyCentral.1Mobilecustom-pageghent-new-partitions14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Nexus Partition, Mobile 2-Sided Porcelain Magnetic Whiteboard/ Fabric Bulletin Board, 65"H x 46"W, Beige discounted at TrophyCentral.1nex224mfp-91Mobilecustom-pageghent-new-partitions14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Nexus Partition, Mobile 2-Sided Porcelain Magnetic Whiteboard/ Fabric Bulletin Board, 65"H x 46"W, Black discounted at TrophyCentral.1nex224mfp-91Mobilecustom-pageghent-new-partitions14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Nexus Partition, Mobile 2-Sided Porcelain Magnetic Whiteboard/ Fabric Bulletin Board, 65"H x 46"W, Blue discounted at TrophyCentral.1nex224mfp-91Mobilecustom-pageghent-new-partitions14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Nexus Partition, Mobile 2-Sided Porcelain Magnetic Whiteboard/ Fabric Bulletin Board, 65"H x 46"W, Gray discounted at TrophyCentral.1nex224mfp-91Mobilecustom-pageghent-new-partitions14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Nexus Partition, Mobile 2-Sided Whiteboard/Fabric Bulletin Board, 46"H x 34"W, Red discounted at TrophyCentral.1nex224mfp-91Mobilecustom-pageghent-new-partitions14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Nexus Partition, Mobile 2-Sided Whiteboard/Fabric Bulletin Board, 46"H x 34"W, Taupe discounted at TrophyCentral.1nex224mfp-91Mobilecustom-pageghent-new-partitions14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Nexus Partition, Mobile 2-Sided Whiteboard/Fabric Bulletin Board, 46"H x 34"W, Teal discounted at TrophyCentral.1nex224mfp-91Mobile11Find office partitions discounted at TrophyCentral. Each partition is mobile. Styles include whiteboards and cork boards - perfect for schools and offices. Made in the US by Ghent.custom-pagemagnetic-dry-erase-boards145123110-171 3 4 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Nexus Porcelain Magnetic Whiteboard, 3'H x 4'W discounted at TrophyCentral.1custom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Nexus Porcelain Magnetic Whiteboard, 4'H x 6'W discounted at TrophyCentral.1custom-pagegifts-desk-general11personalized gifts105502-410.5217210.6Classic MedallicsGiftsGeneral Gifts1:22%,10:20%Shop for Nickel Plated Money Clip from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.Walletscustom-pagecrystalgifts1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"personalized gifts410187-1010.45525.45JcharlesGiftsCrystal Gifts1:22%,100:23%"personalized gifts"Find these fabulous Custom Clocks discounted at TrophyCentral. TrophyCentral is known for its top-rated customer serviceCrystal Gifts1]]>1custom-pageteacher-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"Find these No Child Left Behind pins discounted at TrophyCentral. Lapel pins feature a high quality finish and clutch back, Fast 1-2 day shipping.br531General, Academic, Academiccustom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-411130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these high-quality No Child Left Behind Inserts at TrophyCentral. Each No Child Left Behind Insert can be used to create a unique plaque, medal or trophy.518482General, Academic, Academic
custom-pagerlogonov-13podium-artworkartworkstocksportgraphicsmonarch-basesmmp-norwichsponsoredbytctrophyfigure2trophycentral-reviews-allsatisfactionembosser-logostrophyfigures1podium-shippingartworkhelpleatherhelpdisplaycase-shippingaugustacolorsgildan2000colorsbadge-holder-popupengravinghtrophycentral-reviewsplaque-proofminutemanmmp-sl-forestindlogopressclicherforlo9test1clicherforlo8art-workcltoenstlopicorporate-awards-artprintexamplesclicherforpi10boxsampleseconribbonnotchcornerstm-series-medalsmedals-tm-seriestm-sports-medalstestimonialsshipping-estimateperpetualtrophiesenbabate-medals-allplasticpinbox1notchcorners1clicherforlo11clicherforlo11templateship-countdownconfidenceunique-copyquickshiptrophies-boccesplitrinkeycvelboxclicon1cliconpictoe61]]>11custom-pagescholarship-resource-hub11Nomination letter templates for teachers recognizing students for scholarships and awards. Includes ready-to-use formats for academic achievement, leadership and more!custom-pagenon-magnetic-boards14512310-171 3 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Non-Magnetic Whiteboard with Aluminum Frame, 18"H x 24"W discounted at TrophyCentral.1Not Enclosedcustom-pagenon-magnetic-boards14512310-171 3 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Non-Magnetic Whiteboard with Aluminum Frame, 2'H x 3'W discounted at TrophyCentral.1Not Enclosedcustom-pagenon-magnetic-boards145123110-171 3 4 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Non-Magnetic Whiteboard with Aluminum Frame, 3'H x 4'W discounted at TrophyCentral.1Not Enclosedcustom-pagenon-magnetic-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Non-Magnetic Whiteboard with Aluminum Frame, 3'H x 5'W discounted at TrophyCentral.1Not Enclosedcustom-pagenon-magnetic-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Non-Magnetic Whiteboard with Aluminum Frame, 4'H x 12'W discounted at TrophyCentral.1Not Enclosedcustom-pagenon-magnetic-boards14512317-101 3 4 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Non-Magnetic Whiteboard with Aluminum Frame, 4'H x 4'W discounted at TrophyCentral.1Not Enclosedcustom-pagenon-magnetic-boards14512317-101 3 4 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Non-Magnetic Whiteboard with Aluminum Frame, 4'H x 5'W discounted at TrophyCentral.1Not Enclosedcustom-pagenon-magnetic-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Non-Magnetic Whiteboard with Aluminum Frame, 4'H x 6'W discounted at TrophyCentral.1Not Enclosedcustom-pagenon-magnetic-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Non-Magnetic Whiteboard with Aluminum Frame, 4'H x 8'W discounted at TrophyCentral.1Not Enclosedcustom-pagenon-magnetic-boards14512310-171 3 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Non-Magnetic Whiteboard with Wood Frame, 18"H x 24"W discounted at TrophyCentral.1Not Enclosedcustom-pagenon-magnetic-boards14512310-171 3 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Non-Magnetic Whiteboard with Wood Frame, 2'H x 3'W discounted at TrophyCentral.1Not Enclosedcustom-pagenon-magnetic-boards145123110-171 3 4 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Non-Magnetic Whiteboard with Wood Frame, 3'H x 4'W discounted at TrophyCentral.1Not Enclosedcustom-pagenon-magnetic-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Non-Magnetic Whiteboard with Wood Frame, 3'H x 5'W discounted at TrophyCentral.1Not Enclosedcustom-pagenon-magnetic-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Non-Magnetic Whiteboard with Wood Frame, 4'H x 4'W discounted at TrophyCentral.1Not Enclosedcustom-pagenon-magnetic-boards14512317-101 3 4 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Non-Magnetic Whiteboard with Wood Frame, 4'H x 5'W discounted at TrophyCentral.1m2w-45-4Not Enclosedcustom-pagenon-magnetic-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Non-Magnetic Whiteboard with Wood Frame, 4'H x 6'W discounted at TrophyCentral.1m2w-45-4Not Enclosedcustom-pagenon-magnetic-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Non-Magnetic Whiteboard with Wood Frame, 4'H x 8'W discounted at TrophyCentral.1Not Enclosedcustom-pageghent-new-whiteboardsm2-18-1m2w-18-1m2-23-1m2w-23-1m2-34-1m2w-34-1m2w-44-4m2-35-4m2-44-4m2w-35-4m2-45-4m2w-45-4m2-46-4m2w-46-4m2-48-4m2w-48-4m2-412-411Find non-magnetic whiteboards discounted at TrophyCentral. Each non-magnetic board is made in the US.1noindexed-items12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
498555-8.521
noindexed-items12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
498555-8.521
custom-pagefloating-plaques1"14 business days" "Erlanger, KY" "UPS"plaques410187-1010.451 2 3 4 5 6 7 8 9416.45JcharlesGeneral Awards1:22%,25:25%Find the Nova Plaque at TrophyCentral. Nova Plaques include free engraving.custom-pagequickshiptrophies-fireman1plaques498552-41JDSPlaques1Find this nurse plaque discounted at TrophyCentral. Our nurse plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Military / Herocustom-pagemedallion-inserts-occupational-subjects12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-410.311500240.3Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these high-quality Nurses Caduceus Inserts at TrophyCentral. Each Nurses Caduceus Insert can be used to create a unique plaque, medal or trophy.515873
custom-pagebr6421personalized gifts105502-40.39125035.39Classic MedallicsGiftsKeychains1:22%,10:25%,25:32%,50:39%,100:47%Find these popular Pewter Nurses Care Key Chains at TrophyCentral; discounted prices!pk89-cmKeychainscustom-pagegold-pins-lapelplasticpinboxvelapinbox10105502-30.31150030.3Classic Medallicslapel-award-pins11:22%,50:30%,100:33%,500:47%Find These Nurses Care Pins Discounted at TrophyCentral. Each Nurses Care Pin Features a Clutch-Back. Fast 1-2 Day Shipping!Nurse-CareOccupations, Nursingcustom-pagegold-pins-lapelplasticpinboxvelapinbox10br645 pk89-cm105502-30.31150030.3Classic Medallicslapel-award-pins11:22%,50:30%,100:33%,500:47%Find Nursing Pins discounted at TrophyCentral. Each Nursing Lapel Pin features a qualify gold finish and clutch-back. Fast 1-2 day shipping!RN-Nurses-PinOccupations, Nursingcustom-pagefreeawardcertificates1"Download Only"certificates49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Nursing Award template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Nursing-Award-Certificatenursing-freeNursing, Herocustom-pageletter-shaped-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find these popular O-shaped custom mascot badges at TrophyCentral. Great for fundraising! TrophyCentral is a top-rated Yahoo merchant.letterbadges-ocustom-pageperplaq1"4-6 business days "Marquette, MI" "UPS"perpetual plaques498553-610.45315.15JDS-TCPlaquesPerpetual Plaques1:22%"New Products"This perpetual name plaque boosts an Oak finish and 12 nameplates and is perfect for employee, athlete or student recognition. The price of the perpetual plaque includes engraving for the top plate and one nameplate.opp1209-06-2014Perpetual, Name Platecustom-pageperplaq1"4-6 business days "Marquette, MI" "UPS"perpetual plaques498553-610.45318.45JDS-SPlaquesPerpetual Plaques1:22%"New Products"This perpetual name plaque boosts an Oak finish and 18 nameplates and is perfect for employee, athlete or student recognition. The price of the perpetual plaque includes engraving for the top plate and one nameplate.opp1809-06-2014Perpetual, Name Platecustom-pageperplaq1"4-6 business days "Marquette, MI" "UPS"perpetual plaques498553-610.45321.45JDS-SPlaquesPerpetual Plaques1:22%"New Products"This perpetual name plaque boosts an Oak finish and 24 nameplates and is perfect for employee, athlete or student recognition. The price of the perpetual plaque includes engraving for the top plate and one nameplate.opp2409-06-2014Perpetual, Name Platecustom-pageacrylicawards11"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"general105503-610.451515.45Classic MedallicsCrystal Awards1:30%Shop for Obelisk Acrylic Awards at TrophyCentral; Available in multiple styles.ac26706-15-2012custom-pagecrystalgifts6"7-10 business days" "Kentucky" "UPS (FedEx available on request)"personalized gifts410187-1010.451616.45JcharlesGiftsCrystal Gifts1:22%,100:0%"personalized gifts"Oblique Crystal Card Holders from TrophyCentral. See our great selection of engraved and personalized gifts!64Crystal Giftscustom-pagemusicartpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsMusic, Drama, Art, Dance1:22%,50:30%,100:33%,500:45%"Music Lapel Pins" "Band Lapel Pins" "Music Pins"Find These Oboe Lapel Pins Discounted at TrophyCentral. Features a Clutch-Pin Back and Fast 1-2 Day Shipping!mp3Music / Band / Choruscustom-pageinserts1culinary-ei504301517852507249518634501654518545499195011714984035185625187785014915178355158734898624934015181975066914915095140934957595185615135515170841inserts11Browse our selection of occupation subject inserts. Each 2" insert fits in a medal frame, trophy or plaque.occupation trophies, occupation trophy, occupation awards, occupation trophies and awards1inserts1custom-pagebaseballdisplay11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.5119.5Perfect CaseDisplay Cases11:14%,5:19%Octagon Batting Helmet Glass Display Cases from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.Baseball / T-Ball, Sportscustom-pagefootballdisplay11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.5116.5Perfect CaseDisplay Cases11:14%,5:19%Octagon Glass Football Display Case. Ideal for leagues, schools, and tournaments. Fast shipping.10-16-2017Football, Sportscustom-pagefootballdisplay11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.5119.5Perfect CaseDisplay Cases11:14%,5:19%Octagon Glass Football Helmet Display Case. Ideal for leagues, schools, and tournaments. Fast shipping.Football, Sportscustom-pagebaseballdisplay11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.5116.5Perfect CaseDisplay Cases11:14%,5:19%Octagon Glove Glass Display Cases from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.Baseball / T-Ball, Sportscustom-pageghent-new-whiteboardsdfp1-5747-cdfp1-5747-fpdfp1-5747-m1dfp2-5747-cdfp2-5747-fpdfp2-5747-m1dfp3-5747-cdfp3-5747-fpdfp3-5747-m1nex223ffp-90nex223mfp-90nex224ffp-90nex223mmpnex224mfp-90nex224mmpnex223mfp-96nex223ffp-91nex223ffp-93nex223ffp-95nex223ffp-96nex223ffp-97nex223ffp-98nex223mfp-91nex223mfp-93nex223mfp-95nex223mfp-97nex223mfp-98nex224ffp-91nex224ffp-93nex224ffp-95nex224ffp-96nex224ffp-97nex224ffp-98nex224mfp-91nex224mfp-93nex224mfp-95nex224mfp-96nex224mfp-97nex224mfp-98wsd2-5747-cwsd2-5747-m1cmd7438-acmd7438-gwhiteboard-divider-partitionmp5448-20mp5448-20-8amp5448-20-8fmp5448-70mp5448-8amp5448-8fmp7248-20mp7248-20-8amp7248-20-8fmp7248-70mp7248-8amp7248-8f11Find office partitions discounted at TrophyCentral. Each office partition is made in the US. Browse our large selection now!1

Office Divider Walls & Partitions

See our fabulous selection of modular and wall partitions in a huge number of styles, including:

  • Thermoplastic, Whiteboard & Bulletin Board Surfaces

  • Large Conference Room Dividers

and much more!

Trophycentral is a well-known online retailer that offers a variety of office partitions and dividers on its website. These partitions are designed to enhance privacy and create a more professional work environment. The dividers are made from high-quality materials such as glass, acrylic, fabric, and wood, and are available in various sizes and shapes to suit different office layouts and requirements. One popular type of office partition is the freestanding divider. These dividers are designed to be placed in the middle of the room, creating a separate space for individual workstations or team meetings. They are available in different heights, widths, and colors to match the decor of any office. The freestanding dividers are also easily movable, allowing for quick and convenient reconfiguration of the office layout. Another popular option is the desk divider. They are designed to be placed on top of a desk or table, providing privacy for employees who work in close proximity to one another. The desk dividers come in different sizes and materials, making it easy for users to find the right divider that fits their specific needs. They are also easy to install and remove, making them a flexible option for any office space.

Shop With Ease at TrophyCentral

We have great customer service, discounted prices and bulk discounts. Do you need help with buying a partition or room divider? Yes, we sell online, but we have real people who would love to help you! Feel free to call our customer service experts in Michigan, New York and online. TrophyCentral - delivering smiles since 1999!


]]>
custom-pageghent-new-partitions14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Floor Partition with Aluminum Frame and 2 Split Panel Infill, Porcelain and Silver Vinyl, 72"H x 48"W discounted at TrophyCentral.1Floor Partitioncustom-pageofficesigns1"9-12 business days" "Roanoke, Virginia" "UPS (FedEx available on request)"240169-1210.465025.46RoanokeOffice Signs1Find Custom Wall Signs Discounted at TrophyCentral. Wall Signs and Door Signs Include Engraving and Ship In Just a Few Days.custom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceCertificates / CoversEmbosser Seals1:22%,3:28%,5:31%Find these "Official Seal" Certificate Seals discounted at TrophyCentral. Available in rolls of 100. Fast 1-2 day shipping.803osMascot11custom-pagetrophies-cheerleading-spirit12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,50:28%,100:34%,500:41%"Award Medals - All Subjects" "Sports Medals" "Cheer Awards" "Cheerleading Awards" "Cheerleader Awards" "Cheerlading Medals"j9643See more greatin a large variety of styles and finishes.cheerleadingmedalsCheerleading, Sports
custom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.5115014Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,50:28%,100:34%,500:41%"Award Medals - All Subjects" "Sports Medals" "Track Medals"Find our Female Track Events 2" Olympic-Style J-Series Medals at a super price point at TrophyCentral. Large quantity discounts available!j9683
custom-pagetrophies-track-field1j96652-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.5115014Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,50:28%,100:34%,500:41%"Award Medals - All Subjects" "Sports Medals" "Track Medals"Find our Male Track Events 2" Olympic-Style J-Series Medals at a super price point at TrophyCentral. Large quantity discounts available!j967206-26-2009
11Check out this great Olympics infographic. Add some fun to your next awards ceremony by sharing these fun facts about the Olympics.custom-pageglobal-crystal-awards1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"general410187-1010.454100.45JcharlesCrystal Awards1:22%,25:24%"crystal awards" "sales awards" "service awards" "corporate sales awards" "corporate service awards" "sales award" "service award" "corporate sales award" "corporate service award"Find the Omni Globe and other Awards at TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.400Leadershipcustom-page1105091-311 2 3 4 5 6 7 8 91:0%One-Time Setup Charge: Visit TrophyCentral to see this and similar Trophies and Awards1111custom-pageglass-crystal-awards1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"general410187-1010.45422.45JcharlesCrystal Awards1:22%,25:24%"crystal awards" "sales awards" "service awards" "corporate sales awards" "corporate service awards" "sales award" "service award" "corporate sales award" "corporate service award"Optic Mountains from TrophyCentral. See our great selection of engraved and personalized gifts!5-20-2018Leadershipcustom-pagehigh-end-awards11"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"458221510.45434.45Vision AwardsTrophies1:22%,26:31%Find Optica Alergria Crystal Trophies from TrophyCentral; Price Includes Engraving!custom-page1"10 business days" "Aliquippa, PA" "UPS""PT1=Crystal" "PT1=Trophies" "G=Unisex" "SC2=Tennis"1500110-1410.45424.45Glass AmericaCrystal Awards1:22%,10:25%"Tennis Awards"Find These Crystal Tennis Balls Discounted At TrophyCentral. Each Optical Crystal Tennis Ball Includes Free Engraving and Gift Box!898912-20-2040Tennis, Sportscustom-pageglobal-crystal-awards11"5-10 business days w/engraving" "Mt. Vernon, NY" "UPS (FedEx available on request)"general105505-101211264.4Classic MedallicsCrystal Awards1:30%,10:40%The Optical Crystal Globe Award measures 4" high and sits on a 2" etched base. This is a perfect trophy for global organizations. The price includes 5 lines of text engraving.custom-pageglobal-crystal-awards1"5-10 business days" "Mount Vernon, NY" "UPS"general105503-610.4511213.65Classic MedallicsCrystal Awards1:22%"Crystal Awards"Shop for Optical Crystal Relief Globe from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.See more:glass-crystal-awardsLeadershipcustom-pageglass-crystal-awards1"5-10 business days" "Mount Vernon, NY" "UPS"general105503-610.4511213.65Classic MedallicsCrystal Awards1:30%"Crystal Awards"Find this Optical Cut Shooting Star Award at TrophyCentral. The Shooting Star Award Includes engraving and gift box.Star, Leadership11"5-10 business days w/engraving" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)""PT1=Crystal" "PT1=Trophies" "G=Unisex"105505-1010.45618.45Classic MedallicsCrystal Awards1:30%,5:31%"Special Picks" "General Recognition Awards" "Crystal Globe Awards" "Engraved Crystal Awards" "Crystal Star Awards" "Optical Crystal Awards" "Etched Crystal Awards" "Crystal Awards" "Corporate Crystal" "Crystal Trophies" "Crystal Award Section" "Crystal Trophy Section" "Crystal Corporate Gifts" "Crystal Corporate Awards" "Crystal Corporate Award Section" "Corporate Crystal Awards" "Crystal Trophy"Shop for Optical Cut Star from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.12-20-2040custom-page11105502-410.451824.45Classic Medallics1:22%Find this bag of 100 1/4" screws for attaching perpetual plates to plaques discounted at TrophyCentral. Fast 1-2 day shipping.custom-pagethjaglqucl114-611 2 3 4 5 6 7 8 9Classic MedallicsGiftsSetup1:0%Use this option to indicate your that you would like to incorporate a logo a artwork on your TrophyCentral award item. Adding a logo improves branding and adds a special touch.1custom-pagecalendar-whiteboards145123110-171 3 4 5 6 7 8 9 10 22 2301Bulletin Boards11Find the Ghent OR Schedule Magnetic Whiteboard, 3'H x 4'W discounted at TrophyCentral.1Not Enclosed, Healthcarecustom-pagecalendar-whiteboards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent OR Schedule Magnetic Whiteboard, 4'H x 6'W discounted at TrophyCentral.1grpm313s-46Not Enclosed, Healthcarecustom-pagecalendar-whiteboards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent OR Schedule Magnetic Whiteboard, 4'H x 8'W discounted at TrophyCentral.1grpm313s-48Not Enclosed, Healthcarecustom-pagecalendar-whiteboards145123110-171 3 4 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent OR Schedule Whiteboard, 3'H x 4'W discounted at TrophyCentral.1Not Enclosed, Healthcarecustom-pagecalendar-whiteboards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent OR Schedule Whiteboard, 4'H x 6'W discounted at TrophyCentral.1Not Enclosed, Healthcarecustom-pagecalendar-whiteboards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent OR Schedule Whiteboard, 4'H x 8'W discounted at TrophyCentral.1grpm221g-48Not Enclosed, Healthcare100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)""PT2=7745310-14125016.5PepcoPromotional ProductsSports / Water Bottles1:14%,250:21%,500:31%,1000:45%,2500:49%Orange Custom Sports Bottles from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.sportsbottles-orangeSports / Water Bottlescustom-pagemusic-certificate-templates1"Download Only"free-music4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our orchestra award certificate is free and designed exclusively for TrophyCentral. Orchestra certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.orchestra-template-design-aorchestra-a-521Music / Band / Chorus, Musiccustom-pagemusic-certificate-templates1"Download Only"free-music4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our orchestra template is free and designed exclusively for TrophyCentral. Templates measure 11 x 8 1/2 inches and can be easily downloaded and printed.orchestra-template-design-borchestra-b-521Music / Band / Chorus, Musiccustom-pageawri11"5-7 business days" "Topeka, Indiana" "UPS (Priority Mail also available)"ribbons465715-71 260.4620016.46Tower RibbonRibbonsAwareness Ribbons1:22%,50:36%Find organ donor ribbons discounted at TrophyCentral. Each green organ donor awareness ribbon features choice of backing and optional imprint.ordoawriShop for Organ Donor Ribbons with Ease at TrophyCentral TrophyCentral has a wonderful selection, discounted and bulk pricing and great customer service. Each green organ donor awareness ribbon comes with a tape or pin back and is available with optional imprinting.]]>Organ Donorcustom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these high-quality Outstanding Associate Inserts at TrophyCentral. Each Outstanding Associate Insert can be used to create a unique plaque, medal or trophy.518483Occupations
custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these high-quality Outstanding Athlete Inserts at TrophyCentral. Each Outstanding Athlete Insert can be used to create a unique plaque, medal or trophy.518189General, Outstanding Athlete
custom-pagemotivational-stickers1"1 - 2 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-21 2 3 230.451224.45Certificate SourceCertificates / CoversStickers1:22%,3:24%Find these colorful Outstanding Attendance Motivational Stickers discounted online at TrophyCentral. Fast 1-2 day shipping!bstick4Generalcustom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these quality Mylar Outstanding Attendance Decal Inserts at TrophyCentral. Each decal can be used to create a unique plaque, medal or trophy.489700Academic
custom-pageperfect-attendance-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"Find these Outstanding Attendance pins discounted at TrophyCentral. Each Outstanding Attendance pin features a quality clutch-back.br32506-15-2012Academiccustom-pageperfect-attendance-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:30%,100:33%,500:47%"School Pins" "School Lapel Pins"Outstanding Attendance Letter Pins: EC Series Outstanding Attendance Lapel Pins feature a high-quality enameled finish and ship in just 1-2 business days!ec818-21-09Academiccustom-pagemedals-general102-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.5115014Classic Medallicsaward-medalsAcademic1:22%,25:24%,50:30%,100:36%,500:42%"School Medals" "School Award Medals" "Scholastic Medals" "Scholastic Award Medals" "Academic Medals" "Academic Award Medals" "Medals, School"Your students will love these colorful Mylar Outstanding Attendance Medals from TrophyCentral. Each Outstanding Attendance medal includes a neck ribbon!tm9700General, Academic
custom-pagecitizenship-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsGeneral1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "School Medals"These inexpensive 1 1/4 inch Outstanding Citizen Medal offers a high quality, but low price for those on a tight budget.e925503-16-2009Citizenship
custom-pageschool-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:34%,100:39%,500:43%"School Pins" "School Lapel Pins"Find this Outstanding Community Service Pin at TrophyCentral. Outstanding Community Service and other pins ship in just 1-2 business days!br56707-10-2012General, Thank You, Volunteercustom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsGeneral1:22%Buy these quality Mylar Outstanding Community Service Decal Inserts at TrophyCentral. Each Outstanding Community Service Decal can be used to create a unique plaque, medal or trophy.489841Community Service
custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these high-quality Outstanding Contributor Award Inserts at TrophyCentral. Each Outstanding Contributor Award Insert can be used to create a unique plaque, medal or trophy.518693Volunteer
custom-pageawardcertificates11certificates290631-31 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,25:24%,100:40%,500:50%Find this outstanding effort certificate and other awards discounted at TrophyCentral. Outstanding effort certificates are beautifully printed; template measures 11 x 8 1/2 inches.941Academiccustom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these high-quality Outstanding Employee Inserts at TrophyCentral. Each Outstanding Employee Insert can be used to create a unique plaque, medal or trophy.518171Occupations
custom-pagecorporatepinsplasticpinboxvelapinbox5"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsBusiness1:30%,50:32%,100:35%,500:39%"Meeting or Exceeding Goals" "Employee Lapel Pins" "Corporate Lapel Pins"Find these these outstanding employee pins discounted at TrophyCentral. Each outstanding employee pin features a beautiful finish and clutch-back.br310Businesscustom-pagetrophies-volunteer1"3-6 business days with engraving, Without engraving: 1-3 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"plaques105503-610.4511219.65Classic MedallicsPlaquesInsert1:22%,3:24%,5:27%Genuine Walnut Outstanding Fundraiser Plaque with 2 Inch Insert and Free Engraving.51-fundVolunteercustom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these high-quality Outstanding Manager Inserts at TrophyCentral. Each Outstanding Manager Insert can be used to create a unique plaque, medal or trophy.518682General, Business
custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these high-quality Outstanding Member Inserts (Etched, 518159) at TrophyCentral. Each Outstanding Member Inserts (Etched, 518159) can be used to create a unique plaque, medal or trophy.518159Volunteer, Outstanding Member, Committee
custom-pagemusicartpins1plasticpinboxvelapinbox1"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsMusic, Drama, Art, Dance1:30%,50:34%,100:38%"Music Lapel Pins" "Band Lapel Pins" "Band Awards" "School Pins"Find this Outstanding Music Achievement Pin at TrophyCentral. Outstanding Music Achievement Lapel Pins feature a clutch back for easy attachment to clothing.br577Music / Band / Choruscustom-pagemusicartpins1plasticpinboxvelapinbox1"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsMusic, Drama, Art, Dance1:30%,50:34%,100:38%"Music Lapel Pins" "Band Lapel Pins" "Band Awards" "School Pins"Find this Outstanding Musician Pin at discounted at TrophyCentral. Outstanding Musician Lapel Pins feature a clutch back for easy attachment to clothing.br576Music / Band / Choruscustom-pagedramatrophies2plasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.371150030.37Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"Drama Lapel Pins" "Drama Pins" "Drama Awards"Find these Outstanding Performance pins discounted at TrophyCentral. Each of our drama pins feature a high quality finish and clutch-pin back.br587Dramacustom-pagecorporatepinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsBusiness1:30%,50:32%,100:35%,500:39%Find this Outstanding Performance Pin at TrophyCentral. Outstanding Performance and other pins ship in just 1-2 business days!br311General, Dramacustom-pageeawardmedals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsGeneral1:22%,100:28%,500:34%,1000:45%"General Award Medals" "Award Medals - All Subjects" "School Medals" "Music Awards" "General Recognition Awards" "Drama Awards"These inexpensive 1 1/4 inch Outstanding Performance Medals offer a high quality, but low price for those on a tight budget.e929207-05-2014General, Business, Academic
custom-pagemedallion-inserts-general-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals" "Art / Dance / Drama Medals" "Drama Awards" "Music Awards"Buy these quality Mylar Outstanding Performance Decal Inserts at TrophyCentral. Each Outstanding Performance Decal can be used to create a unique plaque, medal or trophy.489792Star
custom-pagemedallion-inserts-occupational-subjects12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Mylar Outstanding Poker Player Decal Inserts at TrophyCentral. Each decal can be used to create a unique plaque, medal or trophy.489862
custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these high-quality Outstanding Safety Record Inserts at TrophyCentral. Each Outstanding Safety Record Insert can be used to create a unique plaque, medal or trophy.517784General
custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these high-quality Outstanding Sales Person Inserts at TrophyCentral. Each Outstanding Sales Person Insert can be used to create a unique plaque, medal or trophy.518656Occupations, Business
custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these high-quality Outstanding Service Inserts at TrophyCentral. Each Outstanding Service Insert can be used to create a unique plaque, medal or trophy.51821412-25-2040General, Service / Retirement
custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these high-quality Outstanding Sponsor Inserts at TrophyCentral. Each Outstanding Sponsor Insert can be used to create a unique plaque, medal or trophy.518179General, Thank You, Volunteer
custom-pageachievement-certificates-awards1"Download Only"free-academic49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Outstanding Student template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Outstanding-Student-Certificateoutstanding-student-freeAcademic, Most Improvedcustom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these high-quality Outstanding Student Inserts at TrophyCentral. Each Outstanding Student Insert can be used to create a unique plaque, medal or trophy.518162General, Academic
custom-pagemedals-general102-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.5115014Classic Medallicsaward-medalsAcademic1:22%,25:24%,50:30%,100:36%,500:42%"School Medals" "School Award Medals" "Scholastic Medals" "Scholastic Award Medals" "Academic Medals" "Academic Award Medals" "Medals, School"Your students will love these colorful Mylar Outstanding Student Medals from TrophyCentral. Each Outstanding Student medal includes a neck ribbon!tm9789Academic
custom-pageeawardmedals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsAcademic1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "School Medals"These inexpensive 1 1/4 inch Outstanding Student Medals offer a high quality, but low price for those on a tight budget.e995112-10-2021Academic
custom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these quality Mylar Outstanding Student Decal Inserts at TrophyCentral. Each decal can be used to create a unique plaque, medal or trophy.489789Academic
custom-pageschool-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"Find this Outstanding Student - 3/4" Pin at TrophyCentral. Outstanding Student - 3/4" and other pins ship in just 1-2 business days!br314Academiccustom-pageschool-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:30%,100:33%,500:47%"Volunteer Items" "School Pins"Outstanding Student Letter Pins: EC Series Outstanding Student Lapel Pins feature a high-quality enameled finish and ship in just 1-2 business days!ec8312-20-2020Academiccustom-pagetrophies-academic1trophies-academictrophies105503-610.4511211.73Classic MedallicsTrophiesAcademic1:22%,10:25%,50:29%,100:34%"Honor Student Awards"Find outstanding student trophies discounted at TrophyCentral. Each trophy features free engraving. Fast 1 to 2 day shipping!schooltrophies1807-20-2010Generalcustom-pageteacher-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"Find this Outstanding Teacher Pin at TrophyCentral. Outstanding Teacher and other pins ship in just 1-2 business days!br313Academiccustom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these high-quality Outstanding Teacher Inserts at TrophyCentral. Each Outstanding Teacher Insert can be used to create a unique plaque, medal or trophy.518186General, Academic
custom-pageteacher-appreciation1"3-6 business days with engraving, Without engraving: 1-3 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"plaques105503-610.4511219.65Classic MedallicsPlaquesInsert1:22%,3:24%,5:27%"School Awards" "School Products"Genuine Walnut Outstanding Teacher Plaque with 2 Inch Insert and Free Engraving.51-8186Teacher's Awardcustom-pagevolunteer-medals20medals498552-40.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find these colorful Outstanding Volunteer 2" Epoxy-covered insert decals discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Volunteercustom-pagevolunteer-medals1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Outstanding Volunteer Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Volunteercustom-pagevolunteer-medals1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Outstanding Volunteer Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Volunteercustom-pagevolunteer-medals1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Outstanding Volunteer Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Volunteercustom-pagenew-tc-color-medals1medals498552-30.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Colorful Outstanding Volunteer Insert Medals Discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Volunteercustom-pagevolunteer-medals1medals498552-40.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Outstanding Volunteer Insert Medals With A Personalized Front Rim Discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Volunteercustom-pagetrophies-volunteer1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Volunteer insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - VolunteerVolunteercustom-pagevolunteerpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsBusiness1:30%,50:32%,100:35%,500:39%Find this Enameled Outstanding Volunteer Pin at TrophyCentral. Enameled Outstanding Volunteer and other pins ship in just 1-2 business days!br31206-30-2012Volunteer, Leadershipcustom-pagetrophies-volunteer1"3-6 business days with engraving, Without engraving: 1-3 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"plaques105503-610.4511219.65Classic MedallicsPlaquesInsert1:22%,3:24%,5:27%Genuine Walnut Outstanding Volunteer Plaque with 2 Inch Insert and Free Engraving.51-8188Volunteercustom-pagetrophies-volunteer1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Volunteer single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - VolunteerVolunteercustom-pagevolunteer-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsGeneral1:22%Buy these quality Mylar Outstanding Volunteer Work Decal Inserts at TrophyCentral. Each Outstanding Volunteer Work Decal can be used to create a unique plaque, medal or trophy.489830Volunteer
custom-pageacrylicawards11"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"general105503-610.451515.45Classic MedallicsCrystal Awards1:30%Shop for This 9" Oval Acrylic Award, and other Unique Crystal Awards, at TrophyCentral; Free Engraving.ac265custom-pagename-badges-tagswoyoulipr100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Find Oval Badges Discounted At TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.namebadges-ovlcustom-pageawri11"5-7 business days" "Topeka, Indiana" "UPS (Priority Mail also available)""1-2 business days" "Topeka, Indiana" "UPS (Priority Mail also available)""1-2 business days" "Topeka, Indiana" "UPS (Priority Mail also available)""1-2 business days" "Topeka, Indiana" "UPS (Priority Mail also available)"ribbons465715-71 260.4620016.46Tower RibbonRibbonsAwareness Ribbons1:22%,50:36%Find Ovarian Cancer Ribbons discounted at TrophyCentral. Each teal awareness ribbon features choice of backing and optional imprint.ovcariShop for Ovarian Cancer Ribbons with Ease at TrophyCentral TrophyCentral has a wonderful selection, discounted and bulk pricing and top-rated customer service. Each teal awareness ribbon comes with a tape or pin back and is available with optional imprinting.]]>Ovarian Cancercustom-pageindoor-outdoor-non-lighted14512310-171 3 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Ovation 1 Door Enclosed Fabric Bulletin Board with Black Frame, 3'H x 2'W, Beige discounted at TrophyCentral.1ovk1-f96Enclosed - 1 Door, Indoorcustom-pageindoor-outdoor-non-lighted14512310-171 3 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Ovation 1 Door Enclosed Fabric Bulletin Board with Black Frame, 3'H x 2'W, Black discounted at TrophyCentral.1ovk1-f96Enclosed - 1 Door, Indoorcustom-pageindoor-outdoor-non-lighted14512310-171 3 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Ovation 1 Door Enclosed Fabric Bulletin Board with Black Frame, 3'H x 2'W, Blue discounted at TrophyCentral.1ovk1-f96Enclosed - 1 Door, Indoorcustom-pageindoor-outdoor-non-lighted14512310-171 3 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Ovation 1 Door Enclosed Fabric Bulletin Board with Black Frame, 3'H x 2'W, Gray discounted at TrophyCentral.1ovk1-f96Enclosed - 1 Door, Indoorcustom-pageindoor-outdoor-non-lighted14512310-171 3 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Ovation 1 Door Enclosed Fabric Bulletin Board with Black Frame, 3'H x 2'W, Red discounted at TrophyCentral.1ovk1-f96Enclosed - 1 Door, Indoorcustom-pageindoor-outdoor-non-lighted1Bulletin Boards4512310-171 3 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Ovation 1 Door Enclosed Fabric Bulletin Board with Black Frame, 3'H x 2'W, Taupe discounted at TrophyCentral.ovk1-f96Enclosed - 1 Door, Indoorcustom-pageindoor-outdoor-non-lighted14512310-171 3 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Ovation 1 Door Enclosed Fabric Bulletin Board with Black Frame, 3'H x 2'W, Teal discounted at TrophyCentral.1ovk1-f96Enclosed - 1 Door, Indoorcustom-pageindoor-outdoor-non-lighted14512310-171 3 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Ovation 1 Door Enclosed Fabric Bulletin Board with Gray Frame, 3'H x 2'W, Beige discounted at TrophyCentral.1ovk1-f96Enclosed - 1 Door, Indoorcustom-pageindoor-outdoor-non-lighted14512310-171 3 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Ovation 1 Door Enclosed Fabric Bulletin Board with Gray Frame, 3'H x 2'W, Black discounted at TrophyCentral.1ovk1-f96Enclosed - 1 Door, Indoorcustom-pageindoor-outdoor-non-lighted14512310-171 3 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Ovation 1 Door Enclosed Fabric Bulletin Board with Gray Frame, 3'H x 2'W, Blue discounted at TrophyCentral.1ovk1-f96Enclosed - 1 Door, Indoorcustom-pageindoor-outdoor-non-lighted14512310-171 3 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Ovation 1 Door Enclosed Fabric Bulletin Board with Gray Frame, 3'H x 2'W, Gray discounted at TrophyCentral.1ovk1-f96Enclosed - 1 Door, Indoorcustom-pageindoor-outdoor-non-lighted14512310-171 3 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Ovation 1 Door Enclosed Fabric Bulletin Board with Gray Frame, 3'H x 2'W, Red discounted at TrophyCentral.1ovk1-f96Enclosed - 1 Door, Indoorcustom-pageindoor-outdoor-non-lighted14512310-171 3 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Ovation 1 Door Enclosed Fabric Bulletin Board with Gray Frame, 3'H x 2'W, Taupe discounted at TrophyCentral.1ovk1-f96Enclosed - 1 Door, Indoorcustom-pageindoor-outdoor-non-lighted14512310-171 3 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Ovation 1 Door Enclosed Fabric Bulletin Board with Gray Frame, 3'H x 2'W, Teal discounted at TrophyCentral.1ovk1-f96Enclosed - 1 Door, Indoorcustom-pageindoor-enclosed-bulletin-boards1Bulletin Boards4512310-171 3 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Ovation 1 Door Enclosed Letter Board with Black Frame, 3'H x 2'W, Black discounted at TrophyCentral.Enclosed - 1 Door, Indoorcustom-pageindoor-enclosed-bulletin-boards14512310-171 3 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Ovation 1 Door Enclosed Letter Board with Black Frame, 3'H x 2'W, Burgundy discounted at TrophyCentral.1ovk1-bbkEnclosed - 1 Door, Indoorcustom-pageindoor-enclosed-bulletin-boards14512310-171 3 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Ovation 1 Door Enclosed Letter Board with Gray Frame, 3'H x 2'W, Black discounted at TrophyCentral.1ovk1-bbkEnclosed - 1 Door, Indoorcustom-pageindoor-enclosed-bulletin-boards14512310-171 3 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Ovation 1 Door Enclosed Letter Board with Gray Frame, 3'H x 2'W, Burgundy discounted at TrophyCentral.1ovk1-bbkEnclosed - 1 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Black Frame, 3'H x 4'W, Beige discounted at TrophyCentral.1ovk2-f95Enclosed - 2 Door, Indoorcustom-pageindoor-outdoor-non-lighted1Bulletin Boards45123110-171 3 4 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Black Frame, 3'H x 4'W, Black discounted at TrophyCentral.ovk2-f95Enclosed - 2 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Black Frame, 3'H x 4'W, Blue discounted at TrophyCentral.1ovk2-f95Enclosed - 2 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Black Frame, 3'H x 4'W, Gray discounted at TrophyCentral.1ovk2-f95Enclosed - 2 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Black Frame, 3'H x 4'W, Red discounted at TrophyCentral.1ovk2-f95Enclosed - 2 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Black Frame, 3'H x 4'W, Taupe discounted at TrophyCentral.1ovk2-f95Enclosed - 2 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Black Frame, 3'H x 4'W, Teal discounted at TrophyCentral.1ovk2-f95Enclosed - 2 Door, Indoorcustom-pageindoor-outdoor-non-lighted14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Black Frame, 3'H x 5'W, Beige discounted at TrophyCentral.1ovk4-f98Enclosed - 2 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Black Frame, 3'H x 5'W, Black discounted at TrophyCentral.1ovg4-f95Enclosed - 2 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Black Frame, 3'H x 5'W, Blue discounted at TrophyCentral.1ovk4-f98Enclosed - 2 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Black Frame, 3'H x 5'W, Gray discounted at TrophyCentral.1ovg4-f95Enclosed - 2 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Gray Frame, 3'H x 4'W, Beige discounted at TrophyCentral.1ovg2-f95Enclosed - 2 Door, Indoorcustom-pageindoor-outdoor-non-lighted1Bulletin Boards45123110-171 3 4 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Gray Frame, 3'H x 4'W, Black discounted at TrophyCentral.ovg2-f95Enclosed - 2 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Gray Frame, 3'H x 4'W, Blue discounted at TrophyCentral.1ovg2-f95Enclosed - 2 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Gray Frame, 3'H x 4'W, Gray discounted at TrophyCentral.1ovg2-f95Enclosed - 2 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Gray Frame, 3'H x 4'W, Red discounted at TrophyCentral.1ovg2-f95Enclosed - 2 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Gray Frame, 3'H x 4'W, Taupe discounted at TrophyCentral.1ovg2-f95Enclosed - 2 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Gray Frame, 3'H x 4'W, Teal discounted at TrophyCentral.1ovg2-f95Enclosed - 2 Door, Indoorcustom-pageindoor-outdoor-non-lighted14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Gray Frame, 3'H x 5'W, Beige discounted at TrophyCentral.1ovg4-f95Enclosed - 2 Door, Indoorcustom-pageindoor-outdoor-non-lighted1Bulletin Boards45123110-171 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Gray Frame, 3'H x 5'W, Black discounted at TrophyCentral.ovg4-f95Enclosed - 2 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Gray Frame, 3'H x 5'W, Blue discounted at TrophyCentral.1ovk4-f98Enclosed - 2 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Gray Frame, 3'H x 5'W, Gray discounted at TrophyCentral.1ovg4-f95Enclosed - 2 Door, Indoorcustom-pageindoor-enclosed-bulletin-boards145123110-171 3 4 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Letter Board with Black Frame, 3'H x 4'W, Black discounted at TrophyCentral.1ovk2-bbgEnclosed - 2 Door, Indoorcustom-pageindoor-enclosed-bulletin-boards1Bulletin Boards45123110-171 3 4 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Letter Board with Black Frame, 3'H x 4'W, Burgundy discounted at TrophyCentral.ovk2-bbgEnclosed - 2 Door, Indoorcustom-pageindoor-enclosed-bulletin-boards145123110-171 3 4 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Letter Board with Gray Frame, 3'H x 4'W, Black discounted at TrophyCentral.1ovg2-bbgEnclosed - 2 Door, Indoorcustom-pageindoor-enclosed-bulletin-boards145123110-171 3 4 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Letter Board with Gray Frame, 3'H x 4'W, Burgundy discounted at TrophyCentral.1ovk2-bbgEnclosed - 2 Door, Indoorcustom-pageindoor-outdoor-non-lighted1Bulletin Boards45123110-171 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Black Frame, 3'H x 5'W, Red discounted at TrophyCentral.ovk4-f98Enclosed - 3 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Black Frame, 3'H x 5'W, Taupe discounted at TrophyCentral.1ovk4-f98Enclosed - 3 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Black Frame, 3'H x 5'W, Teal discounted at TrophyCentral.1ovk4-f98Enclosed - 3 Door, Indoorcustom-pageindoor-outdoor-non-lighted14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 3 Door Enclosed Fabric Bulletin Board with Black Frame, 4'H x 6'W, Beige discounted at TrophyCentral.1ovk5-f93Enclosed - 3 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 3 Door Enclosed Fabric Bulletin Board with Black Frame, 4'H x 6'W, Black discounted at TrophyCentral.1ovg5-f95Enclosed - 3 Door, Indoorcustom-pageindoor-outdoor-non-lighted1Bulletin Boards45123110-171 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 3 Door Enclosed Fabric Bulletin Board with Black Frame, 4'H x 6'W, Blue discounted at TrophyCentral.ovk5-f93Enclosed - 3 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 3 Door Enclosed Fabric Bulletin Board with Black Frame, 4'H x 6'W, Gray discounted at TrophyCentral.1ovg5-f95Enclosed - 3 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 3 Door Enclosed Fabric Bulletin Board with Black Frame, 4'H x 6'W, Red discounted at TrophyCentral.1ovk5-f93Enclosed - 3 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 3 Door Enclosed Fabric Bulletin Board with Black Frame, 4'H x 6'W, Taupe discounted at TrophyCentral.1ovk5-f93Enclosed - 3 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 3 Door Enclosed Fabric Bulletin Board with Black Frame, 4'H x 6'W, Teal discounted at TrophyCentral.1ovk5-f93Enclosed - 3 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Gray Frame, 3'H x 5'W, Red discounted at TrophyCentral.1ovg4-f95Enclosed - 3 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Gray Frame, 3'H x 5'W, Taupe discounted at TrophyCentral.1ovg4-f95Enclosed - 3 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 2 Door Enclosed Fabric Bulletin Board with Gray Frame, 3'H x 5'W, Teal discounted at TrophyCentral.1ovg4-f95Enclosed - 3 Door, Indoorcustom-pageindoor-outdoor-non-lighted14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 3 Door Enclosed Fabric Bulletin Board with Gray Frame, 4'H x 6'W, Beige discounted at TrophyCentral.1ovg5-f95Enclosed - 3 Door, Indoorcustom-pageindoor-outdoor-non-lighted1Bulletin Boards45123110-171 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 3 Door Enclosed Fabric Bulletin Board with Gray Frame, 4'H x 6'W, Black discounted at TrophyCentral.ovg5-f95Enclosed - 3 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 3 Door Enclosed Fabric Bulletin Board with Gray Frame, 4'H x 6'W, Blue discounted at TrophyCentral.1ovk5-f93Enclosed - 3 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 3 Door Enclosed Fabric Bulletin Board with Gray Frame, 4'H x 6'W, Gray discounted at TrophyCentral.1ovg5-f95Enclosed - 3 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 3 Door Enclosed Fabric Bulletin Board with Gray Frame, 4'H x 6'W, Red discounted at TrophyCentral.1ovg5-f95Enclosed - 3 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 3 Door Enclosed Fabric Bulletin Board with Gray Frame, 4'H x 6'W, Taupe discounted at TrophyCentral.1ovg5-f95Enclosed - 3 Door, Indoorcustom-pageindoor-outdoor-non-lighted145123110-171 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Ovation 3 Door Enclosed Fabric Bulletin Board with Gray Frame, 4'H x 6'W, Teal discounted at TrophyCentral.1ovg5-f95Enclosed - 3 Door, Indoorcustom-pagehigh-end-awards1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"general410187-1010.45424.45JcharlesCrystal Awards1:22%,25:30%"crystal awards"Ovation Awards will earn a standing ovation from all who receive this exceptional award. Available in two sizes. Personalization is free!111noindexed-items111115-711 2 3 4 5 6 7 8 9Tower RibbonsRibbonsCustom Ribbons1:0%Customer proof for Overlay / Step Ribbon. See our complete selection of discounted ribbons and awards!1custom-pagemascotpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:36%,100:46%,500:52%"Mascot Awards"Find These Owl Lapel Pins with Antique Finish Discounted at TrophyCentral! Also See Our Other Fabulous School Mascot Pins. Fast 1-2 Day Shipping!pm13Mascotcustom-pagemascot-plaques1plaques498552-41JDSPlaques1Find this owl plaque discounted at TrophyCentral. Our owl mascot plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Mascotcustom-pagemascottrophies1"4-6 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511016.25Classic MedallicsTrophiesAcademic1:22%,5:24%,10:28%,50:32%"Mascot Awards"Buy this Owl mascot trophy and other mascot awards at TrophyCentral.mt203010-05-2022Mascotcustom-pagemascotinserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsMascots1Buy these quality Owls Mascot Medal Inserts at TrophyCentral. Each Owls Insert can be used to create a unique plaque, medal or trophy.489948Mascot
custom-pagetrophies-golf1"10 business days" "Aliquippa, PA" "UPS"trophies1500110-1410.45424.45Glass AmericaCrystal AwardsSports, Hobby, Org, Livestock1:22%,10:25%Oxford Golf Ball Trophy. Ideal for leagues, schools, and tournaments. Fast shipping.Golf, Sportscustom-pageletter-shaped-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find these popular P-shaped custom mascot badges at TrophyCentral. Great for fundraising! TrophyCentral is a top-rated Yahoo merchant.letterbadges-pcustom-pagetrophies-beer-pongqtpaintncqtpaintscqtpaintdmqtpaintyrqtpaintplqtpaintttqtpaintttwqtpaint3cqtpaintperpmqtpaintscbcup-paint-scbcup-paint-pbdg-paintball1trophies1Find Paintball Trophies Discounted at TrophyCentral. Each Paintball Trophy Includes Free Engraving. Fast 1-2 Day Shipping!Paintball Awards TrophyCentral has a great selection of paintball awards and trophies. Be sure to see our popular Single Column Paintball Trophies, available in several sizes and with several different color columns, and our place trophies with a choice of 1st, 2nd or 3rd place trim. These awards are perfect for a race or club event. All of our paintball awards include up to three lines of FREE ENGRAVING (larger trophies include additional lines). ]]>custom-pagefreeawardcertificates1"Download Only"free-sports49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Paintball template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Paintball-Certificatepaintball-freePaintballcustom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Paintabll Medals"Buy these quality Mylar Paintball Decal Inserts at TrophyCentral. Each Paintball Decal can be used to create a unique plaque, medal or trophy.489853Paintball
custom-pagetrophies-paintball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%,25:23%,50:29%,100:34%Our popular Paintball participation trophies feature a real slant-front marble base and free engraving.qtpaintncPaintballcustom-pagetrophies-paintball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular paintball figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!qtpaintplPaintball, 1st / 2nd / 3rd / Etc.custom-pagetrophies-paintball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%This popular Paintball Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!qtpaintyrPaintballcustom-pagemascotpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:36%,100:46%,500:52%"Mascot Awards"Find These Panther Lapel Pins with Antique Finish Discounted at TrophyCentral! Also See Our Other Fabulous School Mascot Pins. Fast 1-2 Day Shipping!pm12Mascotcustom-pagemascot-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Panther Mascot Badges Discounted At TrophyCentral.mascotbadges-panthercustom-pagemascotpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:30%,100:33%,500:47%"Mascot Awards"Find these Panther Lapel Pins and other colorful mascot pins at TrophyCentral. Fast 1-2 day shipping!em01Mascotcustom-pagemascotinserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsMascots1Buy these quality Panthers Mascot Medal Inserts at TrophyCentral. Each Panthers Insert can be used to create a unique plaque, medal or trophy.489926Mascot
custom-pageglass-crystal-awards1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"general410187-1010.45648.45JcharlesCrystal Awards1:22%,25:24%"crystal awards" "sales awards" "service awards" "corporate sales awards" "corporate service awards" "sales award" "service award" "corporate sales award" "corporate service award"Paradigm from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.custom-pagemedallion-inserts-occupational-subjects12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these quality Paramedic Inserts (Litho) at TrophyCentral. Each Paramedic Insert can be used to create a unique plaque, medal or trophy.493401Occupations
custom-pagetrophies-military-hero11plaques105503-610.4511219.65Classic MedallicsPlaquesBlank Plaques1:22%Shop for Paramedic Plaques from TrophyCentral; Free Engraving. TrophyCentral is a Top-Rated Yahoo Merchant.EMScustom-pagewalnut-insert-plaques1"3-6 business days with engraving, Without engraving: 1-3 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"plaques105503-610.4511222.05Classic MedallicsPlaquesInsert1:22%,3:23%,5:24%Genuine Walnut Paramedic Plaque with 2 Inch Insert and Free Engraving.49-3401Occupationscustom-pageteacher-appreciation1"3-6 business days with engraving, Without engraving: 1-3 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"plaques105503-610.4511219.65Classic MedallicsPlaquesInsert1:22%,3:24%,5:27%"School Awards" "School Products"Genuine Walnut Parent Teacher Association (PTA) Plaque with 2 Inch Insert and Free Engraving.51-3411custom-pageplace-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%Your athletes will love these colorful Mylar Participant Medals from TrophyCentral. Each Participant medal includes a neck ribbon!tm9967gSports
custom-pagetrophies-music1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our band insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - BandMusic / Band / Choruscustom-pagetrophies-baseball1trophies498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1"Baseball Trophies" "Cheap Baseball Trophies" "Buy Baseball Trophies" "Purchase Baseball Trophies" "Discount Baseball Trophies" "Baseball Trophies" "Baseball Trophy"Participation Baseball Trophy with Marble Platform - Baseball Glove. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Baseball / T-Ball, Golden Glovecustom-pagetrophies-baseball1trophies498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1"Baseball Trophies" "Cheap Baseball Trophies" "Buy Baseball Trophies" "Purchase Baseball Trophies" "Discount Baseball Trophies" "Baseball Trophies" "Baseball Trophy" "Baseball Trophies and Medals" "Baseball Medals and Trophies"Participation Baseball Trophy with Marble Platform. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Baseball / T-Ball, Sportscustom-pagefree-school-certificate-templates1free-school-certificate-templates"Download Only"free-sports49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"participationAcademiccustom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceCertificates / CoversEmbosser Seals1:22%,3:28%,5:31%Find these Participation Embossed Certificate Seals discounted at TrophyCentral. Seals are easy to apply with a pressure-sensitive backing.803partGeneralcustom-pageawardcertificates1participation1certificates290631-31 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,25:24%,100:40%,500:50%Find this participation certificate and other awards discounted at TrophyCentral. Participation certificates are beautifully printed; template measures 11 x 8 1/2 inches.920Academiccustom-pagetrophies-chess1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our chess insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - ChessChesscustom-pagetrophies-chess1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy chess insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Chesscustom-pagetrophies-dance1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our dance insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - CheerDancecustom-pagetrophies-music1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy music insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Music / Band / Choruscustom-pagehorseshoes1498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy horeshoes insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Horseshoescustom-pagetrophies-beer-pong1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Beer Pong insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - Beer PongBeer Pongcustom-pagetrophies-beer-pong1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy Beer Pong insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Beer Pongcustom-pagetrophies-marksman-shooting-rifle1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our shooting insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - Shootingcustom-pagetrophies-marksman-shooting-rifle1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy hunting insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.custom-pagetrophies-music1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Music insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - MusicMusic / Band / Choruscustom-pageresin-trophies1"1 - 2 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"trophies290631-21 2 3 230.451224.45Certificate SourceCertificates / CoversStickers1:22%,3:24%Find these colorful Participation Really Rocks Motivational Stickers discounted online at TrophyCentral. Fast 1-2 day shipping!bstick7Participationcustom-pagetrophies-track-field1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our running insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.custom-pagetrophies-track-field1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy running insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.custom-pagetrophies1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"465713-41012.11See these Classic Line School and Sports Participation Trophies at TrophyCentral. Classic Line Trophies Include Free Engraving and Ship in Just 1-2 Days!classic-line-allcustom-pagetrophies-track-field1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our track insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - Trackcustom-pagetrophies-track-field1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy track insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.custom-pageshop-by-categorypart-trophies-tcbstick77020vitrnoco803part920mqt-star-p-ncbdg-star-p1trophies1Find participation trophies discounted at TrophyCentral. Each participation trophy includes free engraving. Browse our budget trophies and awards now!

Inexpensive Participation Trophies and Awards

If you are shopping for trophies online, you have come to the right place! We offer significant quantity discounts for all of your team, league, school and event needs. We know there is a debate about whether every child deserves a trophy, but we also know that our youth sports budget trophies are sure to make kids smile! Also see our cup & large trophies and perpetual trophies sections.
]]>
custom-pageschool-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:28%,100:32%,500:42%"School Pins" "School Lapel Pins"Find Partners In Education pins at TrophyCentral. Each AP Series Partners In Education pin includes a clutch back.ap68Academiccustom-pagemedallion-inserts-general-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals" "Religious Medals"Buy these high-quality, Etched Partners In Faith Religious Cross Inserts Discounted at TrophyCentral.518245Religious
custom-pagereligioustrophies12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsReligious1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "Religious Medals"These inexpensive 1 1/4 inch Religious (Partners in Faith) Medals offer a high quality, but low price for those on a tight budget.e9132Religious
custom-pagegeneral-corporate-awards11"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"458221510.45633.45Vision AwardsTrophies1:22%,26:28%Partners In Success Teamwork Awards from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.custom-pagegift-certificate-templates1"Download Only"certificates4985501Trophy CentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our party themed template is free and designed exclusively for Trophy Central. This gift certificate measures 5" x 3" and can be easily downloaded and printed.Party-Gift-Certificategc-party-521Gift Certificate, Birthday, Holidaycustom-pagecalendar-whiteboards14512310-171 3 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Patient Room Magnetic Whiteboard, 24"H x 18"W discounted at TrophyCentral.1Not Enclosed, Healthcarecustom-pagecalendar-whiteboards14512310-171 3 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Patient Room Magnetic Whiteboard, 3'H x 2'W discounted at TrophyCentral.1Not Enclosed, Healthcarecustom-pagecalendar-whiteboards14512310-171 3 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Patient Room Whiteboard, 24"H x 18"W discounted at TrophyCentral.1Not Enclosed, Healthcarecustom-pagecalendar-whiteboards14512310-171 3 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Patient Room Whiteboard, 3'H x 2'W discounted at TrophyCentral.1Not Enclosed, Healthcarecustom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceCertificates / CoversEmbosser Seals1:22%,3:28%,5:31%Find these Paw (Die Cut) Embossed Certificate Seals discounted at TrophyCentral.803dpMascotcustom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceCertificates / CoversEmbosser Seals1:22%,3:28%,5:31%Find these Paw Blue (Round) Embossed Certificate Seals discounted at TrophyCentral.803pawbgMascotcustom-pagemascot-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Paw Mascot Badges Discounted At TrophyCentral.mascotbadges-pawcustom-pagemascot-medals50medals9303310-May1Simba Calaward-medals1These 2 1/2 inch custom paw mascot medals come with an outer-ring which allows you to add your school or league name, date and location.Mascotcustom-pagemascot-plaques1plaques498552-41JDSPlaques1Find this Paw Plaque discounted at TrophyCentral. Our mascot plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Mascotcustom-pagemascot-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Paw Nameplate Badges Discounted At TrophyCentral.mascotbadges-paw2custom-pagemascotpinsplasticpinboxvelapinbox10105502-30.31150030.3Classic Medallicslapel-award-pins11:22%,50:30%,100:33%,500:47%Find These Paw Print Mascot Pins Discounted at TrophyCentral. Paw Pins Feature a Clutch-Back and are Available in Many Colors. Fast 1-2 Day Shipping!Paw-Print-Mascot-PinsPaw, Mascotcustom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceCertificates / CoversEmbosser Seals1:22%,3:28%,5:31%Find these paw certificate seals discounted at TrophyCentral. Each paw certificate seal is packaged in rolls of 100.803pawMascotcustom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these high-quality Peak Performance Inserts at TrophyCentral. Each Peak Performance Insert can be used to create a unique plaque, medal or trophy.518501General, Business
custom-pagedisplaycases211"7-10 business days" "Connelly Springs, North Carolina" "UPS (FedEx available on request)"display case286127-1010.452.65SpartaCraftDisplay CasesSpecialty Cases1:14%Pedestal / Memorial Urn from TrophyCentral. Also see our great selection of engraved and personalized gifts!Flag Casescustom-pagecoaching-teaching-guides11Master pee-wee football coaching with safety-first tackling progressions, age-appropriate drills, and position basics for ages 5-12. Includes motivation and recognition strategies.custom-pageawardcertificates11certificates290631-31 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,25:24%,100:40%,500:50%Find this peer mediator certificate and other awards discounted at TrophyCentral. Peer mediator certificates are beautifully printed; template measures 11 x 8 1/2 inches.931Academiccustom-pagegeneral-corporate-awards11"7-10 business days w/engraving" "Kentucky" "UPS (FedEx available on request)"general410187-1010.45626.85JcharlesGeneral Awards1:22%,25:24%"Corporate Awards" "New Products" "Crystal Trophies"Perceptions Crystal Trophies from TrophyCentral. Also see our great selection of engraved and personalized gifts!06-01-2019custom-pageaward-medalsperfect-attendance-mcperfect-attendance-mc-prtm9755perfect-attendance-jigfperfect-attendance-jibfperfect-attendance-jisf1academic-general-medals1Find a great selection of Perfect Attendance Medals discounted at TrophyCentral. Each perfect attendance medal includes a neck ribbon. Fast 1-2 day shipping.Shop for with Ease at TrophyCentral! TrophyCentral has a great selection that will fit any budget. Our experts in New York and Michigan have been providing suggestions and guidance since 1999! They would be happy to help you, too!]]>academic-general-medalscustom-pageattendance-medals-pins1498551-30.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find these colorful Perfect Attendance 2" Epoxy-covered insert decals discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Attendance, Academiccustom-pageachievement-certificates-awards1"Download Only"free-academic49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Download free perfect attendance certificates. Printable templates for classroom or school use. Easy to personalize. Recognize students' commitment today.Free-Perfect-Attendance-Award-Certificateperfect-attendance-awardParticipation, Academiccustom-pageachievement-certificates-awards1"Download Only"free-academic49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"See this Perfect Attendance Certificate designed exclusively for TrophyCentral! Each Perfect Attendance Certificate measures 11 x 8 1/2 inches and can be downloaded for free!attendanceAcademic, Perfect Attendancecustom-pageattendance-medals-pins1498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Perfect Attendance Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Perfect Attendance, Academiccustom-pageattendance-medals-pins1498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Perfect Attendance Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Perfect Attendance, Academiccustom-pageattendance-medals-pins1498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Perfect Attendance Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Perfect Attendance, Academiccustom-pageawardcertificates11certificates290631-31 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,25:24%,100:40%,500:50%Find this perfect attendance certificate discounted at TrophyCentral. Perfect attendance certificates are beautifully printed; template measures 11 x 8 1/2 inches.903Academiccustom-pageachievement-certificates-awards1"Download Only"free-academic4985501Trophy CentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Perfect Attendance template is free and designed exclusively for Trophy Central. Perfect Attendance certificate templates measure 11" x 8 1/2" and can be easily downloaded and printed.perfect-attendance-certificateperfect-attendance-frPerfect Attendance, Academiccustom-pageawardcertificates11certificates290631-31 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,25:24%,100:40%,500:50%Find this perfect attendance certificate with clock design discounted at TrophyCentral. Certificates are beautifully printed; template measures 11 x 8 1/2 inches.965Academiccustom-pageperfect-attendance-awards1498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy perfect attendance column insert trophy features a choice of column color, a marble base and free trophy engraving.Attendance, Academiccustom-pageperfect-attendance-pinsplastic-pinbox-t1498551-30.5200040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find these Perfect Attendance Gold Enamel Lapel Pins discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.1attendance-u-pbAttendance, Academiccustom-pagenew-tc-color-medals1medals498551-30.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Colorful Perfect Attendance Insert Medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Perfect Attendance, Academiccustom-pageattendance-medals-pins1498551-30.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Perfect Attendance Insert Medals With A Personalized Front Rim Discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Perfect Attendance, Academiccustom-pagecherry-insert-plaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these perfect attendance insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Academic, Perfect Attendancecustom-pageperfect-attendance-pinsplastic-pinbox-t5lapel pins498551-20.525040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find these Perfect Attendance Gold Enamel Lapel Pins discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.attendance-u-pbAttendance, Academiccustom-pageec34plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:28%,100:32%,500:42%"School Pins" "School Lapel Pins"Find Perfect Attendance pins at TrophyCentral. Each Perfect Attendance pin includes a clutch back. Browse our fabulous selection of school lapel pins now!ap10Academiccustom-pageacademic-lamp-general102-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.5115014Classic Medallicsaward-medalsAcademic1:22%,25:24%,50:30%,100:36%,500:42%"School Medals" "School Award Medals" "Scholastic Medals" "Scholastic Award Medals" "Academic Medals" "Academic Award Medals" "Medals, School"Find Perfect Attendance Medals discounted at TrophyCentral. Each Perfect Attendance Medal features a free neck ribbons. Fast 1-2 day shipping.tm9755General, Academic
custom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these high-quality Perfect Attendance Inserts at TrophyCentral. Each Perfect Attendance Insert can be used to create a unique plaque, medal or trophy.518301General, Business
custom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these quality Mylar Perfect Attendance Decal Inserts at TrophyCentral. Each decal can be used to create a unique plaque, medal or trophy.489755Academic, Perfect Attendance
custom-pageperfect-attendance-awards1498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Perfect Attendance insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - Perfect AttendancePerfect Attendance, Academiccustom-pageperfect-attendance-awards1498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy perfect attendance insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Attendance, Academiccustom-pageperfect-attendance-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"Find Perfect Attendance pins for your students at TrophyCentral. Each Perfect Attendance pin includes a clutch back. Large quantity discounts.br389Generalcustom-pageperfect-attendance-pinsplasticpinboxvelapinbox10105502-30.31150030.3Classic Medallicslapel-award-pins11:22%,50:30%,100:33%,500:47%Find Perfect Attendance Pins Discounted At TrophyCentral. Each Perfect Attendance Pin Features A Clutch-Back. Fast 1-2 Day Shipping!Perfect-AttendancePerfect Attendance, Academiccustom-pagestar-pinsg-perfect-attendanceattendance-pbattendance-u-pbbr633hp15ap10br389ec34ec73ap71br325ec811school-pins1Find perfect attendance lapel pins discounted at TrophyCentral. Each perfect attendance pin features a clutch back for easily attaching to clothing. Shop with Ease at TrophyCentral! If you are looking to buy attendance pins for your students online, look no further! TrophyCentral has a great selection that will fit any budget. Our experts in New York and Michigan have been providing suggestions and guidance since 1999!]]>attendance-medals-pins school-pinscustom-pageperfect-attendance-pinsplasticpinboxvelapinbox107003 965 803p tm9755 ap10 hp15"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:30%,100:33%,500:47%"School Pins" "School Lapel Pins"Chenille PERFECT ATTENDANCE Letter Pins: EC Series Chenille PERFECT ATTENDANCE Lapel Pins feature a high-quality enameled finish and ship in just 1-2 business days!ec34Academiccustom-pageec341"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceCertificates / CoversEmbosser Seals1:22%,3:28%,5:31%Find these Perfect Attendance Embossed Certificate Seals discounted at TrophyCentral.803pGeneralcustom-pageperfect-attendance-awards1498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Perfect Attendance single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - Perfect AttendancePerfect Attendance, Academiccustom-pagetrophies-generalperfect-attendance-part-iperfect-attendance-single-iperfect-attendance-champ-iperfect-attendance-plaque-iperfect-attendance-e-part-iperfect-attendance-e-single-icup-attendance-in1trophies-academic1Find a great selection of perfect attendance trophies discounted at TrophyCentral. Also find perfect attendance awards, including certificates.Shop with Ease at TrophyCentral Be sure to browse our fabulous selection of student and school awards, all at discounted prices. Each Perfect Attendance medal includes a free neck ribbon. Trophy prices include engraving.]]>attendance-medals-pins academic-general-medalscustom-pageperfect-attendance-awards1498551-311821.06TrophyCentraltrophies1Attendance, Academiccustom-pageart-trophies1"3-6 business days with engraving, Without engraving: 1-3 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"plaques105503-610.4511219.65Classic MedallicsPlaquesInsert1:22%,3:24%,5:27%Genuine Walnut Performing Arts / Film Plaque with 2 Inch Insert and Free Engraving.51-7826Art, Academiccustom-pagedance-templates-free1"Download Only"free-certificate4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Performing Arts template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Performing-Arts-Certificateperforming-arts-freePerforming Artscustom-pagedrama-medals-pins12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105502-41130025Classic MedallicsInsertsMusic, Drama, Art, Dance1:22%"Award Medals" "Art / Dance / Drama Medals" "Award Medals - All Subjects" "Drama Awards" "Drama Trophies" "Drama Trophy"517826Drama
custom-pageteacher-appreciation1perpetual trophies498552-31234TrophiesSchool1Find this Perpetual Trophy with Apple figure discounted at TrophyCentral. Each trophy has enough room for 32 names. Ships in just 1-2 days.mqt-apple-perpApplecustom-pagetrophies-baseball1fantasy-baseball-trophiesperpetual trophies498552-311.4234Trophy CentralTrophies1"Baseball Awards" "Baseball Trophies" "Baseball Trophies and Medals" "Baseball Medals and Trophies"Perpetual Series - Fantasy Baseball Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Baseball / T-Ball, Sportscustom-pagetrophies-basketball1fantasy-basketball-trophies"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.4234Quick TrophyTrophies11:14%,3:15%,10:16%"Basketball Awards" "Basketball Trophies"Perpetual Series Trophy - Basketball. Ideal for leagues, schools, and tournaments. Fast shipping.qtbasketperpBasketball, Sportscustom-pagequickshiptrophies-bass1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.4234Quick TrophyTrophies1:14%,3:15%,10:16%"Fishing Trophies" "Fishing Awards"Shop for team, championship and perpetual Bass Fishing trophies at TrophyCentral. Each Bass Fishing trophy has enough room for 32 names and ships in just 1-2 days!qtbassperpSee our completesection.trophies-bass-fishingFishing, Sportscustom-pagetrophies-billiards1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.4234Quick TrophyTrophies1:14%,3:15%,10:16%Shop for team, championship and perpetual Billiards trophies at TrophyCentral. Each Billiards trophy has enough room for 32 names and ships in just 1-2 days!qtbilliardperpReturn to thesection for additional styles.trophies-billiardsBilliardscustom-pagetrophies-bowling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.4234Quick TrophyTrophies1:14%,3:15%,10:16%"Bowling Awards" "Bowling Trophies"Shop for team, championship and perpetual Bowling trophies at TrophyCentral. Each Bowling trophy has enough room for 32 names and ships in just 1-2 days!qtbowlperpReturn to our section for more great choices!trophies-bowlingBowlingcustom-pagetrophies-cards-poker1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.4234Quick TrophyTrophies1:14%,3:15%,10:16%Shop for team, championship and perpetual Cards trophies at TrophyCentral. Each Cards trophy has enough room for 32 names and ships in just 1-2 days!qtcardsperpcustom-pagetrophies-cheerleading-spirit1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.4234Quick TrophyTrophies1:14%,3:15%,10:16%Shop for team, championship and perpetual Cheerleading trophies at TrophyCentral. Each Cheerleading trophy has enough room for 32 names and ships in just 1-2 days!qtcheerperpReturn tosection for additional choices.trophies-cheerleading-spiritCheerleading, Sportscustom-pagetrophies1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.4234Quick TrophyTrophies1:14%,3:15%,10:16%Find team trophies discounted at TrophyCentral. Each team trophy and award has enough room for 32 names! Ships in 1-2 business days!champion-perpetual-trophiescustom-pagetrophies-funny-horses-rear1perpetual trophies498553-Feb11.4Trophy CentralTrophies1Shop for team, championship and perpetual comic turkey trophies at TrophyCentral. Each comic turkey trophy has enough room for 32 names and ships in just 1-2 days!Funny / Gagcustom-pagetrophies-cornhole1perpetual trophies498552-411.4234TrophyCentralTrophies1Shop for team, championship and perpetual cornhole trophies at TrophyCentral. Each cornhole trophy has enough room for 32 names and ships in just 1-2 days!Perpetual Series Trophy - CornholeCornholecustom-pagetrophies-cooking-culinary1perpetual trophies498551-31434TrophyCentralTrophies1Find this perpetual culinary trophy at TrophyCentral. Each trophy has enough room for 32 names and ships in just 1-2 days! Features free engraving for main plate and first nameplate.custom-pagetrophies-dance1perpetual trophies498552-31234TrophiesMusic, Drama, Art, Dance1Shop for team, championship and perpetual Dance trophies at TrophyCentral. Each Dance trophy has enough room for 32 names and ships in just 1-2 days!mqt-dancer-perpDancecustom-pagetrophies-disc-golf1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.4234Quick TrophyTrophies1:14%,3:15%,10:16%Perpetual Series Trophy - Disc Golf. Ideal for leagues, schools, and tournaments. Fast shipping.qtdiscgolfperpDisc Golfnoindexed-items11"Team Award" "Team Awards" "Team Trophy" "Team Trophies" "Team Trophies and Awards"Shop for Fantasy and Perpetual Trophies at TrophyCentral. Free Engraving on Fantasy and Team Trophies. Fast 1-2 Day Shipping!perpetual trophies, team trophy, championship trophy, cup trophy, perpetual trophy, team trophies, perpetual awards, perpetual trophies and awards, cup trophies1perpetual-trophiescustom-pagetagsbadges11"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"458221513.0010010.45Vision AwardsEngraving Plates1:22%"Engraving"Perpetual Fascination Engraved Plates from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.custom-pagetrophies-football1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.4234Quick TrophyTrophies11:14%,3:15%,10:16%"Football Awards" "Football Trophies"Perpetual fantasy football trophy with space for up to 32 names. Ideal for fantasy leagues and tournaments. Free engraving. Fast shipping.qtfootperpReturn to section for our complete selection.trophies-footballFootball, Sportscustom-pagetrophies-golf1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.4234Quick TrophyTrophies11:14%,3:15%,10:16%"Golf Awards" "Golf Trophies"Perpetual Series Trophy - Golf. Ideal for leagues, schools, and tournaments. Fast shipping.qtgolfperpGolf, Sportscustom-pagetrophies-ice-hockey1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.4234Quick TrophyTrophies1:14%,3:15%,10:16%"Hockey Awards" "Hockey Trophies"Find these fabulous perpetual hockey trophies discounted at TrophyCentral. Each trophy has enough room for 32 names and ships in just 1-2 days!qthockeyperpHockey, Sportscustom-pagetrophies-marksman-shooting-rifle1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.4234Quick TrophyTrophies1:14%,3:15%,10:16%Shop for team, championship and perpetual Trap Shooting trophies at TrophyCentral. Each Trap Shooting trophy has enough room for 32 names and ships in just 1-2 days!qttrapperpReturn to thesection for other great choices.trophies-trap-skeet-shootingcustom-pagetrophies-karate-martial-arts1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.4234Quick TrophyTrophies1:14%,3:15%,10:16%"Karate Awards" "Karate Trophies"Shop for team, championship and perpetual Karate trophies at TrophyCentral. Each Karate trophy has enough room for 32 names and ships in just 1-2 days!qtkarateperpKarate / Martial Arts, Sportscustom-pagetrophies-music1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.4234Quick TrophyTrophies1:14%,3:15%,10:16%"Music Awards" "Music Trophies" "Band Awards"Shop for team, championship and perpetual Music trophies at TrophyCentral. Each Music trophy has enough room for 32 names and ships in just 1-2 days!qtmusicperpMusic / Band / Choruscustom-pageperplaq11"7-10 business days w/engraving" "Chicago, Illinois" "UPS (FedEx available on request)"498554-61 3 230.451020.45RS Owens1:22%custom-pagetrophies-paintball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498852-311.4234Quick TrophyTrophies1:14%,3:15%,10:16%Shop for team, championship and perpetual Paintball trophies at TrophyCentral. Each Paintball trophy has enough room for 32 names and ships in just 1-2 days!qtpaintperpPaintballcustom-pagepickleball-trophies1perpetual trophies498552-311.4Trophy CentralTrophies1Shop for team, championship and perpetual pickleball trophies at TrophyCentral. Each pickleball trophy has enough room for 32 names and ships in just 1-2 days!Pickleball, Sportscustom-pagetrophies-pinewood-derby-scouts1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.4234Quick TrophyTrophies1:14%,3:15%,10:16%Shop for team, championship and perpetual Pinewood Derby Cup trophies at TrophyCentral. Each Pinewood Derby Cup trophy has enough room for 32 names and ships in just 1-2 days!qtpineperpReturn to thesection for additional choices.trophies-pinewood-derby-scoutsPinewood Derbycustom-pageperplaqperplaqplatperpetual-2perpetual-3perpetual-plate-for-goat-trophy1tagsbadges1Find perpetual plaque plates discounted at TrophyCentral. Each perpetual plaque plate includes expert custom text engraving.

Perpetual Plaque Plates - The Unsung Heroes of Ongoing Recognition

Engraving plates transform perpetual plaques from one-time investments into endlessly renewable recognition systems, delivering the practical magic where a single wall display serves organizations faithfully across decades through simple nameplate additions rather than complete plaque replacements. These small brass or aluminum rectangles featuring custom engraved text slip into perpetual plaque slots via magnetic backing or traditional screw mounting, adding new honorees chronologically while maintaining visual consistency across years of recognition. Perfect for updating Employee of the Month displays monthly without ordering new plaques, adding donor names to contribution walls as campaigns progress, documenting championship team rosters season after season, recognizing academic achievers each semester, and correcting those inevitable typos discovered after original installation when someone notices their name spelled creatively. Available in standard sizes matching most perpetual plaque configurations including half-inch through one-inch heights and two through four-inch widths, with finish options spanning black brass plates accepting gold or silver text, gold plates featuring black engraving, and silver aluminum alternatives. Magnetic versions cost slightly more but eliminate installation tools and avoid cumulative screw holes from years of updates, while traditional mounted plates provide security against accidental removal in high-traffic areas where curious hands might rearrange organizational history.

Complete your recognition display: Explore Perpetual Plaques, Explore Perpetual Trophies, and Explore Award Plaques for your recognition needs.

Frequently Asked Questions About Perpetual Plaque Plates

How do you determine the correct engraving plate size for an existing perpetual plaque?

Matching replacement plates to existing perpetual plaques requires measuring current nameplates precisely rather than guessing based on plaque dimensions. Use a ruler to measure an existing plate's width and height in inches, noting whether measurements include any visible border or represent only the engraved surface area. Common perpetual plaque plate sizes include half-inch by two-and-three-quarter-inch for compact displays, three-quarter-inch by three-inch for standard recognition, and one-inch by four-inch for larger formats, though dozens of size variations exist across manufacturers and plaque styles. When ordering, verify finish colors match existing plates since black brass with gold text differs noticeably from gold brass with black engraving, and mismatched finishes create distracting visual inconsistencies across plaque surfaces. If possible, photograph existing plates with a ruler visible for scale, helping suppliers confirm correct specifications before production. Organizations without access to original plaque sources sometimes remove a single existing plate temporarily for measurement verification, though this works only with magnetic or easily removable mounted plates.

What happens when you discover an engraving error after installing a nameplate?

Engraving mistakes discovered post-installation cause immediate panic followed by practical problem-solving depending on error severity and plate attachment methods. Minor errors like missing periods or slight spacing irregularities often go unnoticed by anyone except the perfectionist who ordered the plaque, making replacement optional rather than mandatory. Significant mistakes including misspelled names, wrong dates, or transposed information demand immediate correction to avoid permanent embarrassment and recipient disappointment. Magnetic plates allow quick error correction by simply removing incorrect plates and ordering replacements without visible damage to the plaque itself. Traditional mounted plates require careful removal with screwdrivers, potentially leaving visible screw holes if new plates shift positions slightly during reinstallation. Some organizations strategically position replacement plates to cover previous screw marks, while others embrace the minor imperfections as evidence of authentic recognition history rather than pristine but sterile displays. Reputable suppliers typically replace genuinely incorrect engraving at no charge when errors result from their mistakes rather than customer-supplied information.

Can you mix different engraving plate finishes on the same perpetual plaque?

Technically possible but visually questionable, mixing plate finishes on single perpetual plaques creates intentional or accidental tiered recognition systems where finish variations signal achievement levels or simply result from inconsistent ordering over time. Some organizations deliberately use gold plates for first-place winners, silver for runners-up, and bronze for third-place finishers, with finish differences communicating achievement hierarchy instantly. However, most perpetual plaques benefit from finish consistency maintaining visual cohesion across all nameplates regardless of when individuals earned recognition. Organizations discovering their original plate supplier discontinued or changed finishes face difficult choices between accepting mixed finishes going forward or replacing all existing plates for consistency. The latter option proves expensive and erases visible recognition history, while mixed finishes appear careless unless deliberately designed as tiered systems. Forward-thinking administrators document exact plate specifications including manufacturer details when establishing perpetual plaque programs, ensuring consistent replacement ordering across decades even as staff turnover eliminates institutional memory about original sourcing decisions.



If you need more information before deciding, see our expert resource section:
]]>
tagsbadges perplaq
custom-pagegeneral-corporate-awardsdplt043starplaquefs-166xperplaqcomsorosewood-perpetual-plaqueglpeplcomingsoon8101x13peplwpeapeplpepl14x20wpp12wpp18wpp24wpp36wpp45wpp60opp12opp18opp24epp12epp18epp241plaques2-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
498555-8.52Shop perpetual plaques and perpetual name plaques to honor ongoing achievements. Ideal for employee of the month, donor walls, and team recognition. Free engraving, many styles, and fast shipping.

Perpetual Plaques - Building Recognition History One Name at a Time

Perpetual plaques solve the eternal recognition dilemma where honoring monthly or annual achievements with individual awards creates storage nightmares and budget headaches, while verbal acknowledgment alone fails to satisfy anyone who just earned Employee of the Month and wants proof. These multi-nameplate wall displays accumulate winners chronologically on removable brass or aluminum plates arranged in elegant rows beneath header plates announcing the honor, creating living timelines of excellence visible to everyone passing the lobby, break room, or trophy hallway. Perfect for employee recognition programs tracking monthly standouts across years, donor walls acknowledging cumulative contributions without commissioning new plaques annually, sports teams documenting championship seasons and MVP selections, academic institutions celebrating honor roll achievements semester after semester, and volunteer organizations recognizing service milestones while maintaining permanent displays. Available in wood finishes including walnut, cherry, oak, and rosewood piano finishes delivering various levels of formality, with nameplate capacities ranging from compact 12-plate versions suitable for quarterly awards through expansive 60-plate monuments accommodating five years of monthly recognition. Magnetic plate options simplify updates by eliminating screws, though traditional mounted plates provide more permanent attachment preventing curious fingers from rearranging corporate history.

Expand your recognition program: Explore Award Plaques and Shop Additional Perpetual Engraving Plates for nameplate updates.

Frequently Asked Questions About Perpetual Plaques

How do organizations handle perpetual plaques after filling all available nameplate spaces?

Smart recognition programs anticipate this inevitable moment through capacity planning before mounting plaques permanently. Organizations typically choose between starting fresh with new plaques while archiving completed ones in alternate locations maintaining historical records, removing oldest nameplates to accommodate new winners creating rolling recognition windows, or expanding recognition by hanging additional plaques nearby forming gallery walls documenting decades of achievement. The replacement cycle depends on nameplate quantity and award frequency, with 24-plate versions supporting two years of monthly recognition before requiring decisions. Some programs deliberately select larger 45 or 60-plate configurations postponing capacity concerns for years, though massive plaques demand substantial wall space and may overwhelm smaller offices. Forward-thinking organizations photograph completed plaques before storage, maintaining digital archives ensuring past recipients remain documented even after physical displays move to storage rooms or executive offices.

What happens when someone wins the same perpetual award multiple times in non-consecutive periods?

Repeat winners present interesting chronological challenges since perpetual plaques document achievements sequentially rather than grouping by individual. Most organizations simply add new nameplates each time someone earns recognition, creating patterns where the same names appear multiple times throughout the display documenting their consistent excellence. This approach maintains historical accuracy showing exactly when achievements occurred while celebrating sustained performance visibly. Some programs add special indicators like stars or asterisks beside repeat winner names, though this requires custom engraving beyond standard nameplate formats. The visible repetition often becomes a point of pride for both individuals and organizations, with multiple appearances signaling exceptional sustained performance rather than recognition system failures. Observers scanning completed perpetual plaques can identify star performers instantly by spotting repeated names, creating informal hall of fame effects without requiring separate recognition tiers.

Should organizations choose magnetic plates or traditional mounted plates for perpetual plaques?

Magnetic plates offer undeniable convenience for organizations updating plaques monthly or correcting occasional engraving errors, eliminating screwdrivers and avoiding repeated drill marks from plate changes. They work beautifully in professional offices where adult supervision prevents tampering and in spaces where easy updates justify slightly higher costs. Traditional mounted plates suit settings requiring maximum security, including schools where curious students might rearrange magnetic displays during unsupervised hallway moments, high-traffic public areas where accidental bumps could dislodge plates, or organizations valuing the permanence symbolism of screwed-down achievement records. The practical difference matters less than perception in some environments where traditional mounting suggests greater prestige through its apparent permanence. Cost-conscious buyers appreciate traditional plates for their lower price points, while efficiency-focused administrators favor magnetic convenience despite premium pricing. Most suppliers offer both options across similar plaque styles, allowing organizations to match their specific security needs and update frequency against budget constraints.



If you need more information before deciding, see our expert resource section:
]]>
photoplaques champion-perpetual-trophies
custom-pageengravingplates1"4-7 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"105503-60.431251.18Classic Medallics1:22%,10:21%"Engraving"custom-pageengravingplates1"7-10 business days" "Marquette, MI" "UPS (FedEx available on request)"498554-620.005020.43RS Owens1:14%,10:16%Perpetual Plaque Replacement Plates For -RS Plaques from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.perpetual-2custom-pageengravingplates1"4-6 business days" "Marquette, Michigan" "UPS"498553-610.05020.43TrophyCentral1:14%,10:17%Find these Replacement Perpetual Name Plates (For TrophyCentral Plaques) Discounted at TrophyCentral.perpetual-3custom-pagetrophies-academic1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.4234Quick TrophyTrophies11:14%,3:15%,10:16%Shop for team, championship and perpetual School trophies at TrophyCentral. Each School trophy has enough room for 32 names and ships in just 1-2 days!qtacadperpAcademiccustom-pagetrophies-archery1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498852-311.4234Quick TrophyTrophies11:14%,3:15%,10:16%Shop for team, championship and perpetual Archery trophies at TrophyCentral. Each Archery trophy has enough room for 32 names and ships in just 1-2 days!qtarchperpSee more greatin a variety of styles.trophies-archeryArchery, Sportscustom-pagetrophies-dance1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498852-311.4234Quick TrophyTrophies1:14%,3:15%,10:16%"Dance Awards" "Dance Trophies"Shop for team, championship and perpetual Dancing trophies at TrophyCentral. Each Dancing trophy has enough room for 32 names and ships in just 1-2 days!qtdanceperpDancecustom-pagetrophies-darts1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498852-311.4234Quick TrophyTrophies1:14%,3:15%,10:16%Shop for team, championship and perpetual Darts trophies at TrophyCentral. Each Darts trophy has enough room for 32 names and ships in just 1-2 days!qtdartsperpReturn to oursection for more fabulous choices.trophies-dartsDartscustom-pagetrophies-equestrian-horse1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498852-311.4234Quick TrophyTrophies1:14%,3:15%,10:16%Shop for team, championship and perpetual Equestrian trophies at TrophyCentral. Each Equestrian trophy has enough room for 32 names and ships in just 1-2 days!qtequesperpReturn to thesection for other fabulous choices and styles.trophies-equestrian-horseEquestrian, Sportscustom-pagetrophies-lacrosse1perpetual trophies498852-311.4Trophies1Shop for team, championship and perpetual Lacrosse trophies at TrophyCentral. Each Lacrosse trophy has enough room for 32 names and ships in just 1-2 days!Lacrosse, Sportscustom-pagetrophies-motocross1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498852-311.4234Quick TrophyTrophies1:14%,3:15%,10:16%Shop for team, championship and perpetual Motocross trophies at TrophyCentral. Each Motocross trophy has enough room for 32 names and ships in just 1-2 days!qtmotoperpReturn to thesection for other great choices.trophies-motocrossMotocross, Sportscustom-pagetrophies-snowboarding1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498852-311.4234Quick TrophyTrophies1:14%,3:15%,10:16%Shop for team, championship and perpetual Snowboarding trophies at TrophyCentral. Each Snowboarding trophy has enough room for 32 names and ships in just 1-2 days!qtsnowboperpReturn to thesection for more details and choices.trophies-snowboardingSnowboarding, Sportscustom-pagechampion-perpetual-trophies1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"perpetual trophies105503-610.451 2 3 4 5 6 7 8 9110.85Classic MedallicsTrophies1:22%"Minuteman" "Special Picks"See this Silver Cup Award at discounted at TrophyCentral. Free Engraving.10-09-2011Cupcustom-pagetrophies-snowmobile1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.4234Quick TrophyTrophies1:14%,3:15%,10:16%Shop for team, championship and perpetual Snowmobile trophies at TrophyCentral. Each Snowmobile trophy has enough room for 32 names and ships in just 1-2 days!qtsnowmobperpReturn to oursection for additional choices and styles.trophies-snowmobileSnowmobilecustom-pagetrophies-soccer1"PC10=498552-311.4234Trophy CentralTrophies1"Soccer Awards" "Soccer Trophies" "Soccer Trophies and Medals"Perpetual Series Trophy - Soccer. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.1Soccer, Sportscustom-pagetrophies-softball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.4234Quick TrophyTrophies11:14%,3:15%,10:16%"Softball Awards" "Softball Trophies"Shop for team, championship and perpetual Team Softball trophies at TrophyCentral. Each Team Softball trophy has enough room for 32 names and ships in just 1-2 days!qtsoftperpSoftball, Sportscustom-pagequickshiptrophies-spelling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.4234Quick TrophyTrophies1:14%,3:15%,10:16%Find These Fabulous Spelling Bee Perpetual Series Trophies Discounted At TrophyCentral. Each Trophy Has Enough Room for 32 Names And ships In Just 1-2 Business Days!qtspellperpSee more greatin other unique styles.quickshiptrophies-spellingSpellingcustom-pagequickshiptrophies-spelling1perpetual trophies498551-31434TrophyCentralTrophies1Find this perpetual spelling trophy discounted at TrophyCentral. Each trophy has enough room for 32 names and ships in just 1-2 days! Features free engraving for main plate and first nameplate.custom-pagetrophies-drama1perpetual trophies498552-31234TrophiesMusic, Drama, Art, Dance1Shop for perpetual Star Performer trophies at TrophyCentral. Each trophy and award has enough room for 32 names and ships in just 1-2 days!mqt-star-p-perpDrama, Dance, Schoolcustom-pagequickshiptrophies-stock-car1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.4234Quick TrophyTrophies1:14%,3:15%,10:16%Shop for team, championship and perpetual Stock Car trophies at TrophyCentral. Each Stock Car trophy has enough room for 32 names and ships in just 1-2 days!qtstockperpReturn to thesection for other great choices.quickshiptrophies-stock-carcustom-pagetrophies-swimming-diving1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.4234Quick TrophyTrophies11:14%,3:15%,10:16%"Swimming Awards" "Swimming Trophies"Find these fabulous perpetual Swimming Team trophies at TrophyCentral. Each Swimming Team trophy has enough room for 32 names and ships in just 1-2 days!qtswimperpSee our other fabulousin a variety of sizes and styles.trophies-swimmingSwimming / Diving, Sportscustom-pagechampion-perpetual-trophies1"7-10 business days w/engraving" "Chicago, Illinois" "UPS (FedEx available on request)"perpetual trophies606307-101 3 230.45114.45RS Owens1:22%custom-pagetrophies-tennis1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.4234Quick TrophyTrophies11:14%,3:15%,10:16%"Tennis Awards" "Tennis Trophies"Shop for team, championship and perpetual Tennis trophies at TrophyCentral. Each Tennis trophy has enough room for 32 names and ships in just 1-2 days!qttennisperpTennis, Sportscustom-pagetrophies-funny-horses-rear1perpetual trophies498552-311.4Trophy CentralTrophies1Shop for team, championship and perpetual toilet bowl trophies at TrophyCentral. Each toilet bowl trophy has enough room for 32 names and ships in just 1-2 days!Toilet Bowlcustom-pagetrophies-track-field1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.4234Quick TrophyTrophies1:14%,3:15%,10:16%"Track Awards" "Track Trophies"Shop for team, championship and perpetual Track trophies at TrophyCentral. Each Track trophy has enough room for 32 names and ships in just 1-2 days!qttrackperpSee all of our fabulousin a large variety of styles and sizes.trophies-track-fieldcustom-pagecup-trophies-large-and-smalltr7218tr7219tr7220cup-trophy-pnoname3perpetual-trophieschamp-cup-tcgoat-award1cup-trophies-large-and-small1Get reusable awards. Perpetual trophies honor winners yearly. Free personalization, quality materials. Perfect for leagues. Fast shipping. Start shopping today!Perpetual Trophies and Awards Trophy Central carries a fabulous selection of perpetual awards in a variety of styles. Also see our Crystal Championship Trophies.

Trophies in this section include free engraving on the main plate and also on the first nameplate.

Shop with Confidence at Trophy Central

If you are looking to buy trophies online, look no further. Trophy Central has an industry-leading selection of perpetual, name, and cup awards that will fit any budget, all at discounted prices. Our top-rated representatives in New York and Michigan are happy to assist you with all of your needs. Trophy Central has been delivering smiles since 1999.

Order now and crown your champion with a perpetual cup. Join 100,000+ customers, including 370+ Fortune 500 companies, and 9,600+ schools who have trusted Trophy Central.

Frequently Asked Questions (FAQ)

🏆 What is a perpetual trophy?

A perpetual trophy is an award designed to be passed down from winner to winner over multiple events. These trophies are ideal for fantasy football and feature a large main plate with additional smaller plates that can be engraved with each year's champion.

🛠️ Can I add engraving to a perpetual trophy?

Yes! Our perpetual trophies come with a variety of plate engraving options, from names, logos, and even dates. You can customize the main plate and add engraved nameplates with different fonts to recognize each team.

📏 What sizes do perpetual trophies come in?

We offer perpetual name trophies in various sizes, from smaller plaque cup designs to large championship trophies. The number of engravable plates may vary depending on the size.

🎉 What events are perpetual trophies best for?

Our champion perpetual trophies are perfect for recurring team competitions like fantasy football, leagues, corporate awards, academic championships, and any other tournaments. These awards create a lasting tradition of excellence. Most fantasy football champions display their perpetual trophy year-round as a symbol of their victory.

🚚 How fast can I get my perpetual trophy?

Most of our trophies ship within 1-2 business days. If you require custom engraving, please allow extra time for personalization. Expedited shipping options are also available.

]]>
custom-pagetrophies-victory1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.4234Quick TrophyTrophies1:14%,3:15%,10:16%Shop for team, championship and perpetual Victory trophies at TrophyCentral. Each Victory trophy has enough room for 32 names and ships in just 1-2 days!qtvictperpReturn to the section for more fabulous choices.trophies-victoryGeneralcustom-pagetrophies-volleyball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.4234Quick TrophyTrophies1:14%,3:15%,10:16%"Volleyball Awards" "Volleyball Trophies"Shop for volleyball team, championship and perpetual trophies at TrophyCentral. Each perpetual volleyball trophy has enough room for 32 names and ships in just 1-2 days!qtvolleyperpReturn to oursection.Volleyball, Sportscustom-pagetrophies-wrestling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.4234Quick TrophyTrophies1:14%,3:15%,10:16%"Wrestling Awards" "Wrestling Trophies"Shop for wrestling team, championship and perpetual wrestling trophies at TrophyCentral. Each Wrestling trophy has enough room for 32 names and ships in just 1-2 days!qtwresperpSee our complete section of in a variety of styles and sizes.trophies-wrestlingWrestling, Sportscustom-pageengraved-frames1"3-4 business days" "Medina, MN" "UPS"personalized gifts553404-70.51247.3JDSGiftsEngraved Frames1:22%Personalized Blue Christmas Picture Frames from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.Engraved Framescustom-pageengraved-frames1"3-4 business days" "Medina, MN" "UPS"personalized gifts553404-70.51247.3JDSGiftsEngraved Frames1:22%Personalized Blue Holiday Picture Frames from TrophyCentral.Engraved Framescustom-pagepersonalizedleather-leathergifts1"4-7 w/initials or name, 10-14 w/logo , 3-5 business days for stock items, (rush service available for additional charge - please call)" "Secaucus, NJ" "UPS (FedEx available on request)"498554-710.451611.65JDS IndustriesGiftsLeather Gifts1"Leather Gifts" "Executive Gifts" "Leather Portfolio Cases" "Portfolio Cases" "Leather Portfolio Case"Find these Custom Bottle Openers discounted at TrophyCentral. Each Opener Features Your Personalized Message. No Minimum Quantity!Groomsmencustom-pagegifts-desk-general11"7-10 business days w/engraving" "Chicago, Illinois" "UPS (FedEx available on request)"606307-101 3 230.454822.05RS Owens1custom-pagecertificate-diploma-covers1logsetfordiplogoproof50"1-3 business days wo/imprinting, 8-14 days w/imprinting" "Columbia, South Carolina" "UPS (FedEx available on request)"diploma covers290631-31 2 3 230.4520020.45Certificate Source1:22%,100:39%custom-pagegifts-bridesmaid1"3-4 business days" "Medina, MN" "UPS (FedEx available on request)"personalized gifts553404-710.551212.55JDSGiftsBridesmaids / Groomsmen1:22%Find these fabulous Sterling Charm Bracelets discounted at TrophyCentral. TrophyCentral is known for its top-rated customer serviceBridesmaidscustom-pagetrophies-football1"3-4 business days" "Medina, MN" "UPS (FedEx available on request)"trophies553404-710.454834.05JDSGiftsGeneral Gifts1:22%,2:24%"Football Awards" "Fantasy Awards" "Fantasy Football" "New Products"Personalized Fantasy Football Champion Coaster Set. Ideal for leagues, schools, and tournaments. Fast shipping.Football, Sportscustom-pageengraved-frames1"3-4 business days" "Medina, MN" "UPS"personalized gifts553404-70.51247.3JDSGiftsEngraved Frames1:22%Find These Unique Personalized Green Holiday Picture Frames Discounted at TrophyCentral.Engraved Framescustom-pageengraved-frames1"3-4 business days" "Medina, MN" "UPS"personalized gifts553404-70.51247.3JDSGiftsEngraved Frames1:22%Personalized Green Stripes Holiday Picture Frames .Engraved Framescustom-pageengraved-frames1"3-4 business days" "Medina, MN" "UPS"personalized gifts553404-70.51247.3JDSGiftsEngraved Frames1:22%Personalized Holiday Surprises Picture Frames from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.Engraved Framescustom-pagegifts-bridesmaid1"4-7 w/initials or name, 10-14 w/logo , 3-5 business days for stock items, (rush service available for additional charge - please call)" "Secaucus, NJ" "UPS (FedEx available on request)"personalized gifts498553-610.451611.65JDS IndustriesGiftsLeather Gifts1"Leather Gifts" "Executive Gifts" "Executive Business Gifts" "Business Holiday Gifts" "Business Gifts" "Business Holiday Gifts" "Holiday Gifts" "Corporate Business Gifts" "Corporate Christmas Gifts" "Corporate Holiday Gifts" "Leather Portfolio Cases" "Portfolio Cases" "Leather Portfolio Case"Find personalized keychains discounted at TrophyCentral. Each keychain is customized just for you and is available in several colors.custom-pageclocks2071401-5405-5410-5wrpa745-10745-5755-5743-53010755-8743-83050306-5742-5301-5756-9305-5746-55014301-8551555051270101-51personalized-gifts1Find personalized leather gifts discounted at TrophyCentral. Each personalized leather gift features a name, monogram or initials for a special touch.Personalized & Custom Leather Gifts The above sections above include a large selection of personalized leather gifts that can be embossed with your initials or monogram. Leather gifts are organized by section, for example personalized passport jackets, wallets, briefcases, business card holders and more. Personalized leather gifts are appropriate for many occasions, including birthdays, holidays, graduation and business events.
Prices in many of the leather gift sections start at just a few dollars. All of the custom leather products we carry are discounted and are of a very high quality.]]>
custom-pagepersonalizedleather-leathergifts1"5-7 business days (Rush service may be available - please call to confirm)" "Indianapolis, IN" "UPS"462195-710.82020.8Cathys ConceptsGiftsLeather Gifts1Find Quality 2-piece Cosmetic Cases Set at TrophyCentral.12-31-2014Leather Giftscustom-pagegifts-bridesmaid1"4-7 w/initials or name, 10-14 w/logo , 3-5 business days for stock items, (rush service available for additional charge - please call)" "Secaucus, NJ" "UPS (FedEx available on request)"personalized gifts498554-710.451611.65JDS IndustriesGiftsLeather Gifts1"Leather Gifts" "Executive Gifts"Find these personalized journals discounted at TrophyCentral. Each journal features choice of color and is custom engraved for a special touch!custom-pagepersonalizedleather-leathergifts1"4-7 w/initials or name, 10-14 w/logo , 3-5 business days for stock items, (rush service available for additional charge - please call)" "Secaucus, NJ" "UPS (FedEx available on request)"498554-71 7 5 100.451611.65JDS IndustriesGiftsLeather Gifts1"Leather Gifts" "Executive Gifts" "Leather Portfolio Cases" "Portfolio Cases" "Leather Portfolio Case"Find these custom power banks discounted at TrophyCentral. Each charger features your personalized message! No minimums!Leather Gifts, Groomsmencustom-pagenamebadges1"10-14 business days w/engraving" "Chicago, Illinois" "UPS (FedEx available on request)"6063010-141 3 230.4624415.1RS Owens1custom-pagegroomsmengifts1"3-4 business days" "Medina, MN" "UPS (FedEx available on request)"personalized gifts553404-7112420.2JDSGiftsBridesmaids / Groomsmen1:22%,10:25%"Groomsmen Gifts" "Groomsman Gifts" "New Products"Personalized Major League Baseball Mug. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.gc645Bridesmaids / Groomsmencustom-pagetemp-medals1"4-7 business days" "Mt. Vernon, NY" "UPS"105503-6150301Find these fabulous personalized medals at TrophyCentral. Price includes the name of your school or organization imprinted on the front of the medal!personalized-medals-allcustom-pagegifts-desk-general1105503-610.4511218.451custom-pageengraved-frames1"3-4 business days" "Medina, MN" "UPS"personalized gifts553404-70.51247.3JDSGiftsEngraved Frames1:22%Personalized North Pole Holiday Picture Frames from TrophyCentral.Engraved Framescustom-pagecustomlapel1100"4 - 6 Weeks" "Mt. Vernon, N.Y." "UPS (FedEx available on request)"lapel pins1055028-4210.451200020.45Classic Medallicslapel-award-pinsGeneral1:30%,1000:56%"Custom Lapel Pins" "Custom Trading Pins" "Baseball Pins" "Football Pins" "Basketball Pins" "Soccer Pins" "Volleyball Pins" "Swimming Pins" "Tracking Pins"Find These Oval Shaped Custom Brass Lapel Pins Discounted at TrophyCentral. Add Your Own Artwork! Large Quantity Discounts!diestbrlapicustom-pagecustom-ribbons1verprinproof2100"5-7 business days, 14 business days with custom logo" "Topeka, Indiana" "UPS (Priority Mail also available)"ribbons465715-71 260.36Tower RibbonRibbons1:22%,500:31%,1000:46%,5000:60%Shop for Personalized Pinked-Top Ribbons at TrophyCentral. Fast Shipping on Personalized Ribbons - Great Choice of Colors.custom-pageengraved-frames1"3-4 business days" "Medina, MN" "UPS"personalized gifts553404-70.51247.3JDSGiftsEngraved Frames1:22%Personalized Red Holiday Picture Frames from TrophyCentral.Engraved Framescustom-pageblank-medals10medals498552-40.525033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%This medal features an engraveable front rim and a personalized front for your logo or artwork.custom-pageengraved-frames1"3-4 business days" "Medina, MN" "UPS"personalized gifts553404-70.51247.3JDSGiftsEngraved Frames1:22%Personalized Santa Holiday Picture Frames from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.Engraved Framescustom-pagegifts-bridesmaid1"3-4 business days" "Medina, MN" "UPS (FedEx available on request)"personalized gifts553404-710.452412.45JDSGiftsBridesmaids / Groomsmen1:22%"Jewelry Displays" "Jewelry Boxes" "Jewelry Display Cases" "Jewelry Cases" "Jewelry Display Boxes" "Jewelry Case" "Valentines Gifts" "Valentine's Gifts" "Valentine's Day Gifts" "Valentines Gift" "Valentine's Gift"Personalized Silver Plated Jewelry Boxes with Raised HeartBridesmaidscustom-pageengraved-frames1"3-4 business days" "Medina, MN" "UPS"personalized gifts553404-70.51247.3JDSGiftsEngraved Frames1:22%Personalized Snow Day Picture Frames from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.Engraved Framescustom-pageengraved-frames1"3-4 business days" "Medina, MN" "UPS"personalized gifts553404-70.51247.3JDSGiftsEngraved Frames1:22%"New Products"Personalized Snowcapes Picture Frames from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.Engraved Framescustom-pageengraved-frames1"3-4 business days" "Medina, MN" "UPS"personalized gifts553404-70.51247.3JDSGiftsEngraved Frames1:22%Personalized Snowflake Picture Frames from TrophyCentral.gc657Engraved Framescustom-pageengraved-frames1"3-4 business days" "Medina, MN" "UPS"personalized gifts553404-70.51247.3JDSGiftsEngraved Frames1:22%Personalized Snowflakes and Stripes Picture Frames. TrophyCentral is a Top-Rated Yahoo Merchant.Engraved Framescustom-pageengraved-frames1"3-4 business days" "Medina, MN" "UPS"personalized gifts553404-70.51247.3JDSGiftsEngraved Frames1:22%Personalized Stripes Holiday Picture Frames from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.Engraved Framescustom-pageweddingfavors1"7 business days with personalization" "Medina, MN" "UPS (FedEx available on request)"553404-710.454819.65JDSGifts1:22%Find These Personalized Unity Candles Discounted at TrophyCentral. Be Sure to See Our Complete Selection of Custom Wedding Favors!Bridesmaids / Groomsmencustom-pagepersonalized-giftsgroomsmengiftsgifts-bridesmaidweddingfavorsfd1005xxsiplkeychbrsicuchwohuwrpapeunca11Find personalized wedding gifts discounted at TrophyCentral. Shop for custom wedding favors, bridesmaids and groomsmen gifts. Fast 1-2 day shipping.

Engraved Wedding Gifts

We are engraving specialists. So if you need a special wedding gift, whether for the bride and groom or the members of your wedding party, you have come to the right place! Be sure to see our bridesmaid and groomsmen sections for special gifts in each of those categories.

Custom Wedding Favors & Gifts

TrophyCentral has a great selection of personalized gift ideas to help make a special day for the bride and groom even better! We have everything from money clips and cufflinks for him to lockets and jewelry boxes for her. Help the happy couple celebrate their wedding day in fashion. All of the custom wedding gifts in the section above include personalization in the price, and where appropriate, a gift box.

Shop with Confidence at TrophyCentral!

TrophyCentral has a huge selection that will fit any budget. . Have a question? Ask our experts in New York, Michigan, and online. They have been providing guidance since 1999!
]]>
custom-pagefreeawardcertificates1"Download Only"certificates49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Pet Adoption Award certificate templateFree-Pet-Adoption-Award-Certificatepet-adoption-awardPet Adoptioncustom-pageengraved-frames11personalized gifts105503-610.4511610.85Classic MedallicsGiftsEngraved Frames1:22%"Graduation Gifts" "Graduation Gift"Shop for Pewter "Congratulations" Frames from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.Engraved Framescustom-pagekeychains21105502-40.39125035.39Classic MedallicsGiftsKeychains1:22%,10:25%,25:32%,50:39%,100:47%Find these popular Pewter Firefighter Key Chains at TrophyCentral; discounted prices! Add Optional Engraving for a Special Touch!pk95-cmKeychainscustom-pagekeychains21105502-40.39125035.39Classic MedallicsGiftsKeychains1:22%,10:25%,25:32%,50:39%,100:47%Find these popular Pewter Team Mom Key Chains at TrophyCentral; discounted prices! Add Optional Engraving for a Special Touch!pk94-cm12-20-2040Keychainscustom-pagekeychains21105502-40.39125035.39Classic MedallicsGiftsKeychains1:22%,10:25%,25:32%,50:39%,100:47%"Volleyball Awards"Find these popular Pewter Volleyball Key Chains at TrophyCentral; discounted prices. Add Optional Engraving for a Special Touch!pk66-cmKeychains1105502-41Find these popular Pewter Key Chains, Available in a large number of subjects, discounted at TrophyCentral!pewter-keychain-allcustom-pagephotoplaques11plaques105503-610.4511626.051"Plaques" "Trophies and Plaques" "Plaques and Trophies"custom-pagesimenplaq8x10photo9x12photo7x9photopictureplaquecomingsoon8picplaqmotdapn60xxpn605xstanclocwitp1plaques1Personalized Designs & High-Quality Materials

Our photo plaques feature superior craftsmanship, including elegant walnut finish options that showcase your photos with stunning clarity and durability. Choose from multiple sizes to perfectly match your vision, whether honoring a dedicated team member or celebrating a championship team.

Each photo plaque includes a dedicated plate with free engraving to add personalized text and details. Every picture plaque in all sizes is designed to hang beautifully in offices, lobbies, or any display area.

Easy Customization & Quick Turnaround

Our streamlined ordering process makes creating your custom photo plaques simple and efficient, with clear price listings for every item and size option. Upload your photos, select your preferred design elements, and we'll handle the professional engraving with precision.

Volume discounts are available for larger orders, making it affordable to recognize entire teams with personalized award plaques or departments. Our picture plaques are ideal for recognizing employee achievements and team accomplishments at any award ceremony.

Why Choose Trophy Central for Your Custom Photo Plaques

Trophy Central delivers exceptional quality and service with decades of experience in creating memorable recognition products. Our commitment to craftsmanship ensures every picture plaque meets the highest standards, while competitive pricing and reliable delivery make us the preferred choice for organizations nationwide.

Customer satisfaction is guaranteed with our responsive support team, whether you're ordering a single employee award or photo plaques for an entire team. Every picture plaque we create is designed to hang proudly in any setting, with sizes to suit every space and budget.

Celebrate Special Moments with a Lasting Keepsake

Transform your most important moments into beautiful, lasting tributes that recipients will treasure for years to come. Whether recognizing outstanding performance, commemorating milestones, or creating memorial pieces, our custom photo plaques provide the perfect solution.

Shop our complete selection today and design your personalized recognition award with just a few clicks. Honor your employee of the month, celebrate team victories, or present award plaques that recipients will display with pride.

Frequently Asked Questions

Can I shop for picture plaques in bulk sizes?

Yes! When you shop our picture plaque selection, you can order products in any size with volume discounts available for larger quantities. Whether you need matching sizes for an entire department or varied sizes for different recognition levels, we offer flexible ordering options for all our products.

How do I shop for the right picture plaque size?

When you shop our products, each picture plaque displays available sizes with dimensions and pricing. Consider where you'll display the plaque. Desk photo plaques work well in smaller sizes, while wall displays shine in larger sizes. Our product descriptions include size recommendations to help you choose.

What's included with free engraving?

Free engraving on your picture plaque covers enough space on the included plate for names, team titles, or award details. Additional engraving options and premium plate upgrades are available at competitive prices.

Are photo plaques suitable for employee recognition programs?

Absolutely! Our photo plaques are perfect for employee of the month programs, team achievements, and award ceremonies. Each picture plaque includes a customizable plate for personalized recognition details.

]]>
simenplaq
custom-pagephotoplaques1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"plaques105503-610.451510.45Classic MedallicsPlaques1:22%Shop for Photo Sport Plaques from TrophyCentral. Free Engraving on Photo Plaques.custom-pageart-trophiesphotography-part-iphotography-single-iphotography-champ-iphotography-e-part-iphotography-e-single-iphotography-plaque-icup-photography-scb-icup-photography-inphotography-jigfphotography-jisfphotography-jibfphotography-mcphotography-mc-pr1trophies1Find photography trophies discounted at TrophyCentral. Each photography trophy includes free personalization and most ship in just 1-2 days.Why Choose Our Photography Trophies and Camera Awards? Our photography recognition trophies are ideal for schools, photography clubs, professional photo competitions, and camera enthusiasts looking to honor creative excellence. Each camera trophy features detailed inserts depicting vintage and modern photography equipment, making them perfect awards for portrait photography contests, landscape photography competitions, wildlife photography events, and sports photography tournaments. Perfect for:
  • High school and college photography class awards
  • Yearbook staff and journalism photography recognition
  • Camera club monthly competitions and annual shows
  • Photo contest winners at art galleries and community events
  • Photography workshop participant awards
  • Student photographer of the year trophies
  • Instagram and social media photography contest prizes
  • Wedding and portrait photography business employee recognition

What Makes Our Photography Awards Special:

Every trophy includes complimentary custom engraving with up to three lines of personalization at no extra cost. Add the photographer's name, competition category (such as "Best Portrait" or "Most Creative Composition"), and event details to create a meaningful keepsake they'll proudly display. From economy participation trophies perfect for rewarding all photography students to impressive champion's trophies for grand prize winners, our selection ensures you'll find the right photography award for every skill level and achievement.]]>
photography-medals star-trophies
custom-pagephotography-medals1medals498551-30.5100021TrophyCentralInsertsSports, Hobby, Org, Livestock1Find these fabulous Photography 2" epoxy-covered insert stickers discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Photographycustom-pagefree-sports-templates1"Download Only"certificates4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Photography template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Photography-Certificatephotography-freePhotographycustom-pagecoaching-teaching-guides11Discover 15+ creative photography award ideas with engraving examples. From Master of Light to Portrait Perfectionist, find the perfect way to recognize your photo club members and visual artists. Free engraving included.custom-pagesports-resource-hub11Discover the ultimate photography trophy and medal guide! From camera club competitions to professional contests, find creative award ideas that celebrate photographic excellence and artistic vision.custom-pageblog-trophycentral11Comprehensive guide to photography club recognition with 20 award categories for technical excellence, creative vision, dedication, and community contribution.custom-pagephotography-trophies-and-awards1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy photography column insert trophy features a choice of column color, a marble base and free trophy engraving.Photographycustom-pagephotography-trophies-and-awards1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Photography epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Photographycustom-pagephotography-trophies-and-awards1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Photography epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Photographycustom-pagephotography-trophies-and-awards1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Photography epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Photographycustom-pagephotography-trophies-and-awards1medals498551-30.525035.5TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these fabulous Photography insert medals discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Photographycustom-pagephotography-trophies-and-awards1medals498551-30.525035.5TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Photography insert medals with a personalized front rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Photographycustom-pagephotography-trophies-and-awards1plaques498551-311.1Plaques1Find these Photography insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Photography11Find photography medals in a variety of sizes and styles. Choose from several popular finishes, including gold, silver and bronze. Each photography award medal includes a ribbons. Fast 1-2 day shipping.Shop for Photography Award Medals with Ease Our photography medals are a perfect way to recognize photo contest winners, photography students or anyone you want to recognize. We have gold, silver and bronze medal frames for contests with multiple place winners.]]>photography-trophies-and-awardscustom-pagephotography-trophies-and-awards1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our photography insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Photographycustom-pagephotography-trophies-and-awards1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Photography single column insert trophy features a choice of column color, a marble base and free trophy engraving.Photographycustom-pagephotography-trophies-and-awards1trophies498551-311821.06TrophyCentraltrophies1Photographycustom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these high-quality Physical Fitness Inserts at TrophyCentral. Each Physical Fitness Insert can be used to create a unique plaque, medal or trophy.517334Physical Education
custom-pagemusic-certificate-templates1"Download Only"free-music49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Piano template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Piano-Certificatepiano-freePiano, Musiccustom-pagemusicartpins1plasticpinboxvelapinbox1"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsMusic, Drama, Art, Dance1:30%,50:34%,100:38%"Music Lapel Pins" "Band Lapel Pins" "Band Awards" "School Pins"Find These Piano Excellence Pins Discounted at TrophyCentral. Each Piano Excellence Lapel Pin features a clutch-back for safe attachment to clothing.br586Music / Band / Choruscustom-pagemusicartpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsMusic, Drama, Art, Dance1:22%,50:30%,100:33%,500:45%"Music Lapel Pins" "Band Lapel Pins" "Music Pins"Find These Piano Lapel Pins Discounted at TrophyCentral. Features a Clutch-Pin Back and Fast 1-2 Day Shipping!mp14Music / Band / Choruscustom-pagetrophies-music12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsMusic, Drama, Art, Dance1:22%,100:28%,500:34%,1000:45%"Music Awards" "Award Medals - All Subjects" "School Medals" "Music Medals"These inexpensive 1 1/4 inch Piano Medals offer a high quality, but low price for those on a tight budget.e984701-30-2019Music / Band / Chorus
custom-pagekeychains21105502-40.39125035.39Classic MedallicsGiftsKeychains1:22%,10:25%,25:32%,50:39%,100:47%Find these popular Pewter Piano Key Chains at TrophyCentral; discounted prices!pk96-cmKeychainscustom-pagequickshiptrophies-pickup1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:25%Fabulous Pick-up Truck Place Trophy with 1st, 2nd or 3rd Place Trim, Marble Base and Free Engraving. Ships in a fast 1-2 days!qtvintagepickupplcustom-pagepickleball-medals20medals498552-40.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find these colorful Pickleball 2" Epoxy-covered insert decals discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Pickleball, Sportscustom-pagepickleball-trophies1trophies498552-310.45Trophy CentralTrophies1Find this budget pickleball award trophy discounted at Trophy Central. Features a real marble base and plastic pickleball figure. Engraving is free. Fast 1-2 day shipping.Pickleball, Sportscustom-pagepickleball-templates1"Download Only"free-sports4985501Trophy CentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Men's Doubles Pickleball template is free and designed exclusively for Trophy Central. Award certificate templates measure 11" x 8 1/2" and can be easily downloaded and printed.pickleball-mens-doublespickleball-mens-doublesPickleball, Sportscustom-pagepickleball-templates1"Download Only"free-sports4985501Trophy CentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Men's Singles Pickleball template is free and designed exclusively for Trophy Central. Award certificate templates measure 11" x 8 1/2" and can be easily downloaded and printed.pickleball-mens-singlespickleball-mens-singlesPickleball, Sportscustom-pagepickleball-templates1"Download Only"free-sports4985501Trophy CentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Mixed Doubles Pickleball template is free and designed exclusively for Trophy Central. Award certificate templates measure 11" x 8 1/2" and can be easily downloaded and printed.pickleball-mixed-doublespickleball-mixed-doublesPickleball, Sportscustom-pagepickleball-templates1"Download Only"free-sports4985501Trophy CentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Women's Doubles Pickleball template is free and designed exclusively for Trophy Central. Award certificate templates measure 11" x 8 1/2" and can be easily downloaded and printed.pickleball-womens-doublespickleball-womens-doublesPickleball, Sportscustom-pagepickleball-templates1"Download Only"free-sports4985501Trophy CentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Women's Singles Pickleball template is free and designed exclusively for Trophy Central. Award certificate templates measure 11" x 8 1/2" and can be easily downloaded and printed.pickleball-womens-singlespickleball-womens-singlesPickleball, Sportscustom-pagepickleball-trophies1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Pickleball Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Pickleball, Sportscustom-pagepickleball-trophies1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Pickleball Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Pickleball, Sportscustom-pagepickleball-trophies1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Pickleball Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Pickleball, Sportscustom-pagepickleball-trophies1medals498552-30.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Colorful Pickleball Insert Medals Discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Pickleball, Sportscustom-pagepickleball-trophies1medals498552-40.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Pickleball Insert Medals With A Personalized Front Rim Discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Pickleball, Sportscustom-pagecherry-insert-plaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these pickleball insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Pickleball, Sportscustom-pagesports-pinsplastic-pinbox-t5lapel pins498551-20.525040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find these Gold Pickleball Enamel Lapel Pins discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.pickleball-u-pbPickleball11Find pickleball medals discounted at TrophyCentral. Each pickleball medal includes a free neck ribbon.Shop for Pickleball Award Medals With Ease At TrophyCentral We have a great selection, discounted prices and top-rated customer service to help with all of your pickleball award needs. Need help? Contact our expert team in Michigan, New York and online. Also see our Be sure to also see our main pickleball trophies section. If you need more information before deciding, see our expert resource section: ]]>pickleball-trophiescustom-pagepickleball-trophies1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our pickleball insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - PickleballPickleball, Sportscustom-pagepickleball-trophies1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy pickleball insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Pickleball, Sportscustom-pagepickleball-trophies1trophies498552-310.45Trophy CentralTrophies1Our pickleball participation trophies feature a real slant-front white marble base and free personalization. Significant quantity discounts available.Pickleball, Sportscustom-pagepickleball-trophies1plaques498552-41JDSPlaques1Find this pickleball plaque discounted at TrophyCentral. Our pickleball plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Pickleball, Sportscustom-pagepickleball-templatespickleball-award-plaquepickleball-plaque-i1trophies1Shop pickleball trophies, medals and plaques for every level of play. Hundreds of styles for players, leagues and tournaments. Free engraving. Fast shipping.🏆 Custom Pickleball Trophies and Awards TrophyCentral features a large selection, great prices and bulk discounts. We also have a great customer service team online and in Michigan and NY. Be sure to see our popular Single Column Pickleball Trophies, available in several sizes and with several different color columns, and our place trophies with a choice of 1st, 2nd or 3rd place trim. These awards are perfect for a match, league or club event. If you need more information before deciding, see our expert resource section: ]]>trophiescustom-pagepickleball-trophies1trophies498551-311821.06TrophyCentraltrophies1Pickleball, Sportscustom-pagepickleball-trophies1trophies498552-310.45Trophy CentralTrophies1Find this popular pickleball figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!Pickleball, Sportscustom-pagequickshiptrophies-pickup1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%This popular Pickup Truck Figure Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!qtvintagepickupyrcustom-pagetrophies-car-truckqtvintagepickupncqtvintagepickupscqtvintagepickupplqtvintagepickupyrqtvintagepickupttqtvintagepickupttwqtvintagepickup3cqtvintagepickupdmcup-vintagepickup-scbcup-vintagepickup-pmqtvintagepickupscb11Find a great selection of pickup truck trophies discounted at TrophyCentral. Each pickup truck trophy includes free personalization!

Shop with Confidence at TrophyCentral

We offer a huge selection, discounted prices and great customer service. Do you need help with some ideas or with ordering? Yes, we sell online, but we have real people who would love to help you! Feel free to call our customer service experts in Michigan, New York and online. TrophyCentral - delivering smiles since 1999!


]]>
quickshiptrophies-wheel racing-medals
custom-pagequickshiptrophies-pig1498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Find this budget pig award trophy discounted at Trophy Central. Features a real marble base and plastic pig figure. Engraving is free. Fast 1-2 day shipping.1quickshiptrophies-pigcustom-pagequickshiptrophies-pig1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with pig figure discounted at TrophyCentral. Includes free text engraving!cup-pig-pcustom-pagequickshiptrophies-pig1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:27%,100:32%Our popular Pig Figure Participation Trophies feature a real slant-front marble base and free personalization. Significant quantity discounts available.qtpignccustom-pagequickshiptrophies-pig1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Fabulous Pig Figure Trophy with choice of 1st, 2nd or 3rd place trim.qtpigplcustom-pagequickshiptrophies-pig1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%This popular Pig Figure Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!qtpigyrcustom-pagequickshiptrophies-pig1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these pig budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtpigscbcustom-pagequickshiptrophies-rabbitqtpigncqtpigscqtpigplqtpigyrqtpigttqtpigttwqtpig3cqtpigdmmqtpigscbcup-pig-pcup-pig-scbbdg-pig11Find Pig Trophies discounted at TrophyCentral. Each Pig (Hog) trophy includes engraving. Fast 1-2 day shipping.

Shop With Confidence at TrophyCentral

We offer a huge selection, discounted prices and top-rated customer service. Do you need help with some ideas or with ordering? Yes, we sell online, but we have real people who would love to help you! Feel free to call our customer service experts in Michigan, New York and online. TrophyCentral - delivering smiles since 1999!


]]>
quickshiptrophies-goat
custom-pagemedallion-inserts-general-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these quality Pigeons Flying Inserts (Litho) at TrophyCentral. Each Pigeons Flying Insert can be used to create a unique plaque, medal or trophy.502461General
custom-pageschool-pins1"1-2 business days" "Columbia, SC"lapel pins292121-31 2 3 230.65245.45Certificate Sourcelapel-award-pinsGeneral1:22%,50:28%,100:32%Find This Pin Presentation Box at TrophyCentral. This Box is Perfect for Displaying Your Favorite Pins.custom-pagetrophies-go-kartqtpinencqtpinescqtpinedmqtpineyrqtpineplqtpinettqtpinettwqtpine3cqtpinetrqtpineperpmqtpinescbcup-pine-pcup-pine-scbqsinplaqpinewoodbdg-pinewood1trophies1"Trophies"Don't forget to recognize your outstanding scouts. See our great selection of pinewood trophies. Each pinewood derby trophy includes engraving!Shop for Pinewood Derby Recognition Trophies with Ease and TrophyCentral! TrophyCentral has a great online selection of high quality trophies, discounted prices and free personalization. We also have a top-rated customer service team waiting to help you. Be sure to see our Scout Derby Participation Trophies, popular with younger children. Our Single Column Trophies with a derby racer figure is also a customer favorite. Find the perfect award to celebrate your scouts in categories like speed, creativity, best in show and sportsmanship. ]]>first-place-ribbons 1st-place-medalscustom-pagetrophies-pinewood-derby-scouts1trophies498552-311821.06TrophiesAcademic1Find this achievement cup trophy with pinewood derby figure discounted at TrophyCentral. Includes free text engraving!cup-pine-pPinewood Derbycustom-pagetrophies-pinewood-derby-scouts1498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Find this budget pinewood derby award trophy discounted at Trophy Central. Features a real marble base and plastic pinewood derby figure. Engraving is free. Fast 1-2 day shipping.1trophies-pinewood-derby-scoutsPinewood Derbycustom-pagefreeawardcertificates1"Download Only"certificates49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Pinewood Derby template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Pinewood-Derby-Certificatepinewood-derbyPinewood Derbycustom-pageblog-trophycentral11custom-pagetrophies-pinewood-derby-scouts1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-30.38150030Quick TrophyDog TagsSports, Hobby, Org, Livestock1:14%,10:15%Find these pinewood derby dog tags discounted at TrophyCentral. The price of each pinewood derby dog tag includes custom engraving and 24" chain!qtdogderbyPinewood Derbycustom-pageholographic-insert-plaques1"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498852-310.45811.6Quick TrophyPlaquesInsert1:14%,3:14%"Pinewood Derby Awards"See this stunning Pinewood Derby plaque and other Holographic Plaques at TrophyCentral.qsinplaqpinewoodPinewood Derbycustom-pagetrophies-pinewood-derby-scouts1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.453633.4Quick TrophyTrophiesAcademic1:14%,10:17%,25:23%,50:29%,100:34%Our popular Pinewood Derby participation trophies feature a real slant-front marble base and free engraving.qtpinencPinewood Derbycustom-pagetrophies-pinewood-derby-scouts1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.85Quick TrophyTrophiesAcademic1:14%,10:18%,50:22%,100:25%Find this popular pinewood derby figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!qtpineplPinewood Derby, 1st / 2nd / 3rd / Etc.custom-pagetrophies-pinewood-derby-scouts1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.85Quick TrophyTrophiesAcademic1:14%,10:18%,50:22%,100:25%Find these popular Pinewood Derby year trim trophies discounted at TrophyCentral. Available in multiple sizes and includes free engraving.qtpineyrPinewood Derbycustom-pagetrophies-table-tennis-ping-pong1498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Find this budget ping pong (table tennis) award trophy discounted at Trophy Central. Features a real marble base and plastic figure. Engraving is free. Fast 1-2 day shipping.1trophies-table-tennis-ping-pongTable Tennis / Ping Pong, Sportscustom-pagemascot-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Pirate Mascot Badges Discounted At TrophyCentral.mascotbadges-piratecustom-pagemascot-plaques1plaques498552-41JDSPlaques1Find this pirate plaque discounted at TrophyCentral. Our pirate mascot plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Mascotcustom-pagemascottrophies1"4-6 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511016.25Classic MedallicsTrophiesAcademic1:22%,5:24%,10:28%,50:32%"Mascot Awards"Buy this Pirate mascot trophy and other mascot awards at TrophyCentral.mt2016Mascotcustom-pagemascotinserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsMascots1Buy these quality Pirates Mascot Medal Inserts at TrophyCentral. Each Pirates Insert can be used to create a unique plaque, medal or trophy.489927Mascot
custom-pagetrophies-marksman-shooting-rifle1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy pistol insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.custom-pagehunting-shooting-medals1medals498551-30.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find these colorful Pistols 2" Epoxy-covered insert decals discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.custom-pagefreeawardcertificates1"Download Only"free-sports4985501Trophy CentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Pistols template is free and designed exclusively for Trophy Central. Pistols certificate templates measure 11" x 8 1/2" and can be easily downloaded and printed.pistols-certificatepistols-frHunting / Shootingcustom-pagehunting-shooting-medals1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Pistols Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.custom-pagehunting-shooting-medals1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Pistols Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.custom-pagehunting-shooting-medals1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Pistols Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.custom-pagenew-tc-color-medals1medals498551-30.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Colorful Pistols Insert Medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.custom-pagehunting-shooting-medals1medals498551-30.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Pistol Insert Medals With A Personalized Front Rim Discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.custom-pagecherry-insert-plaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these pistols insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.custom-pagetrophies-marksman-shooting-rifle1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our pistols insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - Pistolscustom-pagetrophies-marksman-shooting-rifle1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Pistols single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - Pistolscustom-pagetrophies-marksman-shooting-rifle1trophies498551-311821.06TrophyCentraltrophies1custom-page1st-place-medals1st-mc1st-mc-pr1st-mg2nd-mc2nd-ms3rd-mb3rd-mcir27e98xxtm9955gz98xxhonorable-mc1st-jigf3rd-jibf2nd-jisfhonorable-jisftm9967g4th-place-jisf4th-place-mc2nd-mc-pr3rd-mc-pr4th-place-mc-prhonorable-mc-prtm9956gtm9957gtm9958gtm9959gtm9960ghonorable-jigfhonorable-jibf1achievement-medals1Celebrate champions with 1st Place Medals in gold, silver, and bronze. Perfect for sports, academic, and competition winners. Ribbons included, fast shipping.place-medals

🥇 1st Place Medals & Championship Awards - Honor Your Winners

First place medals represent the ultimate recognition of championship performance and competitive excellence across sports tournaments, academic competitions, science fairs, spelling bees, field days, and athletic events of every level. As the definitive symbol of victory and achievement, gold medals and first place awards provide prestigious, tangible recognition that winners display with pride for years to come. These quality awards feature durable metal construction with traditional gold, silver, and bronze finishes, detailed designs celebrating specific sports and activities, and free neck ribbons in coordinating colors for immediate presentation. Available in multiple sizes from budget-friendly 1.25-inch economy medals to impressive 2.75-inch premium designs, first place medals accommodate every budget while maintaining professional quality and lasting durability. Perfect for recognizing tournament champions, relay race winners, top academic performers, spelling bee victors, science fair champions, field day first place finishers, or any competitive achievement deserving of top honors, these medals create memorable recognition moments that motivate continued excellence and celebrate the dedication required to reach the pinnacle of competitive success in any field of endeavor.

Expand your recognition program: Explore Olympic-Style Torch Medals and Explore Blue Ribbons for timeless achievement recognition. Learn more: Gold Medal History & Olympic Tradition.

Frequently Asked Questions About 1st Place Medals

What size medals are best for different age groups?

For younger children (ages 5-10), 1.25-inch economy medals work well as they're lighter and easier to wear. For teens and adults, 2-inch to 2.75-inch medals provide a more substantial and prestigious feel. Consider the event significance when choosing size - championship tournaments typically warrant larger, premium medals while participation events may use smaller, budget-friendly options.

Do all 1st place medals come with ribbons?

Yes, all our first place medals include a free neck ribbon for immediate presentation. Ribbons are available in multiple colors including traditional blue for first place, red for second, and white for third. You can also choose ribbon styles-standard neck ribbons for most events or drape-style ribbons for more formal ceremonies and championship presentations.

Can 1st place medals be engraved or personalized?

Many first place medals offer optional engraving on the back, allowing you to add participant names, event dates, competition names, or achievement details. Some medals feature personalized rims where you can add custom text around the edge. Insert medals allow you to customize the center with logos, graphics, or event-specific designs for truly unique recognition.

]]>
custom-pagetrophies1trophies498551-212Trophies1:14%,10:18%,50:22%,100:25%Find this popular column trophy with 1st, 2nd or 3rd place trim, marble base and free personalization discounted at TrophyCentral. Ships in a fast 1-2 days!custom-pagetrophies-gymnastics1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%"Gymnastics Awards" "Gymnastics Trophies" "Gymnast Trophies" "Gymnastics Trophy" "Gymnast Trophy"Find this popular gymnast figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!Gymnastics, 1st / 2nd / 3rd / Etc., Sportscustom-pagemedallion-inserts-general-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these quality Plain Wreath For Engraving Inserts (Litho) at TrophyCentral. Each Plain Wreath For Engraving Insert can be used to create a unique plaque, medal or trophy.507382General
11This popup shows sample colors for plaque fabric backing used in Waddell trophy cases. Choose a color to match your school or organizations branding.noindexed-items1TrophyCentralPlaquesSetup1:0%Plaques Proof from TrophyCentral.1custom-pagebadgeribbonsholders1"1-3 business days" "Topeka, Indiana" "UPS (FedEx available on request)"465711-31 260.36Tower RibbonRibbons1Find name badge holders at TrophyCentral. Each name badge holder is made of durable plastic. Fast 1-2 day shipping.custom-pagenoindexed-items11This page shows a sample of the 2" x 3" plastic badge holder from TrophyCentral. Each badge holder features a safety pin back.1custom-pagecup-trophies-large-and-smallqtcupncqtcupscqtcupdmqtcupyrqtcupplqtcupttqtcupttwqtcup3cmqtcupscbchamp-cup-tc11Shop for Plastic Cup Trophies from TrophyCentral. Each Cup Trophy Includes Free Engraving. Fast Shipping on Cup Trophies.cup-trophies-large-and-smallBe sure to see all of our fabulous

Shop for Cup Awards with Confidence at TrophyCentral

We offer a huge selection, discounted prices and top-rated customer service. Do you need help with some ideas or with ordering? Yes, we sell online, but we have real people who would love to help you! Feel free to call our customer service experts in Michigan, New York and online. TrophyCentral - delivering smiles since 1999!


]]>
custom-pagesoccerwaterbottles196"5-8 business days (rush service may be available for additional charge - please call)" "Los Angeles, CA" "UPS (FedEx available on request)"910105-810.453616.65Cosmo FiberPromotional ProductsWater Bottles1"PT=Promotional Products" "G=Him" "G=Her"Plastic Sports Bottles from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.Sports / Water Bottlescustom-pageribbons11muimse1woyoulipr100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Texas" "UPS (FedEx available on request)"7745310-1410.453618.45PepcoPromotional ProductsSpirit1Plastic Footballs. Ideal for leagues, schools, and tournaments. Fast shipping.Spiritcustom-pageghent-new-partitions14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Plastic Mobile Divider, Clear, 74"H x 38"W discounted at TrophyCentral.1Mobilenoindexed-items11"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)""PT1=105502-310.45729.09Classic MedallicsLapel PinsGeneral1:22%,50:30%,100:38%,500:47%"Custom Lapel Pins" "Lapel Pins, Custom" "Custom Trading Pins"Shop for Plastic Boxes at TrophyCentral. Perfect for any lapel pin. We offer free shipping on award orders over $100.custom-pageservicepins21"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"105502-310.4517211.25Classic Medallics1:22%,50:30%,100:38%,500:47%Plastic Pin Presentation Box: Protect your special lapel pin with this enclosed pin box from TrophyCentral.custom-pagebronze-stars1lapel-award-pins498551-310.457211.25TrophyCentrallapel-award-pins1:22%,50:30%,100:38%,500:47%This presentation pin box adds a special touch for presenting lapel pins. Made of plastic and measures: 1 1/4" x 1 1/4" x 7/8".custom-pagesoccerwaterbottlessportsbottles-goldsportsbottles-royalsportsbottles-redsportsbottles-whitesportsbottles-clear11"Basketball Water Bottles" "Logo Sports Bottles" "Sports Bottles" "Promotional Sports Bottles" "Aluminum Sports Bottles" "Stainless Water Bottles" "Aluminum Water Bottles" "Bike Water Bottles" "Bicycle Water Bottles" "Baseball Water Bottles" "Football Water Bottles" "Promotional Water Bottles" "Soccer Water Bottles"Find these plastic sports water bottles discounted at TrophyCentral. Each sports bottle includes a logo imprint. Perfect for soccer, baseball and more!11Find our Player Series Budget Trophies at TrophyCentral. Even at this great price, each budget trophy includes free engraving! Large quantity discounts available!Trophies to Recognize Participation These are TrophyCentral's most popular trophies and are often given to younger children. They have a great low price and a real marble base with a slant front so they don't feel cheap or light weight. Each participation trophy includes free personalization and most ship in just 1 to 2 business days (sometimes even the same day!)! ]]>custom-pagetrophies-cards-poker1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with cards figure discounted at TrophyCentral. Includes free text engraving!cup-cards-pcustom-pagetrophies-cards-poker1498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Find this budget cards (poker) award trophy discounted at Trophy Central. Features a real marble base and plastic 5 card poker hand figure. Engraving is free. Fast 1-2 day shipping.1custom-pagetrophies-cards-poker1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these cards budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtcardsscbcustom-pagecrystalgifts6"7-10 business days" "Kentucky" "UPS (FedEx available on request)"personalized gifts410187-1010.45416.45JcharlesGiftsCrystal Gifts1:22%,100:22%"personalized gifts"Balanced on one corner, our plaza crystal paperweight with logo takes on a dynamic appearance! Shop our discounted paperweights today!Crystal Giftscustom-pagemascotpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:36%,100:46%,500:52%"Mascot Awards"Find These Blue Jays Lapel Pins with Antique Finish Discounted at TrophyCentral! Also See Our Other Fabulous School Mascot Pins. Fast 1-2 Day Shipping!pm26Mascotcustom-pagemascotpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:36%,100:46%,500:52%"Mascot Awards"Find These Buffalo Lapel Pins with Antique Finish Discounted at TrophyCentral! Also See Our Other Fabulous School Mascot Pins. Fast 1-2 Day Shipping!pm2505-01-2019Mascotcustom-pagemascotpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:36%,100:46%,500:52%"Mascot Awards"Find These Bull Dog Lapel Pins with Antique Finish Discounted at TrophyCentral! Also See Our Other Fabulous School Mascot Pins. Fast 1-2 Day Shipping!pm28Mascotcustom-pagemascotpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:36%,100:46%,500:52%"Mascot Awards"Find These Cowboy Saddle Lapel Pins with Antique Finish Discounted at TrophyCentral! Also See Our Other Fabulous School Mascot Pins. Fast 1-2 Day Shipping!pm22Mascotcustom-pageeagle-lapel-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:36%,100:46%,500:52%"Mascot Awards"Find These Eagle Lapel Pins with Antique Finish Discounted at TrophyCentral! Also See Our Other Fabulous School Mascot Pins. Fast 1-2 Day Shipping!pm2310-15-2011Mascotcustom-pagemascotpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:36%,100:46%,500:52%"Mascot Awards"Find These Falcon Lapel Pins with Antique Finish Discounted at TrophyCentral! Also See Our Other Fabulous School Mascot Pins. Fast 1-2 Day Shipping!pm15Mascotcustom-pagemascotpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:36%,100:46%,500:52%"Mascot Awards"Find These Knight Lapel Pins with Antique Finish Discounted at TrophyCentral! Also See Our Other Fabulous School Mascot Pins. Fast 1-2 Day Shipping!pm27Mascotcustom-pagemascotpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:36%,100:46%,500:52%"Mascot Awards"Find These Trojan Lapel Pins with Antique Finish Discounted at TrophyCentral! Also See Our Other Fabulous School Mascot Pins. Fast 1-2 Day Shipping!pm18Mascotcustom-pagemascotpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:36%,100:46%,500:52%"Mascot Awards"Find These Viking Lapel Pins with Antique Finish Discounted at TrophyCentral! Also See Our Other Fabulous School Mascot Pins. Fast 1-2 Day Shipping!pm1711-28-2011Mascot1"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"105502-31500301"Mascot Awards"Shop for Mascot Pins at TrophyCentral. We have a great selection of Mascots, including: panther, knights, bobcats and more!1pm-mascot-pinscustom-pagetrophies-cards-poker11"2-4 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"trophies105503-60.39125035.39Classic MedallicsGiftsKeychains1:14%Find this popular Poker Keychain discounted at TrophyCentral. Available with a gold or silver finish and with optional engraving on back.12-20-2020custom-pagetrophies-cards-poker1plasticpinboxvelapinbox1"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsSports, Hobby, Org, Livestock1:30%,50:34%,100:38%"Cards Pins"These poker pins discounted at TrophyCentral. Each poker lapel pin features a clutch-back and quality finish.lapelpin12-20-2020custom-pagetrophies-cards-poker11"2-4 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"trophies105503-60.75130042.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,500:42%Find these fabulous Poker Medals at TrophyCentral. Each Poker Medal includes a free neck ribbon!pokermedalcustom-pagetrophies-cards-poker5"Engraved: 3-5 business days, Without engraving: 1-3 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"105503-60.5115014Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"School Medals" "School Award Medals" "Scholastic Medals" "Scholastic Award Medals" "Academic Medals" "Academic Award Medals" "Medals, School"Your students will love these colorful Mylar Poker Medals from TrophyCentral. Each Poker medal includes a neck ribbon!tm9862custom-pagetrophies-cards-poker11"2-4 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"plaques105503-610.4513629.25Classic MedallicsPlaquesEngraved Plaques1:22%Shop for Poker Plaques (5" x 7") from TrophyCentral.1"2-4 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"2-41Find a great selection of Poker Trophies at TrophyCentral. Each Poker Trophy and Award includes free engraving.poker trophies, poker trophy, poker awards, poker trophies and awards1custom-pagekeychains21105502-40.39125035.39Classic MedallicsGiftsKeychains1:22%,10:25%,25:32%,50:39%,100:47%Find these popular Pewter Police Officer Key Chains at TrophyCentral; discounted prices! Add Optional Engraving for a Special Touch!pk81-cmKeychainscustom-pagemedallion-inserts-occupational-subjects12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-31130025Classic MedallicsInsertsHero1:22%Buy these quality Police, GENERAL Inserts (Litho) at TrophyCentral. Each Police, GENERAL Insert can be used to create a unique plaque, medal or trophy.506691General
custom-pagesports-inserts1105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Pom Pom Girls Inserts (Litho) at TrophyCentral. Each Pom Pom Girls Insert can be used to create a unique plaque, medal or trophy.502591Cheerleading, Sportscustom-pagesports-resource-hub11Discover the most popular golf awards for tournaments including longest drive, closest to pin, hole-in-one recognition, and more. Complete guide with trophy selection tips and contest rules.12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
498555-8.521
12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
498555-8.521
custom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Natural Cork Bulletin Board Combo Board, Style A, 5'H x 10'W discounted at TrophyCentral.1spc510a-atr-bkNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Natural Cork Bulletin Board Combo Board, Style A, 5'H x 12'W discounted at TrophyCentral.1spc512a-v-181Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Natural Cork Bulletin Board Combo Board, Style A, 5'H x 16'W discounted at TrophyCentral.1spc516a-atr-cfNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Natural Cork Bulletin Board Combo Board, Style A, 5'H x 6'W discounted at TrophyCentral.1spc56a-atr-bkNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Natural Cork Bulletin Board Combo Board, Style A, 5'H x 8'W discounted at TrophyCentral.1Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Natural Cork Bulletin Board Combo Board, Style B, 5'H x 10'W discounted at TrophyCentral.1spc410e-atr-bkNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Natural Cork Bulletin Board Combo Board, Style B, 5'H x 12'W discounted at TrophyCentral.1spc412b-atr-bkNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Natural Cork Bulletin Board Combo Board, Style B, 5'H x 16'W discounted at TrophyCentral.1spc416b-v-183Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Natural Cork Bulletin Board Combo Board, Style B, 5'H x 6'W discounted at TrophyCentral.1Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Natural Cork Bulletin Board Combo Board, Style B, 5'H x 8'W discounted at TrophyCentral.1Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Natural Cork Bulletin Board Combo Board, Style C, 5'H x 10'W discounted at TrophyCentral.1spc410c-v-193Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Natural Cork Bulletin Board Combo Board, Style C, 5'H x 12'W discounted at TrophyCentral.1spc412c-v-183Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Natural Cork Bulletin Board Combo Board, Style C, 5'H x 16'W discounted at TrophyCentral.1spc416c-v-193Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Natural Cork Bulletin Board Combo Board, Style C, 5'H x 8'W discounted at TrophyCentral.1Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Natural Cork Bulletin Board Combo Board, Style D, 5'H x 10'W discounted at TrophyCentral.1spc410d-v-181Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Natural Cork Bulletin Board Combo Board, Style D, 5'H x 12'W discounted at TrophyCentral.1spc412d-atr-bkNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Natural Cork Bulletin Board Combo Board, Style D, 5'H x 16'W discounted at TrophyCentral.1Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Natural Cork Bulletin Board Combo Board, Style D, 5'H x 8'W discounted at TrophyCentral.1Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Natural Cork Bulletin Board Combo Board, Style E, 5'H x 10'W discounted at TrophyCentral.1pa33672vx-193Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Natural Cork Bulletin Board Combo Board, Style E, 5'H x 12'W discounted at TrophyCentral.1spc412e-kNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Natural Cork Bulletin Board Combo Board, Style E, 5'H x 16'W discounted at TrophyCentral.1spc416e-atr-bkNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Natural Cork Bulletin Board Combo Board, Style E, 5'H x 8'W discounted at TrophyCentral.1Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style A, 5'H x 10'W, Black discounted at TrophyCentral.1spc510a-atr-bkNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style A, 5'H x 10'W, Confetti discounted at TrophyCentral.1spc510a-atr-bkNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style A, 5'H x 10'W, Tan Speckled discounted at TrophyCentral.1spc510a-atr-bkNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style A, 5'H x 12'W, Black discounted at TrophyCentral.1spc512a-atr-tnNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style A, 5'H x 12'W, Confetti discounted at TrophyCentral.1spc512a-atr-tnNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style A, 5'H x 12'W, Tan Speckled discounted at TrophyCentral.1spc512a-atr-tnNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style A, 5'H x 16'W, Black discounted at TrophyCentral.1spc516a-atr-cfNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style A, 5'H x 16'W, Confetti discounted at TrophyCentral.1spc516a-atr-cfNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style A, 5'H x 16'W, Tan Speckled discounted at TrophyCentral.1spc516a-atr-cfNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style A, 5'H x 6'W, Black discounted at TrophyCentral.1spc56a-atr-bkNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style A, 5'H x 6'W, Confetti discounted at TrophyCentral.1spc56a-atr-bkNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style A, 5'H x 6'W, Tan Speckled discounted at TrophyCentral.1spc56a-atr-bkNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style A, 5'H x 8'W, Black discounted at TrophyCentral.1spc58a-atr-cfNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style A, 5'H x 8'W, Confetti discounted at TrophyCentral.1spc58a-atr-cfNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style A, 5'H x 8'W, Tan Speckled discounted at TrophyCentral.1spc58a-atr-cfNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style B, 5'H x 10'W, Black discounted at TrophyCentral.1spc410e-atr-bkNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style B, 5'H x 10'W, Confetti discounted at TrophyCentral.1spc410e-atr-bkNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style B, 5'H x 10'W, Tan Speckled discounted at TrophyCentral.1spc410e-atr-bkNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style B, 5'H x 12'W, Black discounted at TrophyCentral.1spc412b-atr-bkNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style B, 5'H x 12'W, Confetti discounted at TrophyCentral.1spc412b-atr-bkNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style B, 5'H x 12'W, Tan Speckled discounted at TrophyCentral.1spc412b-atr-bkNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style B, 5'H x 16'W, Black discounted at TrophyCentral.1spc416e-atr-bkNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style B, 5'H x 16'W, Confetti discounted at TrophyCentral.1spc416e-atr-bkNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style B, 5'H x 16'W, Tan Speckled discounted at TrophyCentral.1spc416e-atr-bkNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style B, 5'H x 6'W, Black discounted at TrophyCentral.1spc46b-atr-cfNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style B, 5'H x 6'W, Confetti discounted at TrophyCentral.1spc46b-atr-cfNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style B, 5'H x 6'W, Tan Speckled discounted at TrophyCentral.1spc46b-atr-cfNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style B, 5'H x 8'W, Black discounted at TrophyCentral.1spc48b-atr-tnNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style B, 5'H x 8'W, Confetti discounted at TrophyCentral.1spc48b-atr-tnNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style B, 5'H x 8'W, Tan Speckled discounted at TrophyCentral.1spc48b-atr-tnNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style C, 5'H x 10'W, Black discounted at TrophyCentral.1spc410c-atr-bkNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style C, 5'H x 10'W, Confetti discounted at TrophyCentral.1spc410c-atr-bkNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style C, 5'H x 10'W, Tan Speckled discounted at TrophyCentral.1spc410c-atr-bkNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style C, 5'H x 12'W, Black discounted at TrophyCentral.1spc412c-atr-cfNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style C, 5'H x 12'W, Confetti discounted at TrophyCentral.1spc412c-atr-cfNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style C, 5'H x 12'W, Tan Speckled discounted at TrophyCentral.1spc412c-atr-cfNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style C, 5'H x 16'W, Black discounted at TrophyCentral.1spc416c-v-193Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style C, 5'H x 16'W, Confetti discounted at TrophyCentral.1spc416c-v-193Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style C, 5'H x 16'W, Tan Speckled discounted at TrophyCentral.1spc416c-v-193Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style C, 5'H x 8'W, Black discounted at TrophyCentral.1spc48c-atr-cfNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style C, 5'H x 8'W, Confetti discounted at TrophyCentral.1spc48c-atr-cfNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style C, 5'H x 8'W, Tan Speckled discounted at TrophyCentral.1spc48c-atr-cfNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style D, 5'H x 10'W, Black discounted at TrophyCentral.1spc410d-atr-cfNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style D, 5'H x 10'W, Confetti discounted at TrophyCentral.1spc410d-atr-cfNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style D, 5'H x 10'W, Tan Speckled discounted at TrophyCentral.1spc410d-atr-cfNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style D, 5'H x 12'W, Black discounted at TrophyCentral.1spc412d-atr-bkNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style D, 5'H x 12'W, Confetti discounted at TrophyCentral.1spc412d-atr-bkNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style D, 5'H x 12'W, Tan Speckled discounted at TrophyCentral.1spc412d-atr-bkNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style D, 5'H x 16'W, Black discounted at TrophyCentral.1spc416d-atr-tnNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style D, 5'H x 16'W, Confetti discounted at TrophyCentral.1spc416d-atr-tnNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style D, 5'H x 16'W, Tan Speckled discounted at TrophyCentral.1spc416d-atr-tnNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style D, 5'H x 8'W, Black discounted at TrophyCentral.1spc48d-atr-cfNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style D, 5'H x 8'W, Confetti discounted at TrophyCentral.1spc48d-atr-cfNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style D, 5'H x 8'W, Tan Speckled discounted at TrophyCentral.1spc48d-atr-cfNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style E, 5'H x 10'W, Black discounted at TrophyCentral.1spc410e-atr-bkNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style E, 5'H x 10'W, Confetti discounted at TrophyCentral.1spc410e-atr-bkNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style E, 5'H x 10'W, Tan Speckled discounted at TrophyCentral.1spc410e-atr-bkNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style E, 5'H x 12'W, Black discounted at TrophyCentral.1spc412e-atr-tnNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style E, 5'H x 12'W, Confetti discounted at TrophyCentral.1spc412e-atr-tnNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style E, 5'H x 12'W, Tan Speckled discounted at TrophyCentral.1spc412e-atr-tnNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style E, 5'H x 16'W, Black discounted at TrophyCentral.1spc416e-atr-bkNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style E, 5'H x 16'W, Confetti discounted at TrophyCentral.1spc416e-atr-bkNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style E, 5'H x 16'W, Tan Speckled discounted at TrophyCentral.1spc416e-atr-bkNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style E, 5'H x 8'W, Black discounted at TrophyCentral.1spc48e-atr-tnNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style E, 5'H x 8'W, Confetti discounted at TrophyCentral.1spc48e-atr-tnNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Recycled Rubber Bulletin Board Combo Board, Style E, 5'H x 8'W, Tan Speckled discounted at TrophyCentral.1spc48e-atr-tnNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style A, 5'H x 10'W, Caramel discounted at TrophyCentral.1spc510a-v-181Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style A, 5'H x 10'W, Ebony discounted at TrophyCentral.1spc510a-v-181Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style A, 5'H x 10'W, Ivory discounted at TrophyCentral.1spc510a-v-181Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style A, 5'H x 10'W, Navy discounted at TrophyCentral.1spc510a-v-181Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style A, 5'H x 10'W, Ocean discounted at TrophyCentral.1spc510a-v-181Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style A, 5'H x 10'W, Silver discounted at TrophyCentral.1spc510a-v-181Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style A, 5'H x 10'W, Stone discounted at TrophyCentral.1spc510a-v-181Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style A, 5'H x 12'W, Caramel discounted at TrophyCentral.1spc512a-v-181Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style A, 5'H x 12'W, Ebony discounted at TrophyCentral.1spc512a-v-181Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style A, 5'H x 12'W, Ivory discounted at TrophyCentral.1spc512a-v-181Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style A, 5'H x 12'W, Navy discounted at TrophyCentral.1spc512a-v-181Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style A, 5'H x 12'W, Ocean discounted at TrophyCentral.1spc512a-v-181Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style A, 5'H x 12'W, Silver discounted at TrophyCentral.1spc512a-v-181Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style A, 5'H x 12'W, Stone discounted at TrophyCentral.1spc512a-v-181Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style A, 5'H x 16'W, Caramel discounted at TrophyCentral.1spc516a-v-193Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style A, 5'H x 16'W, Ebony discounted at TrophyCentral.1spc516a-v-193Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style A, 5'H x 16'W, Ivory discounted at TrophyCentral.1spc516a-v-193Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style A, 5'H x 16'W, Navy discounted at TrophyCentral.1spc516a-v-193Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style A, 5'H x 16'W, Ocean discounted at TrophyCentral.1spc516a-v-193Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style A, 5'H x 16'W, Silver discounted at TrophyCentral.1spc516a-v-193Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style A, 5'H x 16'W, Stone discounted at TrophyCentral.1spc516a-v-193Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style A, 5'H x 6'W, Caramel discounted at TrophyCentral.1spc56a-v-199Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style A, 5'H x 6'W, Ebony discounted at TrophyCentral.1spc56a-v-199Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style A, 5'H x 6'W, Ivory discounted at TrophyCentral.1spc56a-v-199Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style A, 5'H x 6'W, Navy discounted at TrophyCentral.1spc56a-v-199Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style A, 5'H x 6'W, Ocean discounted at TrophyCentral.1spc56a-v-199Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style A, 5'H x 6'W, Silver discounted at TrophyCentral.1spc56a-v-199Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style A, 5'H x 6'W, Stone discounted at TrophyCentral.1spc56a-v-199Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style A, 5'H x 8'W, Caramel discounted at TrophyCentral.1spc58a-v-181Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style A, 5'H x 8'W, Ebony discounted at TrophyCentral.1spc58a-v-181Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style A, 5'H x 8'W, Ivory discounted at TrophyCentral.1spc58a-v-181Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style A, 5'H x 8'W, Navy discounted at TrophyCentral.1spc58a-v-181Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style A, 5'H x 8'W, Ocean discounted at TrophyCentral.1spc58a-v-181Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style A, 5'H x 8'W, Silver discounted at TrophyCentral.1spc58a-v-181Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style A, 5'H x 8'W, Stone discounted at TrophyCentral.1spc58a-v-181Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style B, 5'H x 10'W, Caramel discounted at TrophyCentral.1spc410b-v-193Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style B, 5'H x 10'W, Ebony discounted at TrophyCentral.1spc410b-v-193Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style B, 5'H x 10'W, Ivory discounted at TrophyCentral.1spc410b-v-193Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style B, 5'H x 10'W, Navy discounted at TrophyCentral.1spc410b-v-193Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style B, 5'H x 10'W, Ocean discounted at TrophyCentral.1spc410b-v-193Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style B, 5'H x 10'W, Silver discounted at TrophyCentral.1spc410b-v-193Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style B, 5'H x 10'W, Stone discounted at TrophyCentral.1spc410b-v-193Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style B, 5'H x 12'W, Caramel discounted at TrophyCentral.1spc412b-v-181Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style B, 5'H x 12'W, Ebony discounted at TrophyCentral.1spc412b-v-181Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style B, 5'H x 12'W, Ivory discounted at TrophyCentral.1spc412b-v-181Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style B, 5'H x 12'W, Navy discounted at TrophyCentral.1spc412b-v-181Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style B, 5'H x 12'W, Ocean discounted at TrophyCentral.1spc412b-v-181Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style B, 5'H x 12'W, Silver discounted at TrophyCentral.1spc412b-v-181Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style B, 5'H x 12'W, Stone discounted at TrophyCentral.1spc412b-v-181Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style B, 5'H x 16'W, Caramel discounted at TrophyCentral.1spc416b-v-183Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style B, 5'H x 16'W, Ebony discounted at TrophyCentral.1spc416b-v-183Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style B, 5'H x 16'W, Ivory discounted at TrophyCentral.1spc416b-v-183Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style B, 5'H x 16'W, Navy discounted at TrophyCentral.1spc416b-v-183Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style B, 5'H x 16'W, Ocean discounted at TrophyCentral.1spc416b-v-183Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style B, 5'H x 16'W, Silver discounted at TrophyCentral.1spc416b-v-183Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style B, 5'H x 16'W, Stone discounted at TrophyCentral.1spc416b-v-183Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style B, 5'H x 6'W, Caramel discounted at TrophyCentral.1spc46b-v-183Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style B, 5'H x 6'W, Ebony discounted at TrophyCentral.1spc46b-v-183Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style B, 5'H x 6'W, Ivory discounted at TrophyCentral.1spc46b-v-183Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style B, 5'H x 6'W, Navy discounted at TrophyCentral.1spc46b-v-183Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style B, 5'H x 6'W, Ocean discounted at TrophyCentral.1spc46b-v-183Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style B, 5'H x 6'W, Silver discounted at TrophyCentral.1spc46b-v-183Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style B, 5'H x 6'W, Stone discounted at TrophyCentral.1spc46b-v-183Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style B, 5'H x 8'W, Caramel discounted at TrophyCentral.1spc48b-v-183Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style B, 5'H x 8'W, Ebony discounted at TrophyCentral.1spc48b-v-183Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style B, 5'H x 8'W, Ivory discounted at TrophyCentral.1spc48b-v-183Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style B, 5'H x 8'W, Navy discounted at TrophyCentral.1spc48b-v-183Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style B, 5'H x 8'W, Ocean discounted at TrophyCentral.1spc48b-v-183Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style B, 5'H x 8'W, Silver discounted at TrophyCentral.1spc48b-v-183Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style B, 5'H x 8'W, Stone discounted at TrophyCentral.1spc48b-v-183Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style C, 5'H x 10'W, Caramel discounted at TrophyCentral.1spc410c-v-193Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style C, 5'H x 10'W, Ebony discounted at TrophyCentral.1spc410c-v-193Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style C, 5'H x 10'W, Ivory discounted at TrophyCentral.1spc410c-v-193Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style C, 5'H x 10'W, Navy discounted at TrophyCentral.1spc410c-v-193Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style C, 5'H x 10'W, Ocean discounted at TrophyCentral.1spc410c-v-193Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style C, 5'H x 10'W, Silver discounted at TrophyCentral.1spc410c-v-193Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style C, 5'H x 10'W, Stone discounted at TrophyCentral.1spc410c-v-193Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style C, 5'H x 12'W, Caramel discounted at TrophyCentral.1spc412c-v-183Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style C, 5'H x 12'W, Ebony discounted at TrophyCentral.1spc412c-v-183Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style C, 5'H x 12'W, Ivory discounted at TrophyCentral.1spc412c-v-183Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style C, 5'H x 12'W, Navy discounted at TrophyCentral.1spc412c-v-183Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style C, 5'H x 12'W, Ocean discounted at TrophyCentral.1spc412c-v-183Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style C, 5'H x 12'W, Silver discounted at TrophyCentral.1spc412c-v-183Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style C, 5'H x 12'W, Stone discounted at TrophyCentral.1spc412c-v-183Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style C, 5'H x 16'W, Caramel discounted at TrophyCentral.1spc416c-v-193Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style C, 5'H x 16'W, Ebony discounted at TrophyCentral.1spc416c-v-193Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style C, 5'H x 16'W, Ivory discounted at TrophyCentral.1spc416c-v-193Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style C, 5'H x 16'W, Navy discounted at TrophyCentral.1spc416c-v-193Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style C, 5'H x 16'W, Ocean discounted at TrophyCentral.1spc416c-v-193Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style C, 5'H x 16'W, Silver discounted at TrophyCentral.1spc416c-v-193Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style C, 5'H x 16'W, Stone discounted at TrophyCentral.1spc416c-v-193Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style C, 5'H x 8'W, Caramel discounted at TrophyCentral.1spc48c-v-195Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style C, 5'H x 8'W, Ebony discounted at TrophyCentral.1spc48c-v-195Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style C, 5'H x 8'W, Ivory discounted at TrophyCentral.1spc48c-v-195Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style C, 5'H x 8'W, Navy discounted at TrophyCentral.1spc48c-v-195Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style C, 5'H x 8'W, Ocean discounted at TrophyCentral.1spc48c-v-195Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style C, 5'H x 8'W, Silver discounted at TrophyCentral.1spc48c-v-195Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style C, 5'H x 8'W, Stone discounted at TrophyCentral.1spc48c-v-195Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style D, 5'H x 10'W, Caramel discounted at TrophyCentral.1spc410d-v-181Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style D, 5'H x 10'W, Ebony discounted at TrophyCentral.1spc410d-v-181Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style D, 5'H x 10'W, Ivory discounted at TrophyCentral.1spc410d-v-181Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style D, 5'H x 10'W, Navy discounted at TrophyCentral.1spc410d-v-181Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style D, 5'H x 10'W, Ocean discounted at TrophyCentral.1spc410d-v-181Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style D, 5'H x 10'W, Silver discounted at TrophyCentral.1spc410d-v-181Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style D, 5'H x 10'W, Stone discounted at TrophyCentral.1spc410d-v-181Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style D, 5'H x 12'W, Caramel discounted at TrophyCentral.1spc412d-kNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style D, 5'H x 12'W, Ebony discounted at TrophyCentral.1spc412d-kNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style D, 5'H x 12'W, Ivory discounted at TrophyCentral.1spc412d-kNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style D, 5'H x 12'W, Navy discounted at TrophyCentral.1spc412d-kNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style D, 5'H x 12'W, Ocean discounted at TrophyCentral.1spc412d-kNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style D, 5'H x 12'W, Silver discounted at TrophyCentral.1spc412d-kNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style D, 5'H x 12'W, Stone discounted at TrophyCentral.1spc412d-kNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style D, 5'H x 16'W, Caramel discounted at TrophyCentral.1spc416d-v-193Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style D, 5'H x 16'W, Ebony discounted at TrophyCentral.1spc416d-v-193Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style D, 5'H x 16'W, Ivory discounted at TrophyCentral.1spc416d-v-193Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style D, 5'H x 16'W, Navy discounted at TrophyCentral.1spc416d-v-193Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style D, 5'H x 16'W, Ocean discounted at TrophyCentral.1spc416d-v-193Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style D, 5'H x 16'W, Silver discounted at TrophyCentral.1spc416d-v-193Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style D, 5'H x 16'W, Stone discounted at TrophyCentral.1spc416d-v-193Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style D, 5'H x 8'W, Caramel discounted at TrophyCentral.1spc48d-v-183Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style D, 5'H x 8'W, Ebony discounted at TrophyCentral.1spc48d-v-183Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style D, 5'H x 8'W, Ivory discounted at TrophyCentral.1spc48d-v-183Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style D, 5'H x 8'W, Navy discounted at TrophyCentral.1spc48d-v-183Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style D, 5'H x 8'W, Ocean discounted at TrophyCentral.1spc48d-v-183Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style D, 5'H x 8'W, Silver discounted at TrophyCentral.1spc48d-v-183Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style D, 5'H x 8'W, Stone discounted at TrophyCentral.1spc48d-v-183Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style E, 5'H x 10'W, Caramel discounted at TrophyCentral.1spc410e-v-183Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style E, 5'H x 10'W, Ebony discounted at TrophyCentral.1spc410e-v-183Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style E, 5'H x 10'W, Ivory discounted at TrophyCentral.1spc410e-v-183Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style E, 5'H x 10'W, Navy discounted at TrophyCentral.1spc410e-v-183Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style E, 5'H x 10'W, Ocean discounted at TrophyCentral.1spc410e-v-183Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style E, 5'H x 10'W, Silver discounted at TrophyCentral.1spc410e-v-183Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style E, 5'H x 10'W, Stone discounted at TrophyCentral.1spc410e-v-183Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style E, 5'H x 12'W, Caramel discounted at TrophyCentral.1spc412e-kNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style E, 5'H x 12'W, Ebony discounted at TrophyCentral.1spc412e-kNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style E, 5'H x 12'W, Ivory discounted at TrophyCentral.1spc412e-kNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style E, 5'H x 12'W, Navy discounted at TrophyCentral.1spc412e-kNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style E, 5'H x 12'W, Ocean discounted at TrophyCentral.1spc412e-kNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style E, 5'H x 12'W, Silver discounted at TrophyCentral.1spc412e-kNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style E, 5'H x 12'W, Stone discounted at TrophyCentral.1spc412e-kNot Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style E, 5'H x 16'W, Caramel discounted at TrophyCentral.1spc416e-v-181Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style E, 5'H x 16'W, Ebony discounted at TrophyCentral.1spc416e-v-181Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style E, 5'H x 16'W, Ivory discounted at TrophyCentral.1spc416e-v-181Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style E, 5'H x 16'W, Navy discounted at TrophyCentral.1spc416e-v-181Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style E, 5'H x 16'W, Ocean discounted at TrophyCentral.1spc416e-v-181Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style E, 5'H x 16'W, Silver discounted at TrophyCentral.1spc416e-v-181Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style E, 5'H x 16'W, Stone discounted at TrophyCentral.1spc416e-v-181Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style E, 5'H x 8'W, Caramel discounted at TrophyCentral.1spc48e-v-183Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style E, 5'H x 8'W, Ebony discounted at TrophyCentral.1spc48e-v-183Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style E, 5'H x 8'W, Ivory discounted at TrophyCentral.1spc48e-v-183Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style E, 5'H x 8'W, Navy discounted at TrophyCentral.1spc48e-v-183Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style E, 5'H x 8'W, Ocean discounted at TrophyCentral.1spc48e-v-183Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style E, 5'H x 8'W, Silver discounted at TrophyCentral.1spc48e-v-183Not Enclosedcustom-pagesmartpak-combination-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Porcelain Magnetic Whiteboard/ Vinyl Bulletin Board Combo Board, Style E, 5'H x 8'W, Stone discounted at TrophyCentral.1spc48e-v-183Not Enclosedcustom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these high-quality Power Lifting Inserts at TrophyCentral. Each Power Lifting Insert can be used to create a unique plaque, medal or trophy.517668Weightlifting, Sports
custom-pagetrophies-weightlifting-power1"1-4 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.05Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:16%Find These Popular Weightlifting Deluxe Platform Trophies Discounted at TrophyCentral. Real Marble; Free Engraving!qtliftdmWeightlifting, Sportscustom-pagemedallion-inserts-general-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these quality Praying Hands Inserts (Litho) at TrophyCentral. Each Praying Hands Insert can be used to create a unique plaque, medal or trophy.506701Religious
custom-pagequickshiptrophies-graduate1certificates290631-31 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,25:24%,100:40%,500:50%"Graduation Award" "Graduation Awards"Find this preschool certificate and other awards discounted at TrophyCentral. Preschool diploma certificates are beautifully printed; template measures 11 x 8 1/2 inches.971Pre-schoolcustom-pagequickshiptrophies-graduate102-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.5115014Classic Medallicsaward-medalsAcademic1:22%,25:24%,50:30%,100:36%,500:42%"School Medals" "School Award Medals" "Scholastic Medals" "Scholastic Award Medals" "Academic Medals" "Academic Award Medals" "Medals, School"Your students will love these colorful Preschool Graduation Medals from TrophyCentral. Each Preschool medal includes a neck ribbon!tm982805-25-2009Preschool
custom-pagegift-certificate-templates1"Download Only"certificates4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Gift Certificate template (design 2) is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.gift-certificate-design-2gift-certificate-a2Gift Certificate, Holidaycustom-pagegift-certificate-templates1"Download Only"certificates4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Gift Certificate template (design 5) is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.gift-certificate-design-5gift-certificate-a5Gift Certificate, Holiday, Christmascustom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these high-quality President's Award Inserts at TrophyCentral. Each President's Award Insert can be used to create a unique plaque, medal or trophy.51780112-20-2020General
custom-pagedisplaycases21medicapedestal1display case286125-1010.456108.45SpartaCraftDisplay CasesSpecialty Cases1:14%Buy this Presidential Display Case and other Flag Cases from TrophyCentral at discounted prices.Flag Casescustom-pageflagdisplay11286125-1010.453.45SpartaCraftDisplay CasesSpecialty Cases1:14%Presidential Display Cases: Pedestal from TrophyCentral.Flag Casescustom-pageflagdisplay11display case286125-1010.45660.45SpartaCraftDisplay CasesSpecialty Cases1:22%Find The Presidential Series Award Medal Display Case Discounted At TrophyCentral. Available In Cherry Or Walnut Finish.Ribbons / Medals Displaysnoindexed-items11Press Release from TrophyCentral. TrophyCentral is a Leading Online Supplier of Trophies and Awards.1custom-pagetrophy-award-guideschampionships-and-trophieshigh-school-academic-awardsbasketball-award-24high-school-football-2024amateur-tennis-2024-2025amateur-golf-2024-2025high-school-swimmingjames-beard-2024heisman-2024-2025high-school-track-awardscheerleading-2024spelling-bee-competitionsprestigious-science-awardsprestigious-music-awards11Have you ever wondered who won the most Masters or US Opens? Guess no more - our popular articles feature the major award winners across popular sports, hobbies and academics.custom-pagetop-awards-by-category11Explore the world of prestigious music awards, from the Grammys and Pulitzers to student competitions like All-State, YoungArts, and the Fischoff Chamber Music Competition.custom-pagetop-awards-by-category11Explore the world's most prestigious science awards, from the Nobel Prize to student science fairs. Learn their history, significance, and how they inspire future generations of scientists.custom-pageengraved-frames1"3-4 business days" "Medina, MN" "UPS"personalized gifts553404-70.51832.9JDSGiftsEngraved Frames1:22%Classic with a touch of contemporary, this grey-toned picture frame with white paisley accents looks great even in the most formal location. Lovingly adorned with appropriate words of friendship.gc742Engraved Framescustom-pageacademic-lamp-general12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105502-30.37115016.87Classic Medallicsaward-medalsAcademic1:22%,25:24%,50:30%,100:36%,500:42%Find this Principal's Award Antique Brass medal at TrophyCentral. Also see other great school and academic medals at discounted prices.Antique Brass Principal's Award MedalAcademic
custom-pageawardcertificates11certificates290631-31 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,25:24%,100:40%,500:50%Find these Principal's Certificates discounted at TrophyCentral. Each Principal's Certificate is beautifully printed and template measures 8 1/2 x 11.950Academiccustom-pageachievement-certificates-awards1"Download Only"free-academic4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Principal's Award template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Principal's-Award-Certificateprincipals-award-freeAcademic, Achievementcustom-pageschool-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:28%,100:32%,500:42%"School Pins" "School Lapel Pins"Find Principal's Award pins at TrophyCentral. Each AP Series Principal's Award pin includes a clutch back.ap72Academiccustom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these high-quality Principal's Award Inserts at TrophyCentral. Each Principal's Award Insert can be used to create a unique plaque, medal or trophy.518204General, Academic
custom-pageeawardmedals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsAcademic1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "School Medals"These inexpensive 1 1/4 inch Principal's Award Medals offer a high quality, but low price for those on a tight budget.e9930Academic
custom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these quality Mylar Principal's Award Decal Inserts at TrophyCentral. Each decal can be used to create a unique plaque, medal or trophy.489748Academic
custom-pageschool-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"Find these Principal's Award Pins at TrophyCentral. Each Principal's Award pin features a quality clutch back and ships in just 1-2 business days!br47102-20-2011Academiccustom-pageawardcertificates115"1-3 business days" "Columbia, South Carolina; Marquette, Michigan" "UPS (FedEx available on request)"certificates290631-21 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,50:38%,100:42%Find these Principal's certificates discounted at TrophyCentral. Each Principal's certificate measures 8 1/2 x 11 inches and typically ships in 1-2 days.7050Academiccustom-pageacademic-lamp-general102-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.5115014Classic Medallicsaward-medalsAcademic1:22%,25:24%,50:30%,100:36%,500:42%"School Medals" "School Award Medals" "Scholastic Medals" "Scholastic Award Medals" "Academic Medals" "Academic Award Medals" "Medals, School"Your students will love these colorful Mylar Principal's Medals from TrophyCentral. Each Principal's medal includes a neck ribbon!tm9748General, Academic
custom-pageschool-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:30%,100:35%,500:48%"School Pins" "School Lapel Pins"Find these popular Principal's Award HP Series Award Pins Discounted at TrophyCentral. Fast 1-2 Days Shipping!hp2210-31-2014Academiccustom-pageaward-ribbons-rosetteseventribbonsfunribbonsblue-ribbonsscoolribbonsrsubxxrsubxxcres6xx1esxstocawribwitflatstocpinrs2cx2dgsxresxrosetteribbonbaseball-ribbonsswimming-ribbonstrack-ribbonsbasketball-ribbonssoccer-ribbons11Find printed ribbons discounted at TrophyCentral. Choose from a huge number of printed ribbon subjects and colors. Fast 1-2 day shipping!award-ribbons-rosettes

Shop with Confidence at TrophyCentral!

If you are looking to buy stock or printed ribbons online, look no further! TrophyCentral has an industry-leading selection that will fit any budget. We also offer top-rated customer service. Our experts in New York, Michigan and online have been providing suggestions and guidance since 1999! To start shopping, click on an image above, or for personal service, call us toll-free at 1-888-809-8800.

]]>
custom-ribbons rosetteribbons
custom-pageweddingfavors12"7 business days with personalization" "Medina, MN" "UPS (FedEx available on request)"personalized gifts553404-710.45367.65JDSGifts1:22%,50:27%Greet each guest at your celebration with a glass of champagne they can take home as a keepsake. Choose from black, gold, silver, baby blue, or baby pink ink.Bridesmaids / Groomsmencustom-page12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
498555-8.52
custom-pagegifts-desk-general11"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"personalized gifts458221510.45416.45Vision AwardsGiftsEngraved Gifts1:22%,51:38%"New Products"Private Stock from TrophyCentral. Also see our great selection of engraved and personalized gifts!Engraved Giftscustom-pageaward-ribbons-printed10"1-2 business days" "Topeka, Indiana" "UPS (Post Office Priority Mail may also be available)"ribbons465711-21 263.00Tower RibbonRibbons1:22%,20:28%,50:34%,100:40%07-01-2022Blue Ribbon, Red Ribbon, Exhibitor, 1st / 2nd / 3rd / Etc., 4th Place, 5th Place, 6th Place, 7th Place, 8th Place, 9th Place, 10th Place, Honorable Mention, Participant, Achievement, Assistant, Chairman, Board Member, Best of Show, Chairperson, Co-Chairman, Co-Chairperson, Committee, Contestant, Director, Excellent, Exhibitor, Facilitator, Finalist, Grand Price, Good, Grand Champion, Hostess, Hospitality, Guest, Speaker, Host, Judge, Participation, Past President, Perfect Attendance, Official, Presenter, President, Press, Reserve Champion, Secretary, Treasurer, Staff, Steward, Sponsor, Usher, Vice President, Visitor, Volunteer, Winner, Meritcustom-pageglass-crystal-awards1"14 business days" "Erlanger, KY" "UPS"general410187-1010.451 2 3 4 5 6 7 8 9430.45JcharlesGeneral Awards1:22%,25:25%Allow achievements to shine brightly with our optical crystal Prizmas. These spectacular pieces feature bold geometric cuts and plenty of weight.05-05-2017custom-pagegroomsmengifts1"3-4 business days" "Medina, MN" "UPS (FedEx available on request)"personalized gifts553404-710.451230.45JDSGiftsBridesmaids / Groomsmen1:22%Find these fabulous Professional Poker Set discounted at TrophyCentral. TrophyCentral is known for its top-rated customer serviceGroomsmencustom-pagecrystalcups1"10 business days" "Kentucky" "UPS"general410187-1010.4512108.45J CharlesCrystal Awards1:22%,10:25%See this Strabane Biscuit Barrel at TrophyCentral. Discounted Prices and Quick Shipping.custom-pagegeneral-corporate-awards1"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"458221510.45224.45Vision AwardsTrophies1:22%,26:43% "General Recognition Awards" "Corporate Trophies"Progress Awards and Trophies from TrophyCentral. Discounted Trophies, Awards and Promotional Products.custom-pagemagnetic-dry-erase-boards145123110-171 3 4 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Proma Magnetic Porcelain Projection Whiteboard with Aluminum Frame, 3'H x 4'W discounted at TrophyCentral.1custom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Proma Magnetic Porcelain Projection Whiteboard with Aluminum Frame, 4'H x 4'W discounted at TrophyCentral.1custom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Proma Magnetic Porcelain Projection Whiteboard with Aluminum Frame, 4'H x 6'W discounted at TrophyCentral.1custom-pagemagnetic-dry-erase-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Proma Magnetic Porcelain Projection Whiteboard with Aluminum Frame, 4'H x 8'W discounted at TrophyCentral.111"3 1/2 - 4 1/2 weeks" "Greenfield, Ohio" "Truck (please allow 2-7 days for shipping)""PT4=45123128-421 3 4 5 6 7 8 9 10 22 230.451WaddellDisplay CasesTrophy Cases11Find this Prominence Floor-Standing Display from Waddell discounted at TrophyCentral.com. Measures 36"L x 30"H x 14"D.Wall-Mounted Cases11"3 1/2 - 4 1/2" weeks "Greenfield, Ohio" "Truck (please allow 2-7 days for shipping)""PT4=45123128-541 3 4 5 6 7 8 9 10 22 230.451WaddellDisplay CasesTrophy Cases11This this Prominence Spotlight Series Display from Waddell discounted at TrophyCentral.com.prspse1Floor-Standing11"3 1/2 - 4 1/2 weeks" "Greenfield, Ohio" "Truck (please allow 2-7 days for shipping)""PT4=45123128-541 3 4 5 6 7 8 9 10 22 230.451WaddellDisplay CasesTrophy Cases11This this 48 x 72 x 18 Prominence Spotlight Series Display Case from Waddell Discounted at TrophyCentral.com.prspseFloor-Standingcustom-pagedo-not-erase11105502-4111Click here if you need to see a proof for your custom football artwork. Proofs enable you to confirm the look is exactly what you want.1custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these quality Public Speaker Classic Inserts (Litho) at TrophyCentral. Each Public Speaker Classic Insert can be used to create a unique plaque, medal or trophy.504251General, Business
custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these quality Public Speaker Modern Inserts (Litho) at TrophyCentral. Each Public Speaker Modern Insert can be used to create a unique plaque, medal or trophy.501401General
custom-pagename-badges-tagswoyoulipr100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Pumpkin Badges Discounted At TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.namebadges-pumkincustom-pagetrophies-golf1"3-6 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"trophies105503-610.611815Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,3:22%"Golf Awards"Golf, Sportscustom-pagecrystalgifts6"7-10 business days" "Kentucky" "UPS (FedEx available on request)"personalized gifts410187-1010.4569.45JcharlesGiftsCrystal Gifts1:22%,100:22%"personalized gifts"Find this Pyramid Paperweight at TrophyCentral. Add engraving to your paperweight for a special touch!Crystal Giftscustom-page111TrophyCentral's QR code generator is free. Add your logo and even create QR codes for engraving. Create QR codes for events, marketing and more!custom-pagecorporatepinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsBusiness1:30%,50:32%,100:35%,500:39%Find these Quality - A Continuous Process Pins discounted at TrophyCentral. Each lapel pin features a high-quality finish and clutch back.br524Businesscustom-pageeawardmedals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsGeneral1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "School Medals" "General Award Medals"These inexpensive 1 1/4 inch Quality Medals offer a high quality, but low price for those on a tight budget.e9211General, Business, Academic
11"7 Business Days" "Greenfield, Ohio" "Truck (please allow 2-7 days for shipping)""PT4=45123128-541 3 4 5 6 7 8 9 10 220.451WaddellDisplay CasesTrophy Cases11"Quick-Ship Items"Find this Waddell 512 Quantum Display Case discounted at TrophyCentral. TrophyCentral is a top-rated online merchant.qu513todiFloor-Standing11"7 Business Days" "Greenfield, Ohio" "Truck (please allow 2-7 days for shipping)""PT4=45123128-541 3 4 5 6 7 8 9 10 220.451WaddellDisplay CasesTrophy Cases11"Quick-Ship Items"Find this Waddell Quantum Display Case discounted at TrophyCentral.comqu513todicaFloor-Standingcustom-pageribbons1-tiaras1"1-3 business days" "Topeka, Indiana" "UPS (FedEx available on request)"465711-21 260.8244.4Tower RibbonSashes / Crowns / TiarasTiaras1:22%Wear This Stylish Queen Tiara To Your Event With Pride! Queen Tiaras ship In Just 1-2 Business Days! TrophyCentral Is A Top-Rated Yahoo Merchant.rtp6622custom-pagetrophies-academic1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75219Quick TrophyTrophiesAcademic1:14%,3:19%,10:27%Find these fabulous Academic Figure Champions Line 3-column Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qtacadttAcademiccustom-pagetrophies-bmx1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous BMX Champions Line 3-column Trophies discounted online at TrophyCentral. Free Engraving and Quick 1-2 day shipping!qtbmxttBMXcustom-pagetrophies-bocce-ball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous Bocce Ball Figure Champions Line 3-column Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qtboccettBoccecustom-pagetrophies-boxing1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous Boxing Champions Line 3-column Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qtbox3cBoxingcustom-pagequickshiptrophies-camero1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.4226Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:18%,10:23%Find these fabulous Camaro Champions Line 3-column Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qtcamaro3ccustom-pagetrophies-cricket1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous Cricket Champions Line 3-column Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qtcrick3cCricketcustom-pagetrophies-curling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous Curling Champions Line 3-column Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qtcurl3cCurling, Sportscustom-pageclocks11"3-5 business days w/engraving" "Brewster, New York" "UPS (FedEx available on request)"personalized gifts498553-510.45510.45JDS-S1:22%custom-pagetrophies-baseball1trophies498552-311.418Trophy CentralTrophiesSports, Hobby, Org, Livestock1Quick-Ship Two-Tier 3-Column Trophy - Baseball Glove. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Baseball / T-Ball, Golden Glovecustom-pagetrophies-baseball1trophies498552-311.41824 16 12Trophy CentralTrophiesSports, Hobby, Org, Livestock1"Baseball Trophies and Medals" "Baseball Medals and Trophies" "Baseball Awards" "Baseball Trophies" "Cheap Baseball Trophies" "Buy Baseball Trophies" "Purchase Baseball Trophies"Quick-Ship Two-Tier 3-Column Baseball Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Baseball / T-Ball, Sportscustom-pagetrophies-basketball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Quick-Ship Two-Tier 3-Column Trophy - Basketball. Ideal for leagues, schools, and tournaments. Fast shipping.qtbask3cBasketball, Sportscustom-pagetrophies-funny-horses-rear1"1-4 (typically 1-2) business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-411.418Quick TrophyTrophiesGeneral1:14%,3:19%,10:24%"Gag Trophies" "Gag Trophy" "Joke Trophies" "Joke Trophy" "Funny Trophies" "Funny Trophy"Find these fabulous Horses-Rear Line Champions Line 3-Column Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qthorse3cFunny / Gagcustom-pagetrophies-soccer1trophies498552-311.418Trophy CentralTrophiesSports, Hobby, Org, Livestock1"Soccer Trophies" "Cheap Soccer Trophies" "Buy Soccer Trophies" "Purchase Soccer Trophies" "Discount Soccer Trophies" "Soccer Awards"Quick-Ship Two-Tier 3-Column Trophies - Soccer. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagetrophies-golf1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-411.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%"Hole-in-One Awards"Find these fabulous Hole-in-One 3-column Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qthole3c1-10-2022Golf, Sports, Hole-In-Onecustom-pagetrophies-baseball1trophies498552-310.75219Trophy CentralTrophiesSports, Hobby, Org, Livestock1"Baseball Trophies and Medals" "Baseball Medals and Trophies" "Baseball Trophies" "Cheap Baseball Trophies" "Buy Baseball Trophies" "Purchase Baseball Trophies" "Discount Baseball Trophies" "Baseball Trophies" "Baseball Trophy"Quick-Ship Two-Tier Trophy with Baseball Figure. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Baseball / T-Ball, Sportscustom-pagetrophies-dance1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75219Quick TrophyTrophiesMusic, Drama, Art, Dance1:14%,3:19%,10:27%"Dance Trophy" "Trophies, Dance" "Dancing Trophies" "Trophies, Dancing"Find these two-tier Couples Dancing Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtdancettDancecustom-pagetrophies-funny-horses-rear1"1-4 (typically 1-2) business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.75219Quick TrophyTrophiesGeneral1:14%,3:19%,10:27%"Gag Trophies" "Gag Trophy" "Joke Trophies" "Joke Trophy" "Funny Trophies" "Funny Trophy"Find these fabulous two-tier Horses-Rear Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qthorsettFunny / Gagcustom-pagequickshiptrophies-wheel1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:26%Find these fabulous two-tier Winged Wheel Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtwingedwheeltt03-15-2022custom-pagetrophies-bowling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%"Bowling Trophies" "Trophies, Bowling" "Bowling Trophy" "Bowling Awards"Find these fabulous Bowling Figure Two Tier Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qtbowlttBowlingcustom-pageletter-shaped-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find these popular R-shaped custom mascot badges at TrophyCentral. Great for fundraising! TrophyCentral is a top-rated Yahoo merchant.letterbadges-rcustom-pagequickshiptrophies-rabbit1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with bunny rabbit figure discounted at TrophyCentral. Includes free text engraving!cup-rabbit-pcustom-pagequickshiptrophies-rabbit1498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Find this budget rabbit award trophy discounted at Trophy Central. Features a real marble base and plastic rabbit figure. Engraving is free. Fast 1-2 day shipping.1quickshiptrophies-rabbitRabbit, Farmcustom-pagequickshiptrophies-rabbit1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:27%,100:32%Our popular Rabbit Figure participation trophies feature a real slant-front marble base and free engraving.qtrabbitnccustom-pagequickshiptrophies-rabbit1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these bunny rabbit budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtrabbitscbcustom-pagequickshiptrophies-chickenqtrabbitncqtrabbitscqtrabbitplqtrabbityrqtrabbitttqtrabbitttwqtrabbit3cqtrabbitdmmqtrabbitscbcup-rabbit-scbcup-rabbit-pbdg-rabbit11Find Rabbit Trophies discounted at TrophyCentral. Each Rabbit Trophy includes free engraving. Fast 1-2 day shipping.

Shop With Confidence at TrophyCentral

We offer a huge selection, discounted prices and fast shipping. Do you need help with some ideas or with ordering? Yes, we sell online, but we have real people who would love to help you! Feel free to call our customer service experts in Michigan, New York and online. TrophyCentral - delivering smiles since 1999!


]]>
custom-pagequickshiptrophies-rabbit1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.05Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%Find This Popular Bunny Rabbit Deluxe Platform Series Trophy Discounted at TrophyCentral. Features A Real Marble Base And Free Personalization!custom-pagequickshiptrophies-rabbit1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:25%Fabulous Rabbit Trophy with choice of 1st, 2nd or 3rd place trim.qtrabbitplcustom-pagequickshiptrophies-rabbit1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:25%This popular Rabbit Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!qtrabbityrcustom-pagemedallion-inserts-general-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these quality Rabbits Inserts (Litho) at TrophyCentral. Each Rabbits Insert can be used to create a unique plaque, medal or trophy.501811
custom-pageracing-medals20498551-30.5100021TrophyCentralInsertsSports, Hobby, Org, Livestock1Find these colorful Racing 2" Epoxy-covered inserts discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Racing, Sportscustom-pageracing-trophies-awards1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy racing column insert trophy features a choice of column color, a marble base and free trophy engraving.Racing, Sportscustom-pagetrophies-car-truck1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-30.38150030Quick TrophyDog TagsSports, Hobby, Org, Livestock1:14%,10:15%Find These Racing Dog Tags Discounted At TrophyCentral. Price Includes Engraving And Choice of 6 colors!Shop for Sports Dog Tags at TrophyCentral. Each Sports Tag Can Be Engraved.qtdogracecustom-pageracing-medals1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Racing Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Racing, Sportscustom-pageracing-medals1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Racing Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Racing, Sportscustom-pageracing-medals1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Racing Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Racing, Sportscustom-pagetrophies-car-truck1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511230.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,6:23%,12:24%,24:26%"Racing Awards" "Car Racing Awards"Find This Racing Flags Cast Stone Racing Trophy Discounted at TrophyCentral. Price Includes 3 Lines of Engraving!tr9926custom-pageracing-medals1medals498551-30.525035.5TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these colorful Racing insert medals discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Racing, Sportscustom-pageracing-medals1medals498551-30.525035.5TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Racing insert medals with a personalized front rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Racing, Sportscustom-pageracing-trophies-awards1plaques498551-311.11623.5TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these racing insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Racing, Sportscustom-pageracing-medals50medals9303310-May1Simba Calaward-medals1These 2 1/2 inch custom racing medals come with an outer-ring which allows you to add your school or league name, date and location.Racing, Sportscustom-pagetrophies-pinewood-derby-scoutsrace-qcmracing-jigfracing-jisfracing-jibfracing-mcracing-mc-prtm9913g11Find racing medals discounted at TrophyCentral. Choose from gold, silver, bronze and other popular finishes. Each racing medal features a free neck ribbon. Shop for Racing Award Medals with Ease at TrophyCentral Find a great selection of high quality medals at discounted prices. We also offer top-rated customer service. Be sure to see our related categories, including Safe Driving and Stock Car Racing.]]>racing-trophies-awardscustom-pageracing-trophies-awards1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our racing insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Racing, Sportscustom-pageracing-trophies-awards1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy racing insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Racing, Sportscustom-pageracing-trophies-awards1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Racing single column insert trophy features a choice of column color, a marble base and free trophy engraving.Racing, Sportscustom-pagetrophies-go-kartracing-part-iracing-single-iracing-champ-iracing-e-part-iracing-e-single-iracing-plaque-icup-racing-scb-i1trophies1Find a great selection of racing trophies discounted at TrophyCentral. Each racing trophy includes free personalization! Also see our racing medals and other awards!Shop With Ease For Custom Racing Recognition Trophies, Medals & Awards At TrophyCentral, we have a great selection, low prices and top-rated customer service. Have a question? Our experts in Michigan, NY and online would be happy to help you! Be sure to see our Related Categories featuring other racing awards, such as Safe Driver, Stock Car and other popular designs.]]>trophies racing-medalscustom-pagepickleball-trophiesqtraqtncqtraqtscqtraqtdmqtraqtyrqtraqtplqtraqtttqtraqtttwqtraqt3cmqtramqtscbcup-racup--scbcup-racup--p1trophies1"Sports Trophies"Racquetball Trophies from TrophyCentral. Most Trophies Ship in 1-2 Days and Include Engraving!Custom Racquetball Recognition Trophies TrophyCentral has a great online selection of discounted racquetball trophies to meet all of your needs. Be sure to see our racquetball participation trophies, popular with younger children. Our single column trophies with racquetball figures are also a customer favorite. All of our subject trophies include up to three lines of free personalization (larger awards include additional lines).]]>custom-pagetrophies-racquetball1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%,25:23%,50:29%,100:34%Our popular Racquetball participation trophies feature a real slant-front marble base and free engraving.qtraqtncRacquetball, Sportscustom-pagetrophies-racquetball1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular racquetball figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!qtraqtplRacquetball, 1st / 2nd / 3rd / Etc., Sportscustom-pagetrophies-racquetball1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%This popular Racquetball Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!qtraqtyrRacquetball, Sportscustom-pageribbons111465711-21 260.452420.85Tower RibbonRibbonsGeneral1:22%"School Products" "Quick-Ship Items"custom-pagestar-pinsbr199gbr199bbr199s11Find These Popular 3/4 Inch Raised Star Pins Are Discounted At TrophyCentral!star-pinscustom-pagemascotpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:36%,100:46%,500:52%"Mascot Awards"Find These Ram Lapel Pins with Antique Finish Discounted at TrophyCentral! Also See Our Other Fabulous School Mascot Pins. Fast 1-2 Day Shipping!pm10Mascotcustom-pagemascot-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Ram Mascot Badges Discounted At TrophyCentral.mascotbadges-ramcustom-pagemascot-plaques1plaques498552-41JDSPlaques1Find this ram plaque discounted at TrophyCentral. Our ram mascot plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Mascot1"4-6 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)""PT1=Trophies" "PC11=105503-610.451016.25Classic MedallicsTrophiesAcademic1:22%,5:24%,10:28%,50:32%"Mascot Awards"Buy this Ram mascot trophy and other mascot awards at TrophyCentral.mt201912-20-2020Mascotcustom-pagemascotinserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsMascots1Buy these quality Rams Mascot Medal Inserts at TrophyCentral. Each Rams Insert can be used to create a unique plaque, medal or trophy.489928Mascot
custom-page11Heartwarming stories of kindness and community support from the week of May 4, 2025.custom-pagemascottrophies1"4-6 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)""PT1=Trophies" "PT1=105503-610.4511016.25Classic MedallicsTrophiesAcademic1:22%,5:24%,10:28%,50:32%"Mascot Awards"This realistic looking Rattlesnake trophy measures 6"H x 4"W x 3 1/4"d and is sculptured in resin. Includes up to 3 lines of free personalization.1masc20004-15-2018Mascotcustom-pagemascot-plaques1plaques498552-41JDSPlaques1Find this rattlesnake plaque discounted at TrophyCentral. Our rattlesnake mascot plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Mascotcustom-pagetrophies-mascot1trophies498552-410.55615TrophyCentral1:22%,5:24%,10:28%,50:32%Find rattlesnake trophies discounted at TrophyCentral. Each rattlesnake trophy is made of resin and includes up to 3 lines of free engraving!07-12-2023Mascotcustom-pagemascot-plaques1plaques498552-41JDSPlaques1Find this raven plaque discounted at TrophyCentral. Our raven mascot plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Mascotcustom-pagemascotinserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsMascots1Buy these quality Ravens Mascot Medal Inserts at TrophyCentral. Each Ravens Insert can be used to create a unique plaque, medal or trophy.489949Mascot
custom-pageacademic-general-medalsreading-plaque-i9089681trophies-academic1Find a great selection of reading trophies discounted at TrophyCentral. Choose from many popular styles. Each reading trophy includes personalization. Fast 1-2 day shipping.Celebrate Reading Achievements with Custom Trophies

Classic Reading Trophies for Schools & Libraries

Choose from our wide selection of book-themed awards, including participation medals, single column trophies, and custom engraved keepsakes perfect for summer reading programs, classroom challenges, and library events.

Star & Column Reading Trophies

Consider our star performer series trophies to recognize top readers in any program. These motivational awards are a meaningful way to celebrate effort and dedication in young readers of all ages.

Custom Engraved Reading Trophies

Add the recipient's name, reading milestone, and event date to make every award truly personal. For example: Maya Patel, Top Reader, Jefferson Library Summer Reading Program, June 2026. Engraving is free and adds a lasting touch to any reading trophy or award.

Why Choose TrophyCentral for Reading Trophies?

High-Quality Awards with Fast Shipping

Our trophies feature real marble bases and quality materials. Most awards ship within just 1-2 business days.

Free Engraving & Bulk Discounts Available

Each reading trophy includes up to 3 lines of free engraving. We offer competitive pricing and bulk discounts, making it easy for schools and libraries to recognize every reader without stretching the budget.

Trusted by Teachers, Librarians & Schools Nationwide

We have been a trusted source for awards since 1999. We sell online, but our real team members in Michigan and New York are always happy to help by phone or email.

Frequently Asked Questions (FAQ)

What types of reading awards do you offer?

We offer a wide variety of reading awards including medals, column trophies, ribbons, and certificates. Book-themed designs make our awards especially fitting for summer reading programs, classroom reading challenges, library literacy events, and book club recognitions. Whether you need a small participation ribbon for early readers or an impressive trophy for a top reader champion, we have options to fit every program and budget.

Can I personalize my reading awards?

Yes, most of our reading awards include free engraving. You can add a student's name, reading milestone, program name, school or library name, and the event date. A typical example might read: Daniel Reyes, 100 Books Read, Washington Elementary Reading Challenge, May 2026. Personalizing each award transforms it from a generic prize into a keepsake readers will hold onto for years.

How fast do reading awards ship?

Most reading awards ship within 1-2 business days after your order is placed. If you are working toward a specific program end date or award ceremony, check the estimated delivery time at checkout and contact our team if you need help planning your order timeline.

Do you offer bulk discounts for schools and libraries?

Yes, we offer special pricing on bulk orders for schools, libraries, and literacy programs. Many organizers order a combination of ribbons or medals for all participants and trophies for top finishers to maximize recognition while staying within budget. Contact us by phone or email for a custom quote on larger purchases.

Do you have awards for different reading levels?

Yes, we carry awards suitable for readers of all ages and levels, from early childhood programs celebrating first books to advanced reading competitions for older students. Smaller economy medals and ribbons work well for younger or beginning readers, while more substantial column trophies and engraved plaques suit competitive reading programs and milestone achievements like reading 50 or 100 books.

Do you sell other academic awards?

Yes, in addition to reading awards we offer honor roll certificates, science awards, and academic trophies for a full range of student achievements.

If you need more information before deciding, see our expert resource guides: ]]>
readingpins
custom-pagemedallion-inserts-academic-medallion-inserts20498552-40.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find these colorful Reading 2" Epoxy-covered insert decals discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Readingcustom-pagereadingpinsplastic-pinbox-t1498551-30.5200040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find these Reading Gold Enamel Lapel Pins discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.1reading-u-pbReadingcustom-pagereadingpinsplastic-pinbox-t5498551-20.550040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find our 3D Series gold reading pins discounted at TrophyCentral. Each outstanding volunteer pin features a clutch back so it can be easily and safely attached to clothing. Fast 1-2 day shipping.Readingcustom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%Buy these quality Reading Achievement Inserts (Litho) at TrophyCentral. Each Reading Achievement Insert can be used to create a unique plaque, medal or trophy.507231Reading
custom-pageachievement-certificates-awards1"Download Only"free-academic49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Reading template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Reading-Certificatereading-freeReadingcustom-pagecoaching-teaching-guides11Creative reading award ideas with engraving examples for schools and reading programs. From Bookworm Champion to Reading Marathon Winner, discover 15+ unique ways to recognize young readers with actual trophy wording templates.custom-pagereadingawards10br371 7008 j9078 908 hp17 br4702-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105503-60.5115014Classic Medallicsaward-medalsAcademic1:22%,25:24%,50:30%,100:36%,500:42%"School Medals" "School Award Medals" "Scholastic Medals" "Scholastic Award Medals" "Academic Medals" "Academic Award Medals" "Medals, School" "Reading Award" "Reading Awards" "Reading Medals" "Reading Lapel Pins" "Reading Award Pins"Students love this colorful Mylar Reading Award Medal from TrophyCentral. Each Reading Award Medal includes a neck ribbon!tm9901Reading
custom-pagereadingawards1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Reading Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Readingcustom-pagereadingawards1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Reading Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Readingcustom-pagereadingawards1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Reading Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Readingcustom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105502-40.3713003.37Classic MedallicsInsertsAcademic1:22%Buy these quality Mylar Reading Award Decal Inserts at TrophyCentral. Each Reading Award Decal can be used to create a unique plaque, medal or trophy.489901Reading
custom-pagetm9901plasticpinboxvelapinbox10readingpinsbr371 7008 j9078 908 tm9901 hp17"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"Reading Award" "Reading Awards" "Reading Award Pins"Find this Reading Award Pin at TrophyCentral. Reading Award pins feature a clutch back and ship in just 1-2 business days!br470Readingcustom-pagereadingpins70089089681awardcertificates11Find these reading certificates discounted at TrophyCentral. Each reading certificate is beautifully printed; templates measure 8 1/2 x 11.Printed Reading Certificates TrophyCentral has an industry-leading selection of certificates and templates in a variety of styles. Each reading certificate measures 11 x 8 1/2". If you have any questions, please contact our experts in New York and Michigan. They have been helping customers with excellent service since 1999!]]>trophies readingpinscustom-pagemotivational-stickers1"1 - 2 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-21 2 3 230.451224.45Certificate SourceCertificates / CoversStickers1:22%,3:24%bstick1Readingcustom-pageachievement-certificates-awards1"Download Only"free-academic49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates" "Reading Award" "Reading Awards" "Reading Lapel Pins" "Reading Award Pins"See this reading certificate designed exclusively for TrophyCentral! Reading certificates can be downloaded for free! Each reading award certificate measures 11 x 8 1/2 inches.readingReadingcustom-pagereadingawards1certificates290631-31 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,25:24%,100:40%,500:50%"Reading Award" "Reading Awards" "Reading Medals" "Reading Lapel Pins" "Reading Award Pins"Find These Printed Reading Certificate Awards with a Unique Lizard Design at TrophyCentral. Measures 8 1/2 x 11.968Readingcustom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceCertificates / CoversEmbosser Seals1:22%,3:28%,5:31%Find these Reading Certificate Seals discounted at TrophyCentral. Seals are easy to apply with a pressure-sensitive backing. Buy in bulk for large discounts!803readReadingcustom-pagereadingawards1498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy reading column insert trophy features a choice of column color, a marble base and free trophy engraving.Readingcustom-pagereadingawards1medals498552-30.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Colorful Reading Insert Medals Discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Readingcustom-pagereadingawards1medals498552-40.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Reading Insert Medals With A Personalized Front Rim Discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Readingcustom-pagereadingawards1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these reading insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Readingcustom-pagetm9901plasticpinboxvelapinbox10br371 7008 j9078 908 tm9901 br470"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:30%,100:35%,500:48%"Reading Award" "Reading Awards" "Reading Medals" "Reading Lapel Pins" "Reading Award Pins"Find These Fabulous Reading Pins Discounted At Top-Rated TrophyCentral.hp17Readingcustom-pagereadingpinsplastic-pinbox-t5lapel pins498551-20.550040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find these Reading Gold Enamel Lapel Pins discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.reading-u-pbReadingcustom-pagereadingpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:28%,100:32%,500:42%Find Reading pins at TrophyCentral. Each AP Series Reading pin includes a clutch back.ap81Readingcustom-pagereadingawards12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsAcademic1:22%,100:28%,500:34%,1000:45%These inexpensive 1 1/4 inch Reading Award Medals offer a high quality, but low price for those on a tight budget. Add Engraving to your Reading Award for a Special touch!e990508-15-2014Reading
custom-pagereadingawards12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsAcademic1:22%,100:28%,500:34%,1000:45%These inexpensive 1 1/4 inch Reading Medals offer a high quality, but low price for those on a tight budget.e9078Reading
1academic-general-medals1Find Reading Medals discounted at TrophyCentral. Each Reading Medal includes a free neck ribbon. Fast 1-2 day shipping.readingmedalsCelebrate a Love for Reading with Custom Medals TrophyCentral has an great selection of reading award medals to meet your needs. Choose from popular reading subjects, such as: "Reading Award", "Really Into Reading" and many more. Each reading medal includes a neck ribbon; ribbons are even available in a large number of color combinations to match your school colors!

Engraved Reading Medals with Custom Text

Personalize the back of your medals with names and dates. You can even add an organization or event name on our exclusive front rim medals.

Gold, Silver & Bronze Reading Medals

These medals are perfect for reading programs and motivational competitions.

Bulk Orders for Schools & Libraries

In addition to our low prices, we offer large quantity discounts. Click on an item image above and then on "View Quantity Pricing".

The TrophyCentral Difference

We have the guaranteed lowest prices and top-rated customer service. Yes, there are real people at TrophyCentral ready to answer your questions and to help you find the right reading medal award to fit your needs. If you have any questions regarding your order, simply call us toll-free at 1-888-809-8800.

Frequently Asked Questions (FAQ)

📚 What are reading medals?

Reading medals are special awards designed to recognize students for reading achievements, literacy programs, and book challenges. They help motivate young readers and celebrate their progress.

🏆 Who can receive a reading medal?

Reading medals are perfect for students of all ages, including elementary, middle, and high school readers. They are often awarded for completing reading challenges, summer reading programs, or excelling in literacy-based activities.

📖 What types of reading medals are available?

We offer a variety of reading medals, including gold, silver, and bronze options, as well as medals featuring books, reading mascots, and other themed designs.

🎨 Can I customize reading medals with engraving?

Yes! Many of our reading medals include custom engraving options where you can add the recipient's name, event title, or a short message to make the award extra special.

📦 Do you offer bulk discounts for schools and libraries?

Yes! We provide discounted pricing for bulk orders, making it easy for schools, libraries, and literacy programs to reward multiple students.

⏳ How long does shipping take?

Most reading medals ship within 1-2 days without engraving and a bit longer with engraving. Expedited shipping options are available for last-minute award ceremonies.

🎁 Are reading medals a good way to encourage kids to read?

Absolutely! Reading medals provide positive reinforcement, making reading fun and rewarding. They encourage students to set goals and develop a lifelong love for books.

]]>
readingawards readingpins
custom-pagereadingawards1498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our reading insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - ReadingReadingcustom-pagereadingawards1display case498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy reading insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Readingcustom-pageperfect-attendance-pinsbr470ap81br721hp17br371reading-pbreading-u-pb3d10-reading1school-pins1Find reading pins discounted at TrophyCentral. If you are looking for an inexpensive, yet quality way to recognize your top reading students, you have come to the right place!Lapel Pins: Reading If you are looking for an inexpensive, yet quality way to recognize the achievements of your top reading students, you have come to the right place! Whether you are looking to award students at the end of the year ceremony or motivate them throughout, we have a pin for you. Fast 1-2 day shipping.

Shop with Ease at TrophyCentral!

If you are looking to buy reading lapel pins online, look no further! TrophyCentral has a great selection that will fit any budget. Our top-rated representatives are happy to assist you with all of your reading pin needs. Our customer service experts in New York and Michigan have been providing suggestions and guidance since 1999!
]]>
readingmedals reading-certificates school-pins
custom-pagemotivational-stickers1"1 - 2 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"290631-21 2 3 230.451224.45Certificate SourceCertificates / CoversStickers1:22%,3:24%"Reading Award" "Reading Awards" "Reading Medals" "Reading Lapel Pins" "Reading Award Pins"Find these popular Reading Rocks! motivational stickers discounted online at TrophyCentral. Fast 1-2 day shipping!bstick3Readingcustom-pagereadingawards1498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Reading single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - ReadingReadingcustom-pagereadingpinsplasticpinboxvelapinbox1"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%Find these Reading Star Pins discounted at TrophyCentral. Each reading star pin features a clutch-back. Fast 1-2 day shipping!br721Readingcustom-pagereadingawards1498551-311821.06TrophyCentraltrophies1Readingcustom-pagereadingawards1br371 7008 908 tm9901 hp17 br4702-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105503-60.75130042.75Classic Medallicsaward-medalsAcademic1:22%,50:28%,100:34%,500:41%Find our Reading 2" Olympic-Style J-Series Medals 2" Olympic-Style J-Series Medals at a super price point at TrophyCentral. Large quantity discounts available!j907807-15-11Reading
custom-pageglass-crystal-awards11"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"458221510.45618.45Vision AwardsTrophies1:22%,200:32%Find this paperweight with a Real Estate House design discounted at TrophyCentral. Includes etching and a gift box.custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these quality Real Estate Sales Inserts (Litho) at TrophyCentral. Each Real Estate Sales Insert can be used to create a unique plaque, medal or trophy.507165Occupations
custom-pagewall-mounted-recessed1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell recessed wall display case w/ cork back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 48"H x 48"W x 16"D.14404-ck-bzWall-Mountedcustom-pagewall-mounted-recessed145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell recessed wall display case w/ cork back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 60"H x 48"W x 16"D.114404-ck-bzWall-Mountedcustom-pagewall-mounted-recessed1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell recessed wall display case w/ cork back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 48"W x 16"D.14406-ck-bzWall-Mountedcustom-pagewall-mounted-recessed145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell recessed wall display case w/ cork back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 96"H x 48"W x 16"D.114408-wb-bzWall-Mountedcustom-pagewall-mounted-recessed145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell recessed wall display case w/ cork back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 48"H x 48"W x 16"D.114404-ck-bzWall-Mountedcustom-pagewall-mounted-recessed145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell recessed wall display case w/ cork back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 60"H x 48"W x 16"D.114404-ck-bzWall-Mountedcustom-pagewall-mounted-recessed145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell recessed wall display case w/ cork back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 48"W x 16"D.114406-ck-bzWall-Mountedcustom-pagewall-mounted-recessed1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell recessed wall display case w/ cork back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 96"H x 48"W x 16"D.14408-ck-snWall-Mountedcustom-pagewall-mounted-recessed145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell recessed wall display case w/ white laminate back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 48"H x 48"W x 16"D.114404-ck-bzWall-Mountedcustom-pagewall-mounted-recessed145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell recessed wall display case w/ white laminate back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 60"H x 48"W x 16"D.114404-ck-bzWall-Mountedcustom-pagewall-mounted-recessed145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell recessed wall display case w/ white laminate back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 48"W x 16"D.114406-ck-bzWall-Mountedcustom-pagewall-mounted-recessed1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell recessed wall display case w/ white laminate back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 96"H x 48"W x 16"D.14408-wb-bzWall-Mountedcustom-pagewall-mounted-recessed145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell recessed wall display case w/ white laminate back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 48"H x 48"W x 16"D.114404-ck-bzWall-Mountedcustom-pagewall-mounted-recessed145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell recessed wall display case w/ white laminate back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 60"H x 48"W x 16"D.114404-ck-bzWall-Mountedcustom-pagewall-mounted-recessed145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell recessed wall display case w/ white laminate back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 48"W x 16"D.114406-ck-bzWall-Mountedcustom-pagewall-mounted-recessed145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell recessed wall display case w/ white laminate back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 96"H x 48"W x 16"D.114408-ck-snWall-Mountedcustom-pageglobal-crystal-awards1"5-10 business days" "Mount Vernon, NY" "UPS"general105503-610.4511213.65Classic MedallicsCrystal Awards1:30%"Crystal Awards"Find this Optical Crystal Recessed Globe at TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.See more: glass-crystal-awardsLeadershipcustom-pagescholarship-resource-hub11Comprehensive guide for coaches and teachers to recognize and document sportsmanship in athletes. Includes sport-specific examples.custom-pagescholarship-resource-hub11Complete teacher resource for writing powerful scholarship recommendations. Includes template, before-after examples, and time-saving questionnaire.custom-pageglass-crystal-awards1"1-2 business days" "Marquette, MI" "UPS"general498852-310.45826Quick TrophyCrystal Awards1:14%"New Products"Rectangle Prestige Glass Awards from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.For other great alternatives, be sure to see our mainsection.glass-crystal-awardsLeadershipcustom-pagebaseballdisplay11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.5119.5Perfect CaseDisplay Cases11:14%,5:19%Rectangular Batting Helmet Glass Display Cases from TrophyCentral.Baseball / T-Ball, Sportscustom-pagefootballdisplay11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.5116.524 12 10Perfect CaseDisplay Cases11:14%,5:17%Rectangular Glass Football Display Case. Ideal for leagues, schools, and tournaments. Fast shipping.10-16-2017Football, Sportscustom-pagefootballdisplay11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.5119.5Perfect CaseDisplay Cases11:14%,5:19%Rectangular Glass Football Helmet Display Case. Ideal for leagues, schools, and tournaments. Fast shipping.Football, Sportscustom-pagebaseballdisplay11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.5115.5Perfect CaseDisplay Cases11:14%,5:17%Rectangular Glove Glass Display Cases from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.Baseball / T-Ball, Sportscustom-pagename-badges-tagswoyoulipr100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Rectangular Name Badges Discounted At TrophyCentral.namebadges-rectcustom-pagesports-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsGeneral1:22%,50:30%,100:33%,500:47%"School Pins" "School Lapel Pins"Red #1 Letter Pins: EC Series Red #1 Lapel Pins feature a high-quality enameled finish and ship in just 1-2 business days!ec28rd12-20-2020Academiccustom-pageawri11"3-4 business days" "Topeka, Indiana" "UPS (Priority Mail also available)"medals465715-71 260.4620016.46Tower RibbonRibbonsAwareness Ribbons1:22%,50:35%Buy Red, White and Blue Patriotic Ribbons at TrophyCentral. Each Red, White and Blue Ribbon Features A Tape Or Pin Back And Is Available With Optional Imprinting.reawriShop for Patriotic Red, White and Blue Ribbons with Ease at TrophyCentral TrophyCentral has a wonderful selection, discounted and bulk pricing and great customer service. Each red, white and blue awareness ribbon comes with a tape or pin back and is available with optional imprinting.]]>Red White Blue, Patrioticcustom-pageachievement-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsGeneral1:22%,50:30%,100:33%,500:47%"School Pins" "School Lapel Pins"Our red achievement letter pins (EC Series) feature a high-quality enameled finish and ship in just 1-2 business days!ec60custom-pagebottles-st80"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14142013.4Glass AmericaPromotional ProductsSports / Water Bottles1:14%,640:31%Find these Red Backpack Collection Custom Water Bottles at TrophyCentral. Add your own logo or artwork!41076Sports / Water Bottlescustom-pagemascotinserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsMascots1Buy these quality Red Devils Mascot Medal Inserts at TrophyCentral. Each Red Devils Insert can be used to create a unique plaque, medal or trophy.489947Mascot
custom-pageteacher-appreciation1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"410187-1010.451010.45JcharlesGiftsCrystal Gifts1:22%,25:23%"personalized gifts"Find this Red Royale Apple Award Discounted at TrophyCentral. Price includes etching and gift box.Apple, Crystal Gifts, Teacher's Award, Academiccustom-pagecospwabo50"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745315125016.5PepcoPromotional ProductsSports / Water Bottles1:14%,250:21%,500:31%,1000:45%,2500:49%Red Custom Sports Bottles from TrophyCentral.sportsbottles-redSports / Water Bottlescustom-pagesports-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsGeneral1:22%,50:30%,100:33%,500:47%"Star Awards" "Star Award"Red Stars Letter Pins: EC Series Red Stars Lapel Pins feature a high-quality enameled finish and ship in just 1-2 business days!ec113-28-2016Star, General, Academic1"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)""PT1=7745310-141350018PepcoPromotional ProductsMagnetic Signs1See a great selection of custom mascot magnets at TrophyCentral. Choose your school color and add your own artwork!mascot-magnets-allMascotcustom-pagecrystalcups1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"general410187-1010.45212.45JcharlesCrystal Awards1:22%,25:24%"crystal awards"Find these fabulous Regatta Championship Trophies discounted at TrophyCentral. TrophyCentral is known for its top-rated customer serviceLeadership, Golf, Tennis, Sportscustom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock Bottles1:22%,100:28%,500:34%,1000:45%"Track Medals"These inexpensive 1 1/4 inch Relay Race (Female) Medals offer a high quality, but low price for those on a tight budget.e9044
custom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock Bottles1:22%,100:28%,500:34%,1000:45%"Track Medals"These inexpensive 1 1/4 inch Relay Race (Male) Medals offer a high quality, but low price for those on a tight budget.e9111
custom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281mb-gd-mk.12281mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074mb-gd-mk.12074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075mb-gd-mk.12075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076mb-gd-mk.12076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281mb-bz-mk.12281mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074mb-bz-mk.12074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075mb-bz-mk.12075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076mb-bz-mk.2076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281mb-sn-mk.12281mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074mb-sn-mk.12074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075mb-sn-mk.12075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076mb-sn-mk.12076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281pb-gd-mk.12281pb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074pb-gd-mk.12074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075pb-gd-mk.12075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076pb-gd-mk.12076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281pb-bz-mk.12281pb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074pb-bz-mk.12074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075pb-bz-mk.12075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076pb-bz-mk.12076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281pb-sn-mk.12281pb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074pb-sn-mk.12074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075pb-sn-mk.12075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076pb-sn-mk.12076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281wb-gd-mk.12281wb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074wb-gd-mk.12074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075wb-gd-mk.12075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076wb-gd-mk.12076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281wb-bz-mk.12281wb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074wb-bz-mk.12074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075wb-bz-mk.12075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076wb-bz-mk.12076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281wb-sn-mk.12281wb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074wb-sn-mk.12074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075wb-sn-mk.12075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076wb-sn-mk.12076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281mb-gd-dk.12281mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074mb-gd-dk.12074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076mb-gd-dk.12076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281mb-bz-dk.12281mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074mb-bz-dk.12074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075mb-bz-dk.12075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076mb-bz-dk.12076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281mb-sn-dk.12281mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074mb-sn-dk.12074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075mb-sn-dk.12075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076mb-sn-dk.12076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281pb-gd-dk.12281pb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074pb-gd-dk.12074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075pb-gd-dk.12075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076pb-gd-dk.12076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281pb-bz-dk.12281pb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074pb-bz-dk.12074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075pb-bz-dk.12075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076pb-bz-dk.12076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281pb-sn-dk.12281pb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074pb-sn-dk.12074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075pb-sn-dk.12075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076pb-sn-dk.12076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281wb-gd-dk.12281wb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074wb-gd-dk.12074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075wb-gd-dk.12075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076wb-gd-dk.12076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281wb-bz-dk.12281wb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074wb-bz-dk.12074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075wb-bz-dk.12075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076wb-bz-dk.12076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281wb-sn-dk.12281wb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074wb-sn-dk.12074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075wb-sn-dk.12075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076wb-sn-dk.12076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant driftwood oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075mb-gd-dk.2075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281mb-gd-lv.12281mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074mb-gd-lv.12074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075mb-gd-lv.12075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076mb-gd-lv.12076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281mb-bz-lv.12281mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074mb-bz-lv.12074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075mb-bz-lv.12075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076mb-bz-lv.12076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281mb-sn-lv.12281mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074mb-sn-lv.12074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075mb-sn-lv.12075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076mb-sn-lv.12076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281pb-gd-lv.12281pb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074pb-gd-lv.12074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075pb-gd-lv.12075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076pb-gd-lv.12076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281pb-bz-lv.12281pb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074pb-bz-lv.12074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075pb-bz-lv.12075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076pb-bz-lv.12076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281pb-sn-lv.12281pb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074pb-sn-lv.12074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075pb-sn-lv.12075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076pb-sn-lv.12076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281wb-gd-lv.12281wb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074wb-gd-lv.12074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075wb-gd-lv.12075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076wb-gd-lv.12076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281wb-bz-lv.12281wb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074wb-bz-lv.12074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075wb-bz-lv.12075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076wb-bz-lv.12076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281wb-sn-lv.12281wb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074wb-sn-lv.12074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075wb-sn-lv.12075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076wb-sn-lv.12076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174mb-gd-mk.12174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175mb-gd-mk.12175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176mb-gd-mk.12176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174mb-bz-mk.12174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175mb-bz-mk.12175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176mb-bz-mk.12176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174mb-sn-mk.12174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175mb-sn-mk.12175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176mb-sn-mk.12176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174pb-gd-mk.12174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175pb-gd-mk.12175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176pb-gd-mk.12176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174pb-bz-mk.12174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175pb-bz-mk.12175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176pb-bz-mk.12176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174pb-sn-mk.12174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175pb-sn-mk.12175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176pb-sn-mk.12176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174wb-gd-mk.12174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175wb-gd-mk.12175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176wb-gd-mk.12176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174wb-bz-mk.12174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175wb-bz-mk.12175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176wb-bz-mk.12176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174wb-sn-mk.12174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175wb-sn-mk.12175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted Carmel oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176wb-sn-mk.12176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174mb-gd-dk.12174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175mb-gd-dk.12175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176mb-gd-dk.12176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174mb-bz-dk.12174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175mb-bz-dk.2175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176mb-bz-dk.12176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174mb-sn-dk.12174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175mb-sn-dk.12175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176mb-sn-dk.12176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174pb-gd-dk.12174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175pb-gd-dk.12175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176pb-gd-dk.12176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174pb-bz-dk.12174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175pb-bz-dk.12175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176pb-bz-dk.12176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174pb-sn-dk.12174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175pb-sn-dk.12175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176pb-sn-dk.12176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174wb-gd-dk.12174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175wb-gd-dk.12175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176wb-gd-dk.12176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174wb-bz-dk.12174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175wb-bz-dk.12175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176wb-bz-dk.12176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174wb-sn-dk.12174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175wb-sn-dk.12175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted driftwood oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176wb-sn-dk.12176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174mb-gd-lv.12174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175mb-gd-lv.12175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176mb-gd-lv.12176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174mb-bz-lv.12174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175mb-bz-lv.12175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176mb-bz-lv.12176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174mb-sn-lv.12174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175mb-sn-lv.12175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176mb-sn-lv.12176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174pb-gd-lv.12174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175pb-gd-lv.12175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176pb-gd-lv.12176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174pb-bz-lv.12174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175pb-bz-lv.12175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176pb-bz-lv.12176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174pb-sn-lv.12174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175pb-sn-lv.12175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176pb-sn-lv.12176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174wb-gd-lv.12174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175wb-gd-lv.12175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176wb-gd-lv.12176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174wb-bz-lv.12174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175wb-bz-lv.12175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176wb-bz-lv.12176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174wb-sn-lv.12174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175wb-sn-lv.12175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted light oak vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176wb-sn-lv.12176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174mb-gd-ak.12174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175mb-gd-ak.12175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176mb-gd-ak.12176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174mb-bz-ak.2174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175mb-bz-ak.12175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176mb-bz-ak.2176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174mb-sn-ak.12174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175mb-sn-ak.12175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176mb-sn-ak.12176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174pb-gd-ak.12174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175pb-gd-ak.12175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176pb-gd-ak.12176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174pb-bz-ak.12174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175pb-bz-ak.12175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176pb-bz-ak.12176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174pb-sn-ak.12174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175pb-sn-ak.12175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176pb-sn-ak.12176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174wb-gd-ak.12174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175wb-gd-ak.12175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176wb-gd-ak.12176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174wb-bz-ak.12174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175wb-bz-ak.12175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176wb-bz-ak.12176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174wb-sn-ak.12174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175wb-sn-ak.12175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176wb-sn-ak.12176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174mb-gd-wv.12174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175mb-gd-wv.12175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176mb-gd-wv.12176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174mb-bz-wv.12174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175mb-bz-wv.12175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176mb-bz-wv.12176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174mb-sn-wv.12174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175mb-sn-wv.12175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176mb-sn-wv.12176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174pb-gd-wv.12174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175pb-gd-wv.12175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176pb-gd-wv.12176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174pb-bz-wv.12174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175pb-bz-wv.12175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176pb-bz-wv.12176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174pb-sn-wv.12174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175pb-sn-wv.12175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176pb-sn-wv.12176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174wb-gd-wv.12174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175wb-gd-wv.12175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176wb-gd-wv.12176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174wb-bz-wv.12174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175wb-bz-wv.12175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176wb-bz-wv.12176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 2174wb-sn-wv.12174mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 2175wb-sn-wv.12175mb-bz-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant lighted walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 2176wb-sn-wv.12176mb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281mb-gd-ak.12281mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074mb-gd-ak.12074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075mb-gd-ak.12075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076mb-gd-ak.12076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281mb-bz-ak.12281mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074mb-bz-ak.12074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075mb-bz-ak.12075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076mb-bz-ak.12076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281mb-sn-ak.12281mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074mb-sn-ak.12074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075mb-sn-ak.12075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076mb-sn-ak.12076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281pb-gd-ak.12281pb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074pb-gd-ak.12074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075pb-gd-ak.12075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076pb-gd-ak.12076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281pb-bz-ak.2281pb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074pb-bz-ak.12074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075pb-bz-ak.12075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076pb-bz-ak.12076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281pb-sn-ak.12281pb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074pb-sn-ak.12074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075pb-sn-ak.12075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076pb-sn-ak.12076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281wb-gd-ak.12281wb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074wb-gd-ak.12074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075wb-gd-ak.12075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076wb-gd-ak.12076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281wb-bz-ak.2281wb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074wb-bz-ak.12074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075wb-bz-ak.12075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076wb-bz-ak.12076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281wb-sn-ak.12281wb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074wb-sn-ak.12074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075wb-sn-ak.12075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant natural oak case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076wb-sn-ak.12076mb-bz-mkFloor-Standing11"3 1/2 - 5 weeks" "Greenfield, Ohio" "Truck (please allow 2-7 days for shipping)""PT4=45123128-541 3 4 5 6 7 8 9 10 220.451Waddell11"Glass Display Case" "Glass Display Cases" "Glass Trophy Cases" "Glass Trophy Case"Shop for a Reliant Trophy and Display Case at TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.trophy case, trophy cases, display cases, reliantcomsooncas6Floor-Standingcustom-pagedisplaycases12074mb-gd-mk2075mb-gd-mk2076mb-gd-mk2281mb-gd-mk2074mb-gd-ak2075mb-gd-ak2076mb-gd-ak2281mb-gd-ak2074mb-gd-wv2075mb-gd-wv2076mb-gd-wv2281mb-gd-wv2074mb-gd-dk2076mb-gd-dk2281mb-gd-dk2074mb-gd-lv2075mb-gd-lv2076mb-gd-lv2281mb-gd-lv2174mb-gd-mk2175mb-gd-mk2176mb-gd-mk2075mb-gd-dk2174mb-gd-ak2175mb-gd-ak2176mb-gd-ak2174mb-gd-wv2175mb-gd-wv2176mb-gd-wv2174mb-gd-dk2175mb-gd-dk2176mb-gd-dk2174mb-gd-lv2175mb-gd-lv2176mb-gd-lv2074mb-bz-mk2075mb-bz-mk2076mb-bz-mk2281mb-bz-mk2074mb-bz-ak2075mb-bz-ak2076mb-bz-ak2281mb-bz-ak2074mb-bz-wv2075mb-bz-wv2076mb-bz-wv2281mb-bz-wv2074mb-bz-dk2075mb-bz-dk2076mb-bz-dk2281mb-bz-dk2074mb-bz-lv2075mb-bz-lv2076mb-bz-lv2281mb-bz-lv2174mb-bz-mk2175mb-bz-mk2176mb-bz-mk2174mb-bz-ak2175mb-bz-ak2176mb-bz-ak2174mb-bz-wv2175mb-bz-wv2176mb-bz-wv2174mb-bz-dk2175mb-bz-dk2176mb-bz-dk2174mb-bz-lv2175mb-bz-lv2176mb-bz-lv2074mb-sn-mk2075mb-sn-mk2076mb-sn-mk2281mb-sn-mk2074mb-sn-ak2075mb-sn-ak2076mb-sn-ak2281mb-sn-ak2074mb-sn-wv2075mb-sn-wv2076mb-sn-wv2281mb-sn-wv2074mb-sn-dk2075mb-sn-dk2076mb-sn-dk2281mb-sn-dk2074mb-sn-lv2075mb-sn-lv2076mb-sn-lv2281mb-sn-lv2174mb-sn-mk2175mb-sn-mk2176mb-sn-mk2174mb-sn-ak2175mb-sn-ak2176mb-sn-ak2174mb-sn-wv2175mb-sn-wv2176mb-sn-wv2174mb-sn-dk2175mb-sn-dk2176mb-sn-dk2174mb-sn-lv2175mb-sn-lv2176mb-sn-lv2074pb-gd-mk2075pb-gd-mk2076pb-gd-mk2281pb-gd-mk2074pb-gd-ak2075pb-gd-ak2076pb-gd-ak2281pb-gd-ak2074pb-gd-wv2075pb-gd-wv2076pb-gd-wv2281pb-gd-wv2074pb-gd-dk2075pb-gd-dk2076pb-gd-dk2281pb-gd-dk2074pb-gd-lv2075pb-gd-lv2076pb-gd-lv2281pb-gd-lv2174pb-gd-mk2175pb-gd-mk2176pb-gd-mk2174pb-gd-ak2175pb-gd-ak2176pb-gd-ak2174pb-gd-wv2175pb-gd-wv2176pb-gd-wv2174pb-gd-dk2175pb-gd-dk2176pb-gd-dk2174pb-gd-lv2175pb-gd-lv2176pb-gd-lv2074pb-bz-mk2075pb-bz-mk2076pb-bz-mk2281pb-bz-mk2074pb-bz-ak2075pb-bz-ak2076pb-bz-ak2281pb-bz-ak2074pb-bz-wv2075pb-bz-wv2076pb-bz-wv2281pb-bz-wv2074pb-bz-dk2075pb-bz-dk2076pb-bz-dk2281pb-bz-dk2074pb-bz-lv2075pb-bz-lv2076pb-bz-lv2281pb-bz-lv2174pb-bz-mk2175pb-bz-mk2176pb-bz-mk2174pb-bz-ak2175pb-bz-ak2176pb-bz-ak2174pb-bz-wv2175pb-bz-wv2176pb-bz-wv2174pb-bz-dk2175pb-bz-dk2176pb-bz-dk2174pb-bz-lv2175pb-bz-lv2176pb-bz-lv2074pb-sn-mk2075pb-sn-mk2076pb-sn-mk2281pb-sn-mk2074pb-sn-ak2075pb-sn-ak2076pb-sn-ak2281pb-sn-ak2074pb-sn-wv2075pb-sn-wv2076pb-sn-wv2281pb-sn-wv2074pb-sn-dk2075pb-sn-dk2076pb-sn-dk2281pb-sn-dk2074pb-sn-lv2075pb-sn-lv2076pb-sn-lv2281pb-sn-lv2174pb-sn-mk2175pb-sn-mk2176pb-sn-mk2174pb-sn-ak2175pb-sn-ak2176pb-sn-ak2174pb-sn-wv2175pb-sn-wv2176pb-sn-wv2174pb-sn-dk2175pb-sn-dk2176pb-sn-dk2174pb-sn-lv2175pb-sn-lv2176pb-sn-lv2074wb-gd-mk2075wb-gd-mk2076wb-gd-mk2281wb-gd-mk2074wb-gd-ak2075wb-gd-ak2076wb-gd-ak2281wb-gd-ak2074wb-gd-wv2075wb-gd-wv2076wb-gd-wv2281wb-gd-wv2074wb-gd-dk2075wb-gd-dk2076wb-gd-dk2281wb-gd-dk2074wb-gd-lv2075wb-gd-lv2076wb-gd-lv2281wb-gd-lv2174wb-gd-mk2175wb-gd-mk2176wb-gd-mk2174wb-gd-ak2175wb-gd-ak2176wb-gd-ak2174wb-gd-wv2175wb-gd-wv2176wb-gd-wv2174wb-gd-dk2175wb-gd-dk2176wb-gd-dk2174wb-gd-lv2175wb-gd-lv2176wb-gd-lv2074wb-bz-mk2075wb-bz-mk2076wb-bz-mk2281wb-bz-mk2074wb-bz-ak2075wb-bz-ak2076wb-bz-ak2281wb-bz-ak2074wb-bz-wv2075wb-bz-wv2076wb-bz-wv2281wb-bz-wv2074wb-bz-dk2075wb-bz-dk2076wb-bz-dk2281wb-bz-dk2074wb-bz-lv2075wb-bz-lv2076wb-bz-lv2281wb-bz-lv2174wb-bz-mk2175wb-bz-mk2176wb-bz-mk2174wb-bz-ak2175wb-bz-ak2176wb-bz-ak2174wb-bz-wv2175wb-bz-wv2176wb-bz-wv2174wb-bz-dk2175wb-bz-dk2176wb-bz-dk2174wb-bz-lv2175wb-bz-lv2176wb-bz-lv2074wb-sn-mk2075wb-sn-mk2076wb-sn-mk2281wb-sn-mk2074wb-sn-ak2075wb-sn-ak2076wb-sn-ak2281wb-sn-ak2074wb-sn-wv2075wb-sn-wv2076wb-sn-wv2281wb-sn-wv2074wb-sn-dk2075wb-sn-dk2076wb-sn-dk2281wb-sn-dk2074wb-sn-lv2075wb-sn-lv2076wb-sn-lv2281wb-sn-lv2174wb-sn-mk2175wb-sn-mk2176wb-sn-mk2174wb-sn-ak2175wb-sn-ak2176wb-sn-ak2174wb-sn-wv2175wb-sn-wv2176wb-sn-wv2174wb-sn-dk2175wb-sn-dk2176wb-sn-dk2174wb-sn-lv2175wb-sn-lv2176wb-sn-lv11Find Reliant Series trophy cases discounted at TrophyCentral. These quality display cases from Waddell are ideal for schools and offices.displaycases1trophycases15 floor-standing-merchandisercustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281mb-gd-wv.12281mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074mb-gd-wv.12074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075mb-gd-wv.12075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076mb-gd-wv.12076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281mb-bz-wv.2281mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074mb-bz-wv.2074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075mb-bz-wv.12075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076mb-bz-wv.12076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281mb-sn-wv.12281mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074mb-sn-wv.12074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075mb-sn-wv.12075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076mb-sn-wv.12076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281pb-gd-wv.12281pb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074pb-gd-wv.12074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075pb-gd-wv.12075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076pb-gd-wv.12076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281pb-bz-wv.12281pb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074pb-bz-wv.12074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075pb-bz-wv.12075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076pb-bz-wv.12076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281pb-sn-wv.12281pb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074pb-sn-wv.12074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075pb-sn-wv.12075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076pb-sn-wv.12076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281wb-gd-wv.12281wb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074wb-gd-wv.12074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075wb-gd-wv.12075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076wb-gd-wv.12076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281wb-bz-wv.12281wb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074wb-bz-wv.12074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075wb-bz-wv.12075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076wb-bz-wv.12076mb-bz-mkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 40"H x 36"W x 14"D. Model: 2281wb-sn-wv.12281wb-bz-akFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 2074wb-sn-wv.12074mb-bz-wvFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 2075wb-sn-wv.12075mb-gd-dkFloor-Standingcustom-pagefloor-standing-reliant145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Reliant walnut vinyl case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 2076wb-sn-wv.12076mb-bz-mkFloor-Standingcustom-pageaward-medalsrecrsctrqtcrossncqtcrossscqtcrossdmqtcrossplqtcrossyrqtcrossttqtcrossttwqtcross3cmqtcrossscbcup-cross-scbcup-cross-pcross-award-plaquestar-of-david-award-plaquecross-part-icross-single-icross-champ-icross-e-part-icross-e-single-icup-cross-scb-icup-cross-inbdg-crosse9132cross-jigfcross-jisfcross-jibfcross-mccross-mc-prcross-plaque-i1trophies1Find a great selection of religious trophies at TrophyCentral. Each religious trophy and award includes free engraving. Religious medals include a ribbon.Religious Recognition Trophies TrophyCentral has an industry-leading selection of Religious trophies and medals. Be sure to see our popular Motion Xtreme Trophy, a great alternative for younger children. For older kids, see our Double Marble Trophies . All of our trophies include up to three lines of FREE ENGRAVING (larger awards may include additional lines). ]]>trophies religious-medalscustom-pageemployee-resource-hub11Complete religious and faith-based recognition guide for churches, religious schools, and faith communities. Discover meaningful award ideas for confirmation, Sunday school, pastoral appreciation, and spiritual milestone celebrations.custom-pageblog-trophycentral11From scripture memory medals to confirmation trophies, here are the religious school recognition ideas that honor faith, learning, and the kids who showed up all year. Programs of every tradition covered. custom-page12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsReligious1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals" "Religious Medals"Buy these quality Religious Cross (493581) Inserts (Litho) at TrophyCentral. Each 2: insert can be used to create a unique plaque, medal or trophy.493581Religious
custom-pageinserts112-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsReligious1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals" "Religious Medals"Buy these quality Religious Cross (501111) Inserts (Litho) at TrophyCentral. Each Religious Cross (501111) Insert can be used to create a unique plaque, medal or trophy.501111Religious
custom-pagereligioustrophies1trophies498552-311821.06TrophiesReligious1Find this achievement cup trophy with religious cross figure discounted at TrophyCentral. Includes free text engraving!cup-cross-pReligiouscustom-pagereligioustrophies1498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Find this budget cross award trophy discounted at Trophy Central. Features a real marble base and plastic religious cross figure. Engraving is free. Fast 1-2 day shipping.1religioustrophiesReligiouscustom-pagemedallion-inserts-general-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsReligious1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals" "Religious Medals"50749004-29-2017Religious
custom-pagereligioustrophies1trophies498552-312421.33TrophiesReligious1Find these religious cross budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtcrossscbReligiouscustom-pagereligioustrophies1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.05Quick TrophyTrophiesReligious1:14%,10:18%"Religious Awards"Find This Popular Religious Cross Deluxe Platform Series Trophies Discounted at TrophyCentral. Real Marble Base; Free Personalization!qtcrossdmReligiouscustom-pagereligioustrophies1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesReligious1:14%,10:18%,50:22%,100:25%"Religious Awards"Find this popular religious cross figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!qtcrossplReligious, 1st / 2nd / 3rd / Etc.custom-pagereligioustrophies1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesReligious1:14%,10:18%,50:22%,100:25%"Religious Awards"This popular Religious Cross Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!qtcrossyrReligious11Find these fabulous Religious Military Medals discounted at TrophyCentral. TrophyCentral is known for its top-rated customer service1religious-medals

Shop With Confidence at TrophyCentral

We offer a huge selection, discounted prices and free shipping on orders for trophies, awards and promotional products over $99 (Contiguous US only). Do you need help with some ideas or with ordering? Yes, we sell online, but we have real people who would love to help you! Feel free to call our customer service experts in Michigan, New York and online. TrophyCentral - delivering smiles since 1999!


]]>
custom-pagereligioustrophies1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453633.4Quick TrophyTrophiesReligious1:14%,100:38%"Religious Awards"Our popular Religious participation trophies feature a real slant-front marble base and free engraving.qtcrossncReligiouscustom-pageachievement-certificates-awards1"Download Only"free-academic4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Religious School Diploma template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Religious-School-Diploma-Certificatereligious-school-diplomaDiploma, Academic, Graduation11Find Our Fabulous Religious Sports Medals (Cross on Back) Discounted At TrophyCentral! Add Engraving On Medal Back For A Special Touch.

Shop for Cross Medals With Confidence at TrophyCentral

We offer a huge selection, discounted prices and free shipping on orders over $99 to the contiguous US. Do you need help with some ideas or with ordering? Yes, we sell online, but we have real people who would love to help you! Feel free to call our customer service experts in Michigan, New York and online. TrophyCentral - delivering smiles since 1999!


]]>
custom-pagetrophies-military-hero1trophies105503-610.4513028.65Classic MedallicsTrophiesAcademic1:22%,50:27%"Achievement Award" "Achievement Awards"Find This Popular American Flag Award Discounted at TrophyCentral! Price Includes Choice of 2" Subject Insert and Free Engraving!12-20-2020custom-pagetrophies-basketball1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511224.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,6:24%,12:26%,24:29%,48:31%"Basketball Awards"Resin Basketball Trophy (Male). Ideal for leagues, schools, and tournaments. Fast shipping.tr7000Basketball, Sportscustom-pagetrophies-baseball1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511224.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,6:24%,12:26%,24:29%,48:31%Resin Award (Male Baseball Batter). Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.tr6096Baseball / T-Ball, Sportscustom-pagetrophies-drama1trophies105503-610.4513028.65Classic MedallicsTrophiesAcademic1:22%,10:25%,50:29%,100:34%"Drama Awards" "Drama Trophies" "Drama Trophy"This sculptured resin Drama Trophy Includes Engraving. Be sure to see other section for additional Drama Awards.schooltrophies12See more popularin a large variety of styles.trophies-drama07-28-2010Dramacustom-pagetrophies-golf1"3-6 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"trophies105503-610.811215.2Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,3:26%"Golf Awards"tr5419Golf, Sportscustom-pagequickshiptrophies-graduate1trophies105503-610.4513028.65Classic MedallicsTrophiesAcademic1:22%,10:25%,50:29%,100:34%"Graduation Award" "Graduation Awards"This sculptured resin Graduation Award (Boy) Trophy Includes Engraving. Be sure to see other section for additional Boy's Graduation Awards.schooltrophies21Graduation, Academiccustom-pagequickshiptrophies-graduate1trophies105503-610.4513028.65Classic MedallicsTrophiesAcademic1:22%,10:25%,50:29%,100:34%"Graduation Award" "Graduation Awards"This sculptured resin Graduation Award (Girl) Trophy Includes Engraving. Be sure to see other section for additional Girl's Graduation Awards.schooltrophies20Graduation, Academiccustom-pagereadingawards1105503-610.4513028.65Classic MedallicsTrophiesAcademic1:22%,100:34%This sculptured resin Reading Awards Trophy Includes Engraving. Be sure to see other section for additional Reading Awards.schooltrophies303-20-2016Readingcustom-pagescienceawards1105503-610.4511211.73Classic MedallicsTrophiesAcademic1:22%,10:25%,50:29%,100:34% "Science Awards"This sculptured resin Science Award Trophy Includes Engraving. Be sure to see other section for additional Science Awards.schooltrophies603-15-2016Sciencecustom-pagequickshiptrophies-spelling1trophies105503-610.4511224.45Classic MedallicsTrophiesAcademic1:22%,10:25%,50:29%,100:34%"Spelling Awards"This sculptured resin Spelling Award Trophy Includes Engraving. Be sure to see other section for additional Spelling Awards.schooltrophies1512-20-2020Spellingcustom-pagetrophies1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-611224plaques1Find resin trophies discounted at TrophyCentral. Each resin trophy features free engraving. Fast 1-2 day shipping.tr-resin-trophiescustom-pageemployee-resource-hub11Comprehensive retirement and service milestone recognition guide. Discover meaningful ways to honor career achievements, service anniversaries, and retirement celebrations that create lasting memories.1100"Standard Service: 7 Business Days from Receipt of Artwork, Rush Service (Extra Charge): 3 Business Days from Receipt of Artwork" "Charlotte, NC or Oxnard, CA" "UPS (FedEx available on request)""PT1=Ribbons" "PC60=930338-910.4530027.45Simba CalRibbons11:22%,2500:59%Retractable Badge Holders from TrophyCentral. Also see our great selection of engraved and personalized gifts!custom-pageghent-new-mobile-boards1Bulletin Boards4512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Reversible Magnetic Hygienic Porcelain Whiteboard with Aluminum Frame, 3'H x 4'W discounted at TrophyCentral.arm4m434Mobile, Reversiblecustom-pageghent-new-mobile-boards1Bulletin Boards4512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Reversible Magnetic Hygienic Porcelain Whiteboard with Aluminum Frame, 4'H x 6'W discounted at TrophyCentral.Mobile, Reversiblecustom-pageghent-new-mobile-boards1Bulletin Boards4512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Reversible Magnetic Hygienic Porcelain Whiteboard with Aluminum Frame, 4'H x 8'W discounted at TrophyCentral.Mobile, Reversiblecustom-pageghent-new-mobile-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Reversible Magnetic Porcelain Whiteboard with Aluminum Frame, 3'H x 4'W discounted at TrophyCentral.1arm1m143Mobile, Reversiblecustom-pageghent-new-mobile-boards1Bulletin Boards4512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Reversible Magnetic Porcelain Whiteboard with Aluminum Frame, 4'H x 3'W discounted at TrophyCentral.arm1m143Mobile, Reversiblecustom-pageghent-new-mobile-boards1Bulletin Boards4512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Reversible Magnetic Porcelain Whiteboard with Aluminum Frame, 4'H x 6'W discounted at TrophyCentral.Mobile, Reversiblecustom-pageghent-new-mobile-boards1Bulletin Boards4512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Reversible Magnetic Porcelain Whiteboard with Aluminum Frame, 4'H x 8'W discounted at TrophyCentral.Mobile, Reversiblecustom-pageghent-new-mobile-boards1Bulletin Boards4512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Reversible Music Staff Porcelain Magnetic Whiteboard, 3'H x 4''W, 1-Sided discounted at TrophyCentral.Mobile, Reversiblecustom-pageghent-new-mobile-boards1Bulletin Boards4512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Reversible Music Staff Porcelain Magnetic Whiteboard, 3'H x 4''W, 2-Sided discounted at TrophyCentral.Mobilecustom-pageghent-new-mobile-boards1Bulletin Boards4512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Reversible Music Staff Porcelain Magnetic Whiteboard, 4'H x 6''W, 1-Sided discounted at TrophyCentral.Mobile, Reversiblecustom-pageghent-new-mobile-boards1Bulletin Boards4512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Reversible Music Staff Porcelain Magnetic Whiteboard, 4'H x 6''W, 2-Sided discounted at TrophyCentral.Mobile, Reversiblecustom-pageghent-new-mobile-boards1Bulletin Boards4512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Reversible Whiteboard / Cork Bulletin Board with Aluminum Frame, 4'H x 6'W discounted at TrophyCentral.Mobile, Reversiblecustom-pageghent-new-mobile-boards1Bulletin Boards4512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Reversible Whiteboard / Cork Bulletin Board with Wood Frame, 3'H x 4'W discounted at TrophyCentral.Mobile, Reversiblecustom-pageghent-new-mobile-boards1Bulletin Boards4512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Reversible Whiteboard / Cork Bulletin Board with Wood Frame, 4'H x 6'W discounted at TrophyCentral.Mobilecustom-pageghent-new-mobile-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Reversible Whiteboard / Cork Bulletin Board with Aluminum Frame, 3'H x 4'W discounted at TrophyCentral.1armk43Mobile, Reversiblecustom-pageghent-new-mobile-boards1Bulletin Boards4512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Reversible Whiteboard / Cork Bulletin Board with Aluminum Frame, 4'H x 3'W discounted at TrophyCentral.armk43Mobile, Reversiblecustom-pageghent-new-mobile-boards1Bulletin Boards4512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Reversible Whiteboard with Aluminum Frame, 3'H x 4'W discounted at TrophyCentral.armm34Mobile, Reversiblecustom-pageghent-new-mobile-boards14512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Reversible Whiteboard with Aluminum Frame, 4'H x 3'W discounted at TrophyCentral.1armm34Mobile, Reversiblecustom-pageghent-new-mobile-boards1Bulletin Boards4512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Reversible Whiteboard with Aluminum Frame, 4'H x 6'W discounted at TrophyCentral.Mobile, Reversiblecustom-pageghent-new-mobile-boards1Bulletin Boards4512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Reversible Whiteboard with Wood Frame, 3'H x 4'W discounted at TrophyCentral.Mobile, Reversiblecustom-pageghent-new-mobile-boards1Bulletin Boards4512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Reversible Whiteboard with Wood Frame, 4'H x 6'W discounted at TrophyCentral.Mobile, Reversiblecustom-page11TrophyCentral is a leading provider of trophies, awards and display cases. Guided by customer service, TrophyCentral has over 2000 5-star reviews!custom-pagehigh-end-awards1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"general410187-1010.45444.45JcharlesCrystal Awards1:22%,25:24%"crystal awards"Find this Rhombus Award discounted at TrophyCentral. Includes free engraving.Leadershipcustom-pageawri1woyoulipr15"3-5 business days wo/imprinting, 5-7 days w/imprinting (Rush service may be available)" "Topeka, Indiana" "UPS (FedEx available on request)"ribbons465715-71 260.3650020.36Tower RibbonRibbons1:22%,50:29%:100:36%,500:45%"Quick-Ship Items"custom-pagehunting-shooting-medals20medals498552-40.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find these colorful Rifle 2" Epoxy-covered insert decals discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Rifle 3 Position Inserts (Litho) at TrophyCentral. Each Rifle 3 Position Insert can be used to create a unique plaque, medal or trophy.504921
custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Rifle 4 Position Inserts (Litho) at TrophyCentral. Each Rifle 4 Position Insert can be used to create a unique plaque, medal or trophy.504891
custom-pagehunting-shooting-medals1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Rifle Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.custom-pagehunting-shooting-medals1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Rifle Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.custom-pagehunting-shooting-medals1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Rifle Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.custom-pagenew-tc-color-medals1medals498552-30.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these colorful Rifle insert medals discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.custom-pagehunting-shooting-medals1medals498552-30.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Rifle insert medals with a personalized front rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.custom-pagecherry-insert-plaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these rifle insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.custom-pageeawardmedals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "Sports Medals"These inexpensive 1 1/4 inch Rifle Shooter Medals offer a high quality, but low price for those on a tight budget.e907011-15-2013
custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Rifle Standing Inserts (Litho) at TrophyCentral. Each Rifle Standing Insert can be used to create a unique plaque, medal or trophy.50169112-05-2014
custom-pageawri11ribbons465715-71 260.4620016.46Tower RibbonRibbonsAwareness Ribbons1:22%,50:36%Buy White Right to Life Ribbons at TrophyCentral. Each Right To Life Awareness Ribbon Features A Tape Or Pin Back And Is Available With Optional Imprinting.ritoliriShop for Right to Life Ribbons with Ease at TrophyCentral TrophyCentral has a wonderful selection, discounted and bulk pricing and great customer service. Each white right to life awareness ribbon comes with a tape or pin back and is available with optional imprinting.]]>Right to Lifecustom-pagestar-trophies20medals498551-30.5100021TrophyCentralInsertsSports, Hobby, Org, Livestock1Find these colorful Rising Star 2" Epoxy-covered inserts discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Starcustom-pagestar-trophies1"1-2 business days" "Marquette, MI" "UPS"trophies498552-310.451611.65Quick TrophyCrystal Awards1:14%"New Products"Find these fun Jade Acrylic Rising Star Awards Discounted at TrophyCentral. Free engraving!Starcustom-pagesports-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsGeneral1:22%,50:30%,100:33%,500:47%"Star Awards" "Star Award"RISING STAR Pin Letter Pins: EC Series RISING STAR Pin Lapel Pins feature a high-quality enameled finish and ship in just 1-2 business days!ec7008-10-2007Star, Generalcustom-pagetrophies-drama1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy rising-star column insert trophy features a choice of column color, a marble base and free trophy engraving.Starcustom-pagestar-trophies1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Rising Star Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Starcustom-pagestar-trophies1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Rising Star Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Starcustom-pagestar-trophies1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Rising Star Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Starcustom-pagestar-pinsplastic-pinbox-t10Lapel pins498551-30.5200040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find these Rising Star Gold Enamel Lapel Pins discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.1rising-star-u-pbStarcustom-pagestar-trophies1medals498551-30.525035.5TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these colorful Rising Star insert medals discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Starcustom-pagestar-trophies1medals498551-30.525035.5TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Rising Star insert medals with a personalized front rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Starcustom-pagestar-trophies1plaques498551-311.11623.5TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these rising star insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Starcustom-pagestar-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsBusiness1:30%,50:32%,100:35%,500:39%"Star Award" "Star Awards" "Meeting or Exceeding Goals" "Employee Lapel Pins" "Corporate Lapel Pins"Find these Rising Star pins discounted at TrophyCentral. Each Rising Star lapel pin features a gold finish and clutch-back.br36903-15-2011Star, Generalcustom-pageschool-pinsplastic-pinbox-t5lapel pins498551-20.525040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find these Rising Star Gold Enamel Lapel Pins discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.rising-star-u-pbStarcustom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsGeneral1:22%Buy these high-quality Rising Star Inserts at TrophyCentral. Each Rising Star Insert can be used to create a unique plaque, medal or trophy.51816012-20-2040General, Star, Drama
custom-pagetrophies-drama1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our rising-star insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Starcustom-pagetrophies-drama1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy rising-star insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Starcustom-pageglass-crystal-awards1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"general410187-1010.45424.45JcharlesCrystal Awards1:22%,25:24%"crystal awards" "sales awards" "service awards" "corporate sales awards" "corporate service awards" "sales award" "service award" "corporate sales award" "corporate service award"Precisely cut from optic crystal, the facets of this impressive award promise to shine like a star in the night. A most fitting presentation for your stellar performers. Available in 3 sizes.Leadershipcustom-pagetrophies-drama1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Rising Star single column insert trophy features a choice of column color, a marble base and free trophy engraving.Starcustom-pageghent-new-mobile-boards1Bulletin Boards4512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Roam Rolling Whiteboard 45"H x 36"W discounted at TrophyCentral.Mobilecustom-pagetrophies-baseball1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.45169.5Tower RibbonTrophies1:14%Rock N Jox Baseball Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.wrj651Baseball / T-Ball, Sports1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.45169.5Tower RibbonTrophies1:14%Rock N Jox Trophy - Basketball (Female). Ideal for leagues, schools, and tournaments. Fast shipping.wrj658Basketball, Sportscustom-pagetrophies1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"465713-4169.51This fun Rock-N-Sox participation trophy measures 6.5 inches in height. Price includes engraving. Available in many popular sports!rock-n-jox-allcustom-pagetrophies-football1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.45169.5Tower RibbonTrophies1:14%Rock N Jox Trophy - Football. Ideal for leagues, schools, and tournaments. Fast shipping.wrj659Football, Sportscustom-pagetrophies-cheerleading-spirit1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.45169.5Tower RibbonTrophies1:14%This Fun Rock N Jox Style Cheerleader with Star Trophy Measures 6.5 Inches In Height. Price Of Rock N Jox Cheerleader with Star Trophy Includes Engraving.wrj660Cheerleading, Sportscustom-pageshop-by-categoryqtrollerncqtrollerscqtrollerdmqtrolleryrqtrollerplqtrollerttqtrollerttwqtroller3cmqtrollerscbcup-roller-pcup-roller-scb1trophies1See our great selection of roller hockey trophies. Each roller hockey trophy includes free engraving! Fast 1-2 day shipping!Custom Roller Hockey Recognition Trophies TrophyCentral has a great selection of roller hockey awards and trophies. Be sure to see our Roller Hockey Trim Trophies, available with the current year trim, ideal for any event. Our Two-Tier Trophies are also popular for tournament winners. All of our roller hockey awards include up to three lines of FREE ENGRAVING (larger awards include additional lines). ]]>custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Roller Hockey Inserts (Litho) at TrophyCentral. Each Roller Hockey Insert can be used to create a unique plaque, medal or trophy.507411Hockey, Sports
custom-pageeawardmedals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "Sports Medals"These inexpensive 1 1/4 inch Roller Hockey Medals offer a high quality, but low price for those on a tight budget.e908212-20-2020Roller Hockey, Sports
custom-pagetrophies-roller-hockey1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%,25:23%,50:29%,100:34%Our popular Roller Hockey Participation Trophies feature a real slant-front white marble base and free personalization. Significant quantity discounts available.qtrollerncRoller Hockey, Sportscustom-pagetrophies-roller-hockey1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular roller hockey figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!qtrollerplRoller Hockey, 1st / 2nd / 3rd / Etc., Sportscustom-pagetrophies-roller-hockey1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%This popular Roller Hockey Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!qtrolleryrRoller Hockey, Sportscustom-pagetrophies-roller-hockey1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-411.215Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%Find this awesome Roller Hockey two tier championship trophy discounted at TrophyCentral. Add up to 3 lines of Free Personalization!qtrollerttwRoller Hockey, Sportscustom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Rollerblade Inserts (Litho) at TrophyCentral. Each Rollerblade Insert can be used to create a unique plaque, medal or trophy.507410Rollerblading
custom-pageeawardmedals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "Sports Medals"These inexpensive 1 1/4 inch Rollerblading Medals offer a high quality, but low price for those on a tight budget.e908112-20-2020Rollerblading
custom-pageglass-crystal-awards1"10-15 business days w/engraving" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"general105505-1010.451 2 3 4 5 6 7 8 91420.45Classic MedallicsCrystal Awards1:30%,25:29%"Minuteman" Shop for Roman Arch from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.Leadershipcustom-pagefirst-place-ribbonsstockrosetterosettecusminwfunbucustomrosetteblue-ribbonscusrossinstrstocminrosetteribbonch7rbsxrosecx1award-ribbons-rosettes1Shop rosette ribbons for awards, competitions and events. USA-made quality. Custom and stock options with fast shipping and great pricing from TrophyCentral.Elegant Designs & Premium Quality Materials

Our rosette ribbons showcase vibrant colors and professional layered construction using premium satin and acetate materials for lasting durability.

Each rosette award features a premium rosette ribbon design with carefully pleated centers with secure attachment points, and smooth-flowing streamers. The rich fabric textures and brilliant color combinations create impressive awards that recipients will proudly display.

Customization Options for Every Event

Transform standard ribbons into personalized recognition pieces with your custom text, logos, or ceremony details printed on center buttons or streamers. Choose from various ribbon lengths, streamer configurations, and specialized graphics to match your next event's theme.

Most custom rosette ribbon orders ship within 4-6 business days, with professional artwork assistance available. Our customization services ensure every ribbon award reflects your organization's unique character and prestige.

Why Choose Trophy Central for Your Rosette Ribbons

Since 1999, Trophy Central has delivered exceptional rosette ribbon awards with USA-based production and unmatched customer service expertise. Our commitment to producing superior rosette awards with quality materials, competitive pricing, and reliable shipping has earned thousands of positive reviews from satisfied customers.

Our extensive product selection includes both ready-to-ship stock options and fully customized designs at transparent price points for every budget. Trust our award specialists to help you select the perfect rosette ribbons for your recognition needs.

Order with Confidence

Browse our extensive rosette ribbon collection online and easily customize your awards with our user-friendly design tools and preview options. Take advantage of quantity discounts on larger orders and enjoy free shipping on purchases over $99. Place your order today to ensure timely delivery for your upcoming ceremony.

Frequently Asked Questions

What sizes are available for ribbon awards?

Our rosette ribbons come in multiple sizes, ranging from compact mini-rosette awards to large three-streamer designs. Each product page includes detailed sizing information to help you select the perfect dimensions for your needs.

What information can be printed on rosette awards?

Our customized rosette ribbons can feature text, logos, dates, or event names on the center buttons or streamers. The specific customization options and price vary by product, so check individual product descriptions for details.

Is there a minimum order quantity for custom rosette awards?

Minimum order requirements vary by product, so please check each individual product description for specific quantity details. Our competitive price structure makes customized ribbon awards affordable for both small ceremonies and large competitions.

How quickly do stock rosette ribbons ship?

Most stock rosette ribbons, including 1st-10th place and honorable mention ribbon awards, ship within 1-2 business days, ensuring quick delivery for urgent needs. You can view the exact availability and price for each custom product directly on its detail page.

]]>
award-ribbons-printed custom-ribbons
custom-pageclocks1"1-2 business days" "Marquette, MI" "UPS"personalized gifts498552-310.45510.45Quick TrophyGiftsClocks1:14%"New Products"Rosewood Awards Clock from TrophyCentral.Engraved Clockscustom-pageclocks11"5-10 business days w/engraving, 1-3 without" "Marquette, Michigan" "UPS (FedEx available on request)"personalized gifts498555-1010.45129.81JDS-S1:22%,5:23%custom-pageperplaq1"7-10 business days w/engraving" "Chicago, Illinois" "UPS (FedEx available on request)"perpetual plaques606307-101 3 230.6524.45RS Owensplaques1:22%Find these elegant Piano Finish Rosewood Perpetual Plaques in a variety of sizes. Each Rosewood Perpetual Plaque includes free engraving of header plate and one nameplate.custom-pagegavelplaques11"4-6 business days" "Mount Vernon, NY" "UPS"plaques105503-610.4513636.45Classic MedallicsPlaques, GiftsGavels1:22%Rosewood Gavel from TrophyCentral. Engrave your Gavel for Special Touch. Quick Shipping on Gavels and Awards.Gavelcustom-pagegifts-desk-general11personalized gifts105503-610.451810.05Classic MedallicsGiftsEngraved Gifts1:22%Shop for Rosewood Keepsake Boxes from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.Engraved Giftscustom-pagegifts-desk-general1"1-2 business days" "Marquette, MI" "UPS"personalized gifts498852-310.4520034.45Quick TrophyGiftsCustom Pens1:14%"New Products"Find these fabulous Rosewood Pen Cases discounted at TrophyCentral. TrophyCentral is known for its top-rated customer serviceCustom Penscustom-pageperplaq11perpetual plaques6063010-141 3 230.45511.45RS OwensPlaquesPerpetual Plaques1:22%Find this 12 name plate perpetual plaque discounted at TrophyCentral. Features a beautiful Rosewood finish and engraving and top and first name plate.custom-pageclocks11"7-10 business days w/engraving, 1-3 without" "Chicago, Illinois" "UPS (FedEx available on request)"personalized gifts606307-101 3 230.45129.81RS Owens1:22%custom-pagename-badges-tagswoyoulipr100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Round Badges Discounted At TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.namebadges-rndcustom-pagename-badges-tagswoyoulipr100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Round Nameplate Badges Discounted At TrophyCentral.namebadges-rndncustom-pagename-badges-tagswoyoulipr100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Round Pennant Badges Discounted At TrophyCentral.namebadges-pennantcustom-pageschool-pins1"1-2 business days" "Columbia, SC"lapel pins290631-31 2 3 230.4150030.4Certificate Sourcelapel-award-pinsAcademic1:22%,50:28%,100:32%,500:36%"School Pins"Round School Lapel Pins from TrophyCentral.Generalcustom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Rowing (503631) Inserts (Litho) at TrophyCentral. Each Rowing (503631) Insert can be used to create a unique plaque, medal or trophy.503631Boating / Sailing, Sports
custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Rowing (506041) Inserts (Litho) at TrophyCentral. Each Rowing (506041) Insert can be used to create a unique plaque, medal or trophy.506041Boating / Sailing, Sports
custom-pagecospwabo50"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745315125016.5PepcoPromotional ProductsSports / Water Bottles1:14%,250:21%,500:31%,1000:45%,2500:49%Royal Blue Custom Sports Bottles from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.sportsbottles-royalSports / Water Bottlescustom-pagerunning-trophies20medals498551-30.5100021TrophyCentralInsertsSports, Hobby, Org, Livestock1Find these colorful Running 2" Epoxy-covered inserts discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.custom-pagetrophies-track-field1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Running Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.custom-pagetrophies-track-field1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Running Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.custom-pagetrophies-track-field1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Running Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.custom-pagetrophies-track-field1medals498551-30.525035.5TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these colorful Running insert medals discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Running, Sportscustom-pagetrophies-track-field1medals498551-30.525035.5TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Running insert medals with a personalized front rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Running, Sportscustom-pagetrophies-track-field1plaques498551-311.11623.5TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these running insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.11Find running medals discounted at TrophyCentral. Each running medal features a free ribbon. custom-pagetrophies-track-field1105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Jogging Or Marathon Inserts (Litho) at TrophyCentral. Each Jogging Or Marathon Insert can be used to create a unique plaque, medal or trophy.506731custom-pageaward-medalsrunning-e-part-irunning-plaque-irunning-part-irunning-single-irunning-e-single-irunning-champ-iir36e9083e7037marathon-mcmarathon-mc-prmarathon-jigfmarathon-jisfmarathon-jibfmarathon-single-imarathon-part-irunning-jigfrunning-jisfrunning-jibfrunning-mcrunning-mc-pr1trophies1Find running trophies discounted at TrophyCentral. Each running trophy includes up to 3 lines of personalization. Shop With Ease At TrophyCentral We have a large selection of running awards and trophies, fast shipping and great customer service. We also have discounted prices with large quantity price breaks.]]>trophies marathon-medalscustom-pageletter-shaped-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find these popular S-shaped custom mascot badges at TrophyCentral. Great for fundraising! TrophyCentral is a top-rated Yahoo merchant.letterbadges-scustom-pagetrophiesqtwingedwheelncqtwingedwheelscqtwingedwheeldmqtwingedwheelplqtwingedwheelyrqtwingedwheelttqtwingedwheelttwqtwingedwheel3cmqtwingedwheelscbcup-wingedwheel-scbcup-wingedwheel-pbdg-wheelbr5541trophies1Find safe driver trophies discounted at TrophyCentral. Each wheel and safe driving trophy features free personalization. Fast 1-2 day shipping. Perfect for racing and drivers ed classes.wheel trophies, wheel trophy, wheel awards, wheel trophies and awards

Shop For Custom Driving Trophies and Awards With Confidence at TrophyCentral

We offer a huge selection, discounted pricing and great customer service. Do you need help with some ideas or with ordering? Yes, we sell online, but we have real people who would love to help you! Feel free to call our customer service experts in Michigan, New York and online. TrophyCentral - delivering smiles since 1999!


]]>
custom-pagequickshiptrophies-wheel1trophies498551-310.453633.4trophies1Find this budget wheel / safe driver award trophy discounted at TrophyCentral. Features a real marble base and plastic winged steering wheel figure. Engraving is free. Fast 1-2 day shipping.Drivingcustom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these high-quality Safe Driver Award Inserts at TrophyCentral. Each Safe Driver Award Insert can be used to create a unique plaque, medal or trophy.518571General
custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these high-quality Safe Driver Inserts at TrophyCentral. Each Safe Driver Insert can be used to create a unique plaque, medal or trophy.517653General
custom-pagequickshiptrophies-wheelplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"Find these Safe Driver pins discounted at TrophyCentral. Each Safe Driver Award pin features a quality finish and clutch back.br554Generalcustom-pagefreeawardcertificates1"Download Only"certificates49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Safety template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Safety-Certificatesafety-freeSafety, Employee, Academiccustom-pagecorporatepinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsBusiness1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"Find Safety First pins discounted at TrophyCentral. Each Safety First Lapel Pin features a quality clutch-back.br356Generalcustom-pagemedallion-inserts-occupational-subjects12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsGeneral1:22%Buy these quality Safety Inserts (Litho) at TrophyCentral. Each Safety Insert can be used to create a unique plaque, medal or trophy.491509General
custom-pageachievement-certificates-awards1"Download Only"free-academic49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Safety Patrol template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Safety-Patrol-Certificatesafety-patrol-freeSafety, Employee, Academiccustom-pageawardcertificates11certificates290631-31 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,25:24%,100:40%,500:50%Find These Printed Safety Patrol certificates discounted at TrophyCentral. Each Safety Patrol certificate is beautifully printed and template measures 8 1/2 x 11.984Academiccustom-pageschool-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"Find these Safety Patrol Pins discounted at TrophyCentral. Each pin features a quality clutch back. Be sure to browse all of our student lapel pins.br43612-20-2020Safety Patrolcustom-pagecorporatepinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsBusiness1:30%,50:32%,100:35%,500:39%Find this Safety Through Teamwork Pin at TrophyCentral. Safety Through Teamwork and other pins ship in just 1-2 business days!br529Businesscustom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these high-quality Safety Through Teamwork Inserts at TrophyCentral. Each Safety Through Teamwork Insert can be used to create a unique plaque, medal or trophy.518356General, Business
custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Sail 1 Design Inserts (Litho) at TrophyCentral. Each Sail 1 Design Insert can be used to create a unique plaque, medal or trophy.50443109-17-2016Boating / Sailing, Sports
custom-pagetrophies-sailing-boat1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with sailboat figure discounted at TrophyCentral. Includes free text engraving!cup-sailboat-pBoating / Sailing, Sportscustom-pagetrophies-sailing-boat1trophies498551-310.453633.4trophies1Find this budget sailing award trophy discounted at TrophyCentral. Features a real marble base and plastic sailboat figure. Engraving is free. Fast 1-2 day shipping.Boating / Sailing, Sportscustom-pagetrophies-sailing-boat1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:38%Our popular Sailboat participation trophies feature a real slant-front marble base and free engraving.qtsailboatncBoating / Sailing, Sportscustom-pagetrophies-sailing-boat1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these sailboat budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtsailboatscbBoating / Sailing, Sportscustom-pageshop-by-categoryqtsailboatncqtsailboatscqtsailboatdmqtsailboatplqtsailboatyrqtsailboatttqtsailboatttwqtsailboat3cmqtsailboatscbcup-sailboat-scbcup-sailboat-pbdg-sailing1trophies1Reward top sailors and regatta winners with beautiful custom sailing trophies and awards. Find the perfect boat trophy at TrophyCentral today. Shop for Custom Sailing Trophies with Ease at TrophyCentral TrophyCentral has a great online selection to meet your needs. Be sure to see our popular Single Column Sailing Trophy, available in several sizes and with several different color columns. Our place trophies with a sail boat figure and choice of 1st, 2nd or 3rd place trim is also a popular choice. These sailing awards are perfect for a race or club event. Recognizing your sailors is a breeze at TrophyCentral!

Frequently Asked Questions (FAQ)

Can sailing awards be personalized?

Yes! All trophies in the sailing section include free engraving, allowing you to add winner names, event details, or a special message. Personalization makes each award more meaningful and unique.

How long does it take to receive a sailing trophy?

Most of our sailing trophies and awards ship within a fast 1-2 business days. If you need an award quickly, we also offer expedited shipping options to ensure it arrives on time for your event.

Do you offer bulk discounts?

Yes! We offer special pricing for bulk orders. If you are purchasing multiple trophies for a sailing club, regatta, or league, contact us for a custom quote.

]]>
silver-cup-trophies crystalcups
custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Sailing 6 Meter Inserts (Litho) at TrophyCentral. Each Sailing 6 Meter Insert can be used to create a unique plaque, medal or trophy.503861Boating / Sailing, Sports
custom-pagefree-sports-templates1"Download Only"free-sports4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Sailing template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Sailing-Certificatesailing-freeBoating / Sailing, Sportscustom-pagetrophies-sailing-boat1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.05Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%Find This Popular Sailing Deluxe Platform Series Trophies Discounted at TrophyCentral. Real Marble Base; Free Personalization!qtsailboatdmBoating / Sailing, Sportscustom-pagetrophies-sailing-boat1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Fabulous Sailboat Figure Trophy with choice of 1st, 2nd or 3rd place trim.qtsailboatplBoating / Sailing, 1st / 2nd / 3rd / Etc., Sportscustom-pagetrophies-sailing-boat1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find these popular Sailboat Figure year trim trophies discounted at TrophyCentral. Available in multiple sizes and includes free personalization.qtsailboatyrBoating / Sailing, Sportscustom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these high-quality Sales - Inserts at TrophyCentral. Each Sales - Insert can be used to create a unique plaque, medal or trophy.51332112-20-2020Occupations
custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these high-quality Sales Achievement Award Inserts at TrophyCentral. Each Sales Achievement Award Insert can be used to create a unique plaque, medal or trophy.517787Occupations
custom-pagefreeawardcertificates1"Download Only"certificates49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Sales Award template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Sales-Award-Certificatesales-award-freeSales, Employeecustom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these high-quality Sales Excellence Inserts at TrophyCentral. Each Sales Excellence Insert can be used to create a unique plaque, medal or trophy.518499Occupations, Business
custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these quality Sales Lady Inserts (Litho) at TrophyCentral. Each Sales Lady Insert can be used to create a unique plaque, medal or trophy.501411Occupations
custom-pagecorporatepinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsBusiness1:30%,50:32%,100:35%,500:39%"Meeting or Exceeding Goals"Find this Sales Leader pin discounted at TrophyCentral. Each Sales Leader lapel pin features a clutch-back. Large quantity discounts.br37004-07-2006Business, Leadershipcustom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these high-quality Sales Leader Award Inserts at TrophyCentral. Each Sales Leader Award Insert can be used to create a unique plaque, medal or trophy.518184Occupations, Leadership
custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these high-quality Sales Person Of The Month Inserts at TrophyCentral. Each Sales Person Of The Month Insert can be used to create a unique plaque, medal or trophy.518174Occupations
custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these quality Salesman Inserts (Litho) at TrophyCentral. Each Salesman Insert can be used to create a unique plaque, medal or trophy.504511Occupations
custom-pagetrophies-beauty-queensashessacsiribbons1-tiarasribbons1-crownspacofbacnumconnumraffleticketssorufologomegaphoneshafarasimascot-badgesletter-shaped-badgesseatcushionscustom-pom-poms1award-ribbons-rosettes2-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
498555-8.52"Awards" "Purchase Trophies" "Purchase Trophies Online" "Buy Trophies Online" "Trophy Store" "Trophy Stores"Shop sashes, tiaras, crowns, and event accessories for competitions, pageants, and school events. Perfect for recognizing achievements in style.banners-spirit
12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
498555-8.52See our great selection of ribbon sashes, tiaras and crowns all discounted at TrophyCentral and perfect for pageants or homecoming!1Shop with Confidence at TrophyCentral! If you are looking to buy homecoming sashes online, look no further! TrophyCentral has a great selection that will fit any budget. Our top-rated representatives are happy to assist you with all of your pageant and homecoming sash needs. Our experts in New York and Michigan have been providing suggestions and guidance since 1999! To find the perfect custom homecoming and pageant sashes, click on an image above, or for personal service, call us toll-free at 1-888-809-8800.
]]>
custom-pagemusicartpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsMusic, Drama, Art, Dance1:22%,50:30%,100:33%,500:45%"Music Lapel Pins" "Band Lapel Pins" "Music Pins"Find These Saxophone Lapel Pins Discounted at TrophyCentral. Each Saxophone Pin Features a Clutch-Pin Back and Fast 1-2 Day Shipping!mp6Music / Band / Choruscustom-pagefree-sports-templates1"Download Only"free-sports free-academic49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Scholar Athlete template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Scholar-Athlete-Certificatescholar-athlete-freeAcademic, Sportscustom-pageschool-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins"br43506-14-2010General, Academic (General)custom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these high-quality Scholar Athlete Inserts at TrophyCentral. Each Scholar Athlete Insert can be used to create a unique plaque, medal or trophy.51839906-15-2012Sports
custom-pageschool-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins"Find this Scholar Athlete Pin at TrophyCentral. Scholar Athlete and other pins ship in just 1-2 business days!br43006-14-2010Academic (General)custom-pagescholarship-award11custom-pagescholarship-award11Thank you page for TrophyCentral's Scholarship Award application submission.1custom-pagescholarship-resource-hub11See real winning scholarship essays with annotations explaining what works. Includes 4 fill-in-the-blank templates for sportsmanship and character essays.custom-pagescholarship-resource-hub11Comprehensive scholarship interview preparation guide for students. Includes 20 common questions with answer strategies.custom-pagescholarship-resource-hub11Master scholarship season with this teacher timeline guide. Learn when requests peak, how to plan ahead, and manage deadlines without overwhelm. Practical monthly planning strategies.11custom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these quality Scholastic Achievement (493641) Inserts (Litho) at TrophyCentral. Each 2"nsert can be used to create a unique plaque, medal or trophy.493641General, Academic
custom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these quality Scholastic Achievement (506721) Inserts (Litho) at TrophyCentral. Each Scholastic Achievement (506721) Insert can be used to create a unique plaque, medal or trophy.506721General
custom-pagemedals-ir-series12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic Medallicsaward-medalsAcademic1:22%,10:27%,100:36%"School Medals" "School Awards"These 1 1/2 Inch Scholastic Achievement medals come in gold, silver and bronze finishes and are perfect for recognizing different place winners.ir32Academic
custom-pagemedals-diamond-cut-edge12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic Medallicsaward-medalsAcademic1:22%,25:29%,100:38%"School Awards" "School Award Medals"See Our Scholastic Achievement Medals With A Diamond-Cut Edge. Also See Our Other High-Quality Scholastic Achievement Awards At TrophyCentral!z9003General, Academic
custom-pageeawardmedals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsAcademic1:22%,100:28%,500:34%,1000:45%These inexpensive 1 1/4 inch Scholastic Achievement Medals offer a high quality, but low price for those on a tight budget.e9003General, Academic
custom-pagemedallion-inserts-academic-medallion-inserts1105502-40.3713003.37Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Find these fabulous Scholastic Awards With Imprint Inserts and Medals discounted at TrophyCentral. TrophyCentral is known for its top-rated customer serviceGeneralcustom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these quality Scholastic Lamp And Books Inserts (Litho) at TrophyCentral. Each Scholastic Lamp And Books Insert can be used to create a unique plaque, medal or trophy.507393General, Academic
custom-pagetrophies-honor-roll-society125medals105502-50.751 2 3 4 5 6 7 8 9130042.75Classic Medallicsaward-medals1:22%,500:41%Find School Subject Award Medals at TrophyCentral. All Academic Award Medals include Neck Ribbons and Optional Engraving.Academiccustom-pagefree-school-certificate-templatescitizenship-awardsscience-award-certificatesreading-certificateshonor-roll-certificatesmusic-award-certificates7002700770127003700470107020702170307027703570507036artawce9039069099139049079189059089129209299329219309339319359409439619649419629659429509639669699719849681certificates0.31"School Awards" "Quick-Ship Items" "Gold School Medals" "Award Certificates and Diploma Covers" "Award Certificates and Diploma Holders" "Award Certificates and Diploma Frames" "Award Certificate and Diploma Holders" "Certificate and Diploma Holders" "Certificates and Frames" "Certificates and Diploma Holders" "Diploma Covers and Certificates" "Diploma Covers and Award Certificates" "Diploma Covers, Frames and Holders" "Diploma Covers, Frames, Holders and Certificates"Find school certificates discounted at TrophyCentral. Each school certificate and template measures 8 1/2 x 11. Fast 1-2 day shipping.

Printed School Certificates & Templates with Photo Images

This section includes a fabulous selection of high-quality, academic certificates featuring colorful photographs. Each school certificate measures a standard 11" x 8 1/2", is printed on 60 lb. paper and includes a place to write or print the student's name, event, date and more. There are a large variety of school subjects, including: honor roll, art, attendance, science, math, reading, student council and many more. We also have several other related sections: printed certificates (colorful certificates in a variety of school subjects), sports certificates and custom certificates.

Shop with Confidence at TrophyCentral!

If you are looking to buy school certificates online, look no further! TrophyCentral has a great selection that will fit any budget. Our top-rated representatives are happy to assist you with all of your sports and school certificate and award needs. Our experts in New York and Michigan have been providing suggestions and guidance since 1999! To find the perfect school certificate, click on an image above, or for personal service, call us toll-free at 1-888-809-8800.

]]>
custom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these high-quality School Bus Inserts at TrophyCentral. Each School Bus Insert can be used to create a unique plaque, medal or trophy.518218Academic, Occupations, School Bus
custom-pageschool-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"Find this School Bus Pin at TrophyCentral. School Bus and other pins ship in just 1-2 business days!br30612-20-2020Academic, Occupations50"28 business days"4020128-350.83030.8CentennialDiploma Covers11:22%,2500:47%"Diploma Covers" "Padded Diploma Covers" "Diploma Holders" "School Diploma Covers" "Award Certificates and Diploma Covers" "Award Certificates and Diploma Holders" "Award Certificates and Diploma Frames" "Award Certificate and Diploma Holders" "Certificate and Diploma Holders" "Certificates and Frames" "Certificates and Diploma Holders" "Diploma Covers and Certificates" "Diploma Covers and Award Certificates" "Diploma Covers, Frames and Holders" "Diploma Covers, Frames, Holders and Certificates"Find these School Diploma Covers and Holders at TrophyCentral. These high-quality school covers are available in a variety of styles and colors.12-20-2020custom-pagetrophies-academic1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511230.45Classic MedallicsTrophiesAcademic1:22%,6:23%,12:24%,24:26%Shop for Cast Stone School Lamp of Learning Awards at TrophyCentral. We have a great selection of School Lamp of Learning and other recognition trophies at discounted prices.tr9911Academiccustom-pagefree-school-certificate-templateshonorrollpinsreadingpinsmath-lapel-pinsperfect-attendance-pinsscience-lapel-pinsspelling-pins-medals3d-2026student-council-pins3d8-academic1xxxec835004xal82rising-star-u-pbec16academic-u-pbec35academic-pbhp07hp20hp19hp22hp24hp25hp02hp06ap72ap77ap80ap68ap118ap04ap09br304br363br319br601hp13br314br134br306br634br567br357br358br436br405br411br395br540br436br430br471br377br2218br241br43511xxbr2119111x1lapel-award-pins1School pins are more than just accessories. These academic pins are cherished tokens of recognition and pride. From commemorating academic milestones to promoting school spirit, our custom pins offer a versatile solution for any occasion.

With options for personalization, bulk ordering, and fast shipping, we make it easy to honor your students' achievements. Explore our collection today and find the perfect pin to celebrate your school's unique community.

Why Choose Trophy Central for Your Award Pins?

Trophy Central has been a trusted leader in recognition products since 1999, serving over 100,000 customers, including 370+ Fortune 500 companies and 9,600+ educational institutions.

Our commitment to excellence encompasses expert design assistance, fast production turnaround, and competitive bulk pricing, all backed by secure online ordering and multiple payment options.

Our U.S.-based production facilities ensure superior quality control, while our dedicated team works closely with educators to create meaningful awards that inspire achievement. We understand that each recognition moment matters, which is why schools across the nation trust us to deliver exceptional quality and personalized service for their recognition needs.

Order School Lapel Pins Today

Getting your custom school pins is made simple with our user-friendly online ordering system and expert support team. Order today or contact our knowledgeable staff for any assistance.

Frequently Asked Questions

Is there a minimum order quantity for school pins?

Yes, our minimum order is 10 lapel pins per design. This ensures cost-effective pricing while maintaining our high-quality standards.

Can I mix different lapel pin designs in the same order?

Yes, you can combine different styles, such as honor roll pins and attendance pins, in a single order. Many schools order a variety of lapel pins to recognize different achievements.

]]>
custom-pagemascotpins1"1-2 business days" "Columbia, SC"lapel pins292121-31 2 3 230.4150030.4Certificate Sourcelapel-award-pinsAcademic1:22%,50:28%,100:32%,500:36%Find School Mascot Pins at TrophyCentral. Mascot Pins Ship in Just 1-2 Business Days.Mascot11See our school medals and awards in a large number or styles and subjects. Each school medal below includes a neck ribbon.academic medals, school medals, scholastic medals, school medal, academic medal1

School Medals and Awards

TrophyCentral has an industry-leading selection of medals to meet all of your academic needs. If you are looking for a quality school medallion or medal, you have come to the right place! Medals are available in several sizes, starting from 1 1/4" in diameter for our inexpensive budget medals up to over 2". Depending on type, they may be available in a gold, silver or bronze finish, a color finish, or both. Each recognition school medal features a FREE NECK RIBBON - we have a huge selection to choose from, so you should be able to easily match your school colors! We also offer large quantity discounts.

Insert Medals - School Subjects

If you have a hard-to-find school subject, be sure to see our large selection of academic Inserts. Inserts are 2" discs that are available in a huge number of titles. Inserts can be used to create a unique medal, plaque or even a trophy and are available in gold / silver /bronze or full color! We have many generic inserts as well, for example, star performer and rising star. We also have a large selection of mascot medals and award ribbons.
]]>
custom-pageachievement-certificates-awards1"Download Only"free-academic4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our School Newspaper template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-School-Newspaper-Certificateschool-newspaper-freeSchool Newspaper, Academiccustom-pagetrophies-academic1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453633.4Quick TrophyTrophiesGeneral1:14%,10:17%,25:23%,50:29%,100:34%Our Academic Lamp Participation Trophies feature a real slant-front white marble base and free personalization. Significant quantity discounts available.qtacadncBe sure to see our fabulous selection oftrophies-school7-14-2009Academiccustom-pagetrophies-music1award-ribbons-printed"1-2 business days" "Topeka, Indiana" "UPS (Post Office Priority Mail may also be available)"ribbons465711-21 2618024.36Tower RibbonRibbons1:22%,50:45%Shop for school award ribbons at TrophyCentral.com. These fun school ribbons are available in several titles, including science, honor roll, reading, spelling and more!school ribbons, school award ribbons, fun school ribbons, spelling ribbons, honor roll ribbons, science ribbons, award ribbons, fun award ribbonsBirthday, Honor Roll, Music / Band / Chorus, Reading, Science, Super Speller, Student of the Month, Math, Academiccustom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these high-quality School Safety Patrol Inserts at TrophyCentral. Each School Safety Patrol Insert can be used to create a unique plaque, medal or trophy.51843206-30-2012Academic
custom-pageschool-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"Find these Safety Patrol pins discounted at TrophyCentral. Each School Safety Patrol pin features a quality clutch-back. Fast 1-2 day shipping.br30408-12-2010Safety Patrolcustom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsAcademic1:22%Buy these quality Mylar School Spirit Cheerleader Decal Inserts at TrophyCentral. Each decal can be used to create a unique plaque, medal or trophy.489824Cheerleading, Sports
custom-pagerooterpoms11"PC10=10-1411 2 3 4 5 6 7 8 9PepcoPromotional ProductsSpirit1Use this setup option for printing more than one color on your school spirit item. The setup charge is based on the number of colors and imprints required.1Spiritcustom-pagecl29100"1-3 business days" "Columbia, South Carolina" "UPS (FedEx available on request)"290631-31 2 3 230.45200020.45Certificate Source1:22%,200:27%,500:35%"Quick-Ship Items" "Award Certificates and Diploma Covers" "Award Certificates and Diploma Holders" "Award Certificates and Diploma Frames" "Award Certificate and Diploma Holders" "Certificate and Diploma Holders" "Certificates and Frames" "Certificates and Diploma Holders" "Diploma Covers and Certificates" "Diploma Covers and Award Certificates" "Diploma Covers, Frames and Holders" "Diploma Covers, Frames, Holders and Certificates"Find School Certificate Awards Discounted at TrophyCentral. Choose From A Large Variety of School Certificates.custom-pageacademic-lamp-general504015177855074214897814933115054915181564897335181634897204898294898284897795074855182085182344897784929514976465047915140525017315044214897905181804898865184824897005181624897895181865183014897555182044897485072314899015183994897464936415067214899055073935182185184325184105045015044814897574959014899034899044960905181614898124897115181724896675178065178255178055183884898971inserts11Find for academic inserts and school insert medals discounted at TrophyCentral. Each 2" inserts can be used in a medal frame, plaque or trophy.2" Academic Inserts The above inserts measure 2" in diameter and can be used to create your own medal, trophy or plaque. The inserts (discs) are perfect for recognizing an outstanding student or special teacher. TrophyCentral's top-rated customer service experts have been assisting customers since 1999! If you have any questions, please do not hesitate to call us at 1-888-809-8800.]]>11Find beautiful and unique school trophies at TrophyCentral. Each School Trophy includes free engraving.custom-pageachievement-certificates-awards1"Download Only"free-academic4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our School Yearbook template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-School-Yearbook-Certificateschool-yearbook-freeSchool Yearbook, Academiccustom-pageschool-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:30%,100:35%,500:48%"School Pins"Find these fabulous Yearbook Pins discounted at TrophyCentral. Each School Yearbook Lapel Pin features a quality finish and clutch back. Fast 1-2 day shipping.hp2506-15-2024Yearbook, Academiccustom-pagemath-medalsscience-ribbonsbstick6science-award-plaquescience-plaque-i1trophies-academic1

Science Trophies & STEM Awards - Honor Scientific Excellence

Science trophies recognize student achievement and innovation across biology, chemistry, physics, earth science, engineering, and STEM competitions celebrating young researchers pushing boundaries of scientific discovery. As prestigious symbols of academic accomplishment, quality science fair trophies provide impressive display pieces that participants showcase for years as lasting reminders of their dedication. These customizable awards feature scientific themes including beakers, microscopes, atoms, DNA structures, and planetary designs, durable construction with weighted bases for stable display, multiple height options from compact desk trophies to towering championship columns, and complimentary engraving plates for student names, project titles, placement, school names, and event dates. Available in economical participation trophy sizes starting at 6 inches for classroom recognition to impressive 20-inch championship columns for regional and state competitions, science trophies accommodate programs from elementary school fairs to prestigious national STEM olympiads. Perfect for honoring grand champion winners, category first place finishers, outstanding research methodology, innovation excellence, or best of fair distinctions, these trophies create memorable recognition moments while providing permanent keepsakes that inspire continued scientific pursuit.

Expand your recognition program: Explore Academic Trophies for comprehensive STEM recognition options. Learn more: Science Fair History and Educational Impact.

Frequently Asked Questions About Science Trophies

What trophy sizes work best for different science fair award levels?

For elementary classroom science fairs and participation recognition, 6-inch to 9-inch economy trophies provide meaningful awards at accessible price points for recognizing all young scientists. Middle school regional competitions and category winners benefit from 10-inch to 14-inch single column trophies featuring scientific inserts and school color ribbons, creating impressive displays worthy of months of research while managing budgets across multiple categories. High school state championships, STEM olympiads, and prestigious competitions deserve 15-inch to 20-inch multi-column championship trophies with substantial presence reflecting the significance of top-tier scientific achievement. Grand champion and best of fair awards often feature cup-style trophies or unique custom designs 18-24 inches tall that distinguish overall winners from category placements. Many programs create visual hierarchies using smaller trophies for category finalists, medium trophies for first through third place, and reserve largest statement pieces exclusively for grand champions and special innovation awards.

What information should science trophy engraving include?

Essential engraving elements include student name, specific achievement or placement, competition name, and event date. Examples: Sofia Rodriguez, Grand Champion, State Science Fair 20XX or James Thompson, First Place Chemistry, Regional STEM Competition April 20XX. Research-focused fairs benefit from abbreviated project titles like Renewable Energy Innovation or Marine Biology Research. Achievement-specific trophies gain clarity through detailed titles such as Outstanding Experimental Design, Excellence in Scientific Methodology, or Judge's Choice Award for Innovation. School pride elements like Lincoln Middle School Science Fair add institutional recognition. Team projects should acknowledge collaborators like Martinez and Chen Research Team. Multi-year competitions benefit from adding grade level such as Eighth Grade Division Champion to provide context for display.

When should science fairs use trophies versus medals for student recognition?

Science trophies excel for grand champion recognition where statement pieces reflect months of intensive research, perpetual awards displayed permanently in school trophy cases showcasing program excellence, smaller elite competitions with limited top finishers deserving substantial display awards, and creating clear hierarchies where trophy size visually communicates achievement levels from category winners to overall champions. Their permanent display nature makes trophies ideal for long-term recognition in homes and schools. Science medals better suit large-scale fairs requiring immediate wearable recognition for hundreds of participants, multi-category competitions acknowledging numerous placements where affordability enables broader recognition, traveling regional events where portability matters, and programs where students showcase awards immediately following judging ceremonies. Successful programs often combine both by presenting medals for all category placements and participant recognition, while reserving impressive trophies exclusively for grand champions, best of fair, distinguished research excellence, and special innovation awards.

If you need more information before deciding, see our expert resource guides:
]]>
trophies
custom-pagescience-medal-inserts20498552-40.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find these colorful Science 2" Epoxy-covered insert decals discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Sciencecustom-pageachievement-certificates-awards1"Download Only"free-academic49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our science award certificate template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Science-Award-Certificate1science-award-certificatesSciencecustom-pageachievement-certificates-awards1"Download Only"free-academic49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"See this Science Certificate designed exclusively for TrophyCentral! Science Certificates can be downloaded for free! Each Science Certificate measures 11 x 8 1/2 inches.scienceSciencecustom-pagescienceawards1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Science Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Sciencecustom-pagescienceawards1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Science Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Sciencecustom-pagescienceawards1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Science Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Sciencecustom-pagescience-medal-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects" "Science Awards"Buy these high-quality Science Award Inserts at TrophyCentral. Each Science Award Insert can be used to create a unique plaque, medal or trophy.518410Science
custom-pagebr584plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"Science Awards" "School Pins"Find this Science Subject Award Lapel Pin at TrophyCentral. Science Lapel Pins and other School Subject Pins Ship in Just 1-2 Business Days!br43204-08-2007Sciencecustom-pagescienceawards1"1-2 business days" "Topeka, Indiana" "UPS (Post Office Priority Mail may also be available)"465711-21 260.3620030.36Tower RibbonRibbons11:22%,50:46%Find science ribbons discounted at Trophy Central. Choose from 1st - 6th place, participant and more!Sciencecustom-pageawardcertificates11certificates290631-31 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,25:24%,100:40%,500:50%Find this science certificate award discounted at TrophyCentral. Each science award is beautifully printed and measures 8 1/2 x 11.science-award-certificates02-01-2008Sciencecustom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceCertificates / CoversEmbosser Seals1:22%,3:28%,5:31%Find these Science Certificate Seals discounted at TrophyCentral. Embossed science seals are easy to apply with a pressure-sensitive backing.803sciSciencecustom-pagescienceawards70267029906803sci1awardcertificates11Find science certificates and science fair certificates discounted at TrophyCentral. Each certificate measures 8 1/2" x 11" and is beautifully printed.Shop with Ease at TrophyCentral TrophyCentral has a wonderful selection of high quality products, discounted prices and top-rated customer service. We have been helping customers since 1999 and we would be happy to help you, too!

Frequently Asked Questions (FAQ)

What types of science award certificates do you offer?

We offer a wide range of **science award certificates**, including those for **science fairs, STEM achievements, classroom excellence, and innovation awards**. Our certificates come in different designs and can be customized for students, schools, and competitions.

Can I personalize my science certificates?

Yes! You can add a school name, student name, date and more.

Do you offer printable science award certificates?

Yes! We offer **both printed and digital** science award certificates. Digital certificates allow you to print awards on-demand, perfect for last-minute recognition.

How quickly can I receive my science award certificates?

Most of our **science award certificates ship within 1-2 business days**. If you need them sooner, we offer rush processing and expedited shipping options at checkout.

Do you offer bulk discounts for schools and science competitions?

Yes! We offer **discounts on bulk orders** for schools, science fairs, and competitions. The more you order, the more you save. Contact us for a **custom quote on large orders**.

Do you have other science-related awards?

Absolutely! In addition to science certificates, we offer **science medals, trophies, and plaques** for students and competitions. Check out our full selection on our Science Awards page.

]]>
scienceawards trophies
custom-pagescience-medal-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects" "Science Awards"Buy these quality Science Einstein Inserts (Litho) at TrophyCentral. Each Science Einstein Insert can be used to create a unique plaque, medal or trophy.504501Science
custom-pageachievement-certificates-awards1"Download Only"free-academic49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates" "Science Awards"See this Science Fair Certificate designed exclusively for TrophyCentral! Science Fair Certificates can be downloaded for free!sciencefairSciencecustom-pageacademic-resource-hub11Discover inspiring science fair award ideas! From budding researchers to STEM champions, find creative trophies and recognition that celebrates scientific curiosity and innovation across all grade levels.custom-pagecoaching-teaching-guides11Creative science fair award ideas with engraving examples for competitions and STEM programs. From Mad Scientist to Future Nobel Prize Winner, discover 15+ unique ways to recognize young scientists with actual trophy wording templates.custom-pagescience-medal-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects" "Science Awards"Buy these quality Science Fair Inserts (Litho) at TrophyCentral. Each Science Fair Insert can be used to create a unique plaque, medal or trophy.504481Science
custom-pagescienceawards102-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.5115014Classic Medallicsaward-medalsAcademic1:22%,25:24%,50:30%,100:36%,500:42%"School Medals" "School Award Medals" "Scholastic Medals" "Scholastic Award Medals" "Academic Medals" "Academic Award Medals" "Medals, School" "Science Awards" "Science Medals"Your students will love these colorful Mylar Science Fair Medals from TrophyCentral. Each Science Fair medal includes a neck ribbon!tm9757Science
custom-pagescience-medal-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsAcademic1:22%"Science Medals" "Award Medals" "School Medals" "Award Medals - All Subjects" "Science Awards"Buy these quality Mylar Science Fair Decal Inserts at TrophyCentral. Each decal can be used to create a unique plaque, medal or trophy.489757Science
custom-pagescience-award-certificates15"1-3 business days" "Columbia, South Carolina; Marquette, Michigan" "UPS (FedEx and Post Office Priority Mail may be available on request)"certificates290631-21 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,50:38%,100:42%"Science Awards"Find these Science Fair Participation certificates discounted at TrophyCentral. Each Science Fair Participation certificate measures 8 1/2 x 11 inches and typically ships in 1-2 days.702611-16-2006Sciencecustom-pagebr584plasticpinboxvelapinbox10br584 ap78 br432 hp18 e9005"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:34%,100:39%,500:43%"Science Awards" "School Pins"Find this Science Fair Award Pin at TrophyCentral. Science Fair Award and other pins ship in just 1-2 business days!br584Sciencecustom-pageblog-trophycentral11Most science fair programs only recognize first place. Build an award structure that celebrates every participant, strengthens school science culture, and gives students a reason to return next year.custom-pagescience-medal-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects" "Science Awards"Buy these quality Science GENERAL Inserts (Litho) at TrophyCentral. Each 2" insert can be used to create a unique plaque, medal or trophy.495901Science
custom-pagescienceawards1medals498552-30.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Colorful Science Insert Medals Discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Sciencecustom-pagescienceawards1medals498552-40.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Science Insert Medals With A Personalized Front Rim Discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Sciencecustom-pagecherry-insert-plaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these science insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Sciencecustom-pagesciencemedalsscience-ei48975749590150448150450151841011Find science medal inserts discounted at TrophyCentral. Each 2" science insert can be used to make medals, trophies and plaques.science-mcscience-mc-prscience-mge9901e9005tm9757ir22science-jigfscience-jibfscience-jisf11Find a great selection of Science Medals at TrophyCentral. Each Science Medal includes a neck ribbon. Science trophies include personalization. Fast 1-2 shipping!science medals,science trophies, science fair medals, science trophies and medals

Science Medals & STEM Awards - Celebrate Scientific Discovery

Science medals honor student curiosity and achievement across biology, chemistry, physics, earth science, engineering, and STEM competitions celebrating young innovators exploring scientific principles. As meaningful recognition for intellectual dedication, quality science fair medals provide affordable, wearable awards that participants treasure as keepsakes commemorating their research journey. These budget-friendly medals feature scientific imagery including microscopes, atoms, DNA helixes, and laboratory equipment, durable metal construction in gold, silver, and bronze finishes, free neck ribbons in school or competition colors, and complimentary back engraving for student names, project titles, placement, and event dates. Available in economical 1.25-inch participation sizes ideal for large-scale fairs to impressive 2.75-inch premium designs for grand champions, science medals accommodate programs from elementary classroom experiments to national STEM championships. Perfect for recognizing science fair participants, category winners, research excellence, innovation awards, or engineering design achievements, these medals inspire continued exploration while making recognition accessible for schools managing hundreds of young scientists annually.

Expand your recognition program: Explore Science Trophies and Explore Academic Medals for comprehensive STEM recognition options. Learn more: Science Fair History and Educational Impact.

Frequently Asked Questions About Science Medals

What medal sizes work best for different science fair levels?

For elementary classroom experiments and large school-wide fairs, 1.25-inch economy medals provide maximum affordability while delivering tangible recognition that young scientists proudly wear home. Middle school regional fairs and STEM competitions benefit from 2-inch insert medals featuring detailed scientific designs and customizable ribbons, balancing visual impact with budget management when recognizing dozens of category placements. High school championship events, state science olympiads, and prestigious competitions deserve 2.5-inch to 2.75-inch premium medals with substantial weight and elegant presentation worthy of months-long research investments. Many organizers use medal hierarchies with gold for first place, silver for second, and bronze for third within each category, while reserving larger premium medals for overall grand champions and special innovation awards.

What information should science fair medal engraving include?

Essential engraving elements include student name, specific category or placement, competition name, and event date. Examples: Emma Chen, First Place Biology, District Science Fair 2025 or Marcus Williams, Engineering Innovation Award, STEM Championship April 2025. Project-focused fairs benefit from abbreviated project titles like Solar Cell Efficiency or Water Filtration Design. Category-specific medals gain clarity through discipline identification such as Chemistry Excellence or Physics Research. Team projects should acknowledge all participants like Chen & Martinez Team. Special recognition medals become more meaningful with descriptive titles including Best Experimental Design, Outstanding Research Methodology, or Judge's Choice Innovation Award.

When should science fairs use medals versus trophies for student recognition?

Science medals excel for immediate ceremony presentations where students wear recognition home, multi-tiered category systems acknowledging numerous placements across diverse disciplines, traveling regional competitions requiring portable awards, and budget-conscious programs where affordability enables recognizing every participant plus multiple winners per category. Their wearable nature creates visible pride as students showcase medals immediately following judging. Science trophies better suit overall grand champion recognition, perpetual awards displayed permanently in school trophy cases, and small elite competitions where substantial display pieces reflect months of intensive research. Successful programs often combine both by presenting medals for all category placements and participant recognition, while reserving impressive trophies exclusively for overall grand champions, best of fair, and distinguished research excellence.


If you need more information before deciding, see our expert resource section: ]]>
scienceawards science-award-certificates
custom-pagescienceawards1498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our science insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - ScienceSciencecustom-pagescienceawards1498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy science insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Sciencecustom-pagereadingpinsbr584br432ap78hp183d-science1school-pins1Find science pins discounted at TrophyCentral. Each high quality science pin features a clutch back for easy attachment to clothing. Shop with Ease at TrophyCentral Science lapel pins are an excellent and inexpensive way to recognize your top students. Whether you need a pin for students that excel in science or who participated in a science fair, we have a fabulous selection in a variety of styles and finishes. Our pins typically ship in a fast 1-2 days. We also offer excellent customer service. Our experts in New York and Michigan have been providing suggestions and guidance since 1999. They would be thrilled to help you, too!

Frequently Asked Questions (FAQ)

🔬 What types of science pins do you offer?

We offer a variety of science lapel pins featuring designs like atoms, microscopes, DNA strands, and chemistry symbols. These pins are great for recognizing students, teachers, and science fair participants.

🏆 Who can wear science lapel pins?

Our science award pins are perfect for students excelling in STEM subjects, teachers inspiring future scientists, and professionals in scientific fields. They are also great for science clubs and academic competitions.

🧪 Can I customize my science pins?

Some of our science lapel pins can be customized with engraving or color choices. If you need a custom design for a school or organization, contact us for details on bulk orders and personalization.

📦 Do you offer bulk discounts for science club orders?

Yes! We offer discounts on bulk orders for schools, science fairs, and academic organizations. Contact us for special pricing on large orders of science award pins.

🚚 How fast can I receive my science pins?

Most science lapel pins ship within 1-2 business days. If you need them quickly, choose expedited shipping at checkout to ensure timely delivery for your event or ceremony.

]]>
scienceawards science-lapel-pins
custom-pagescienceawards1plaques498554-Feb1JDSPlaques1Find this science plaque discounted at TrophyCentral. Our science plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Sciencecustom-pagescienceawards1498551-311821.06TrophyCentraltrophies1Sciencecustom-pagegeneral-corporate-awards1606307-101 3 234222RS Owens1Find this beautiful and unique art glass sculpture award with free engraving at TrophyCentral. Choose from three popular colors.custom-pageschool-pinsplasticpinboxvelapinbox20"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,500:37%"School Pins" "School Lapel Pins"Find these scroll pins discounted at TrophyCentral. Each gold scroll pin features a clutch-back for easy and safe attachment to clothing.br134Academic, Leadershipcustom-pagesimenplaq11"4-6 business days with engraving" "Mt. Vernon, NY" "UPS (FedEx available on request)"plaques105503-610.451813.25Classic MedallicsPlaquesBlank Plaques1:22%Find this scroll plaque discounted at TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.Blank, Generalcustom-pagestar-trophies1"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"trophies458221510.45416.45Vision AwardsTrophies1:22%,51:34%Find the Sculpted Star Award discounted at TrophyCentral. Jade crystal is carved and sculpted depicting a shooting star as it emerges from a green marble base.custom-pagemedallion-inserts-government-agencies-and-logos12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%"Award Medals" "Award Medals - All Subjects" "Medals - All Others"Buy these high-quality Seal Of The United States Inserts at TrophyCentral. Each Seal Of The United States Insert can be used to create a unique plaque, medal or trophy.515524General
custom-page12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
498555-8.521
custom-page11Our search results may be filtered by price, brand, reviews, processing time and more. Check out TrophyCentral's industry-leading selection of awards and personalized gifts!1custom-pagemedallion-inserts-general-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these high-quality Second Place Inserts at TrophyCentral. Each Second Place Insert can be used to create a unique plaque, medal or trophy.5134511st / 2nd / 3rd / Etc., Sports
custom-pagemedals-ir-series12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
"PT1=Medals" "PC11=105503-60.7530036.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,10:27%,100:36%"School Medals" "School Awards"These 1 1/2 Inch Second Place Medals come in gold, silver and bronze finishes and are perfect for recognizing different place winners.ir28Return to our:section.award-medals02-01-2017General, Torch, Achievement, 1st / 2nd / 3rd Place
custom-page1st-place-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.751 2 3 4 5 6 7 8 9130042.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%Shop for Second Place Torch Medals at TrophyCentral. Fast 1-2 Day Shipping!tm9916sReturn to oursection.place-medalsSports, Academic, General, Torch, Achievement, 1st / 2nd / 3rd / Etc.
custom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceCertificates / CoversEmbosser Seals1:22%,3:28%,5:31%Find these Second Semester Embossed Certificate Seals discounted at TrophyCentral.803ssGeneralcustom-pageenclosed-bulletin-boards1Bulletin Boards4512317-101 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Sentry Enclosed Letter Boards with Satin or Bronze Aluminum Frame and Gothic Letter Set, 36"H x 30"W discounted at TrophyCentral.Enclosed - 1 Door, Indoor111custom-pageservicepins11plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"105502-30.31150030.3Classic Medallicslapel-award-pins1:30%,100:45%Find Service Anniversary Award Pins with a torch design discounted at TrophyCentral. Available in 5 year increments. Each Service Anniversary Pin features a clutch-pin back.custom-pageappreciation-templates1"Download Only"free-appreciation4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Service Award template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Service-Award-Certificateservice-award-freeSciencecustom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these high-quality Service Award Inserts at TrophyCentral. Each Service Award Insert can be used to create a unique plaque, medal or trophy.51779802-28-2015Service / Retirement
11Recognize dedication with service awards including trophies, medals, plaques and certificates. Honor volunteers, employees, frontline workers and our military heroes now.Shop for Service Awards and Trophies with Ease at TrophyCentral Celebrate the people who go above and beyond with meaningful service awards that recognize their dedication and commitment. Whether honoring years of service, volunteer contributions, safety achievements, or outstanding performance, our comprehensive selection ensures you can find the perfect recognition for every type of service. Our service awards collection spans four essential categories to meet all your recognition needs. Service trophies celebrate major milestones and achievements with impressive presentations perfect for ceremonies and special events. Service medals provide elegant, wearable recognition that recipients can proudly display. Service plaques offer lasting recognition ideal for office displays and permanent installations. Service certificates provide formal documentation of achievement and appreciation. Every service award includes free personalized engraving to make each recognition truly meaningful. Add names, dates, specific achievements, or organizational logos to create awards that recipients will treasure. With quick 1-2 day turnaround and volume discounts available, recognizing your team's service has never been easier or more affordable. From volunteer appreciation to employee milestones, find the perfect way to say "thank you" for exceptional service and dedication.]]>custom-pagecorporatepins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsBusiness1:30%,50:32%,100:35%,500:39%Find this Crystal Rhinestone Service Pin at TrophyCentral. Crystal Rhinestone Service and other pins ship in just 1-2 business days!seisourpa07-21-2011Businesscustom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsGeneral1:22%Buy these high-quality Service Is Our Passion Inserts at TrophyCentral. Each Service Is Our Passion Insert can be used to create a unique plaque, medal or trophy.518534General, Business
custom-pageschool-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:28%,100:32%,500:42%"School Pins" "School Lapel Pins"Find these popular Service AP Series Lapel Pins discounted at TrophyCentral. Fast 1-2 day shipping!ap118Service / Retirement11Service Medals represent more than achievement — they symbolize sacrifice, dedication, and the willingness to serve others. From honoring the courage of firefighters and military members to recognizing the compassion of volunteers and frontline workers, these medals are lasting tokens of appreciation. Each design is crafted for durability and presentation, making them a fitting choice for formal events or community recognition. Explore our Service Medals collection today, or visit individual categories such as military, firefighter, police, or volunteer medals for specialized designs.custom-pagesimenplaq1plaques498552-41JDSPlaques1Find this Service Plaque discounted at TrophyCentral. Our service plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Service11"PC10=10-1411 2 3 4 5 6 7 8 9Saratoga PenSetupSetup1Setup (Required For Any New Pen Imprinting) from TrophyCentral.11110-1411 2 3 4 5 6 7 8 9Saratoga PenSetupSetup1Imprinting Setup Charge for Awards and Plaques1custom-pagebaseballdisplay11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231112Perfect CaseDisplay Cases11:14%,5:15%Seven Baseball Glass Display Case. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.basedisplay-7Baseball / T-Ball, Sportscustom-pagebest-moment-captured11Submit your photo to the TrophyCentral Best Moment Captured contest. One image, any subject. The community votes, a panel of judges scores, and the winner receives a real engraved trophy. Round One submissions close March 18.1custom-pagestandout-awards111custom-pagequickshiptrophies-sheep1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:28%Find this awesome Sheep Figure two-tier championship trophy discounted, and with free engraving, at TrophyCentral!qtsheepttwcustom-pagequickshiptrophies-sheep1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:27%,100:32%Our popular Sheep Figure Participation Trophies feature a real slant-front marble base and free personalization. Significant quantity discounts available.qtsheepnccustom-pagequickshiptrophies-sheepqtsheepncqtsheepscqtsheepplqtsheepyrqtsheepttqtsheepttwqtsheep3cqtsheepdmmqtsheepscbcup-sheep-scbcup-sheep-pbdg-sheep11Find Sheep Trophies discounted at TrophyCentral. Each Sheep Trophy includes free engraving. Fast 1-2 day shipping.

Shop With Confidence at TrophyCentral

We offer a huge selection, discounted prices and great customer service. Do you need help with some ideas or with ordering? Yes, we sell online, but we have real people who would love to help you! Feel free to call our customer service experts in Michigan, New York and online. TrophyCentral - delivering smiles since 1999!


]]>
quickshiptrophies-bull quickshiptrophies-chicken quickshiptrophies-tractor
custom-pagequickshiptrophies-sheep1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Fabulous Sheep Figure Place Trophy with 1st, 2nd or 3rd Place Trim, Marble Base and Free Engraving. Ships in a fast 1-2 days!qtsheepplcustom-pagequickshiptrophies-sheep1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%This popular Sheep Figure Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!qtsheepyrcustom-pagequickshiptrophies-fireman11plaques105503-610.4512032.45Classic MedallicsPlaquesBlank Plaques1:22%Buy Shield Plaques and other Police and Hero Awards at TrophyCentral.Firefightercustom-pagestar-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:34%,100:39%,500:43%"Star Pins" "Star Lapel Pins" "Star Award Pins"Find this Shining Star - 1 Inch Gold Pin (BR Series) Discounted at TrophyCentral. Fast 1-2 Day Shipping.br557Starcustom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsGeneral1:22%Buy these high-quality Shining Star Inserts at TrophyCentral. Each Shining Star Insert can be used to create a unique plaque, medal or trophy.518671General, Star
custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsGeneral1:22%Buy these quality Mylar Shining Star Decal Inserts at TrophyCentral. Each Shining Star Decal can be used to create a unique plaque, medal or trophy.489875Star
noindexed-items11ShipPinsg Countdown from TrophyCentral. Discounted Trophies, Awards and Promotional Products.1custom-page11TrophyCentral's shipping information page. Here find information about ship times, carriers and more.custom-pageflaglapelpinsplasticpinboxvelapinbox1"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsMilitary1:30%,50:34%,100:39%,500:43%Find this shooting star American Flag lapel pin discounted at TrophyCentral. Pin features a clutch back. Shops in just 1 day!Shooting Star PinStarcustom-pageindexachievement-trophies-awardstrophies-archerytrophies-badmintontrophies-baseballtrophies-basketballtrophies-bicycle-cyclingtrophies-billiardstrophies-bmxtrophies-bocce-balltrophies-bowlingtrophies-boxingtrophies-cheerleading-spirittrophies-coachtrophies-crickettrophies-curlingtrophies-dartstrophies-disc-golftrophies-equestrian-horsetrophies-figure-skatingtrophies-bass-fishingtrophies-marlin-fishingtrophies-footballtrophies-hockey-goalietrophies-golftrophies-gymnasticstrophies-ice-hockeytrophies-karate-martial-artstrophies-lacrossetrophies-marksman-shooting-rifletrophies-motocrossracing-trophies-awardstrophies-racquetballtrophies-roller-hockeyrunning-trophiestrophies-sailing-boattrophies-skateboardingtrophies-cross-country-skiingtrophies-downhill-skiingtrophies-snowboardingtrophies-snowmobiletrophies-soccertrophies-softballtrophies-swimming-divingtrophies-t-balltrophies-tennistorch-trophiestrophies-track-fieldtrophies-trap-skeet-shootingtrophies-volleyballtrophies-weightlifting-powertrophies-wrestlingquickshiptrophies-goatresin-trophiespickleball-trophiestr-resin-trophiestrophies-academictrophies-funny-horses-reartrophies-livestock-farm-animalsgeneral-corporate-awardsreligioustrophiestrophies-volunteerquickshiptrophies-firemanteacher-appreciationtrophies-military-heroart-trophiestrophies-chesscitizenship-awardsdebate-trophiestrophies-mascotquickshiptrophies-graduatetrophies-honor-roll-societytrophies-mathreadingawardsscienceawardsquickshiptrophies-spellingperfect-attendance-awardsschooltrophies14schooltrophies18trophies-cooking-culinarytrophies-dancetrophies-dramatrophies-musicphotography-trophies-and-awardstrophies-beauty-queeninsert-trophies-awardstrophies-generalstar-trophiesplace-trophiestrophies-victoryall-star-trophiesmvp-trophiestrophies-family-reunionhorseshoescounty-fair-awardstrophies-cards-pokertrophies-beer-pongtrophies-camperstrophies-cornholetrophies-go-karttrophies-paintballtrophies-pinewood-derby-scoutstrophies-table-tennis-ping-pongtrophies-car-truckquickshiptrophies-wheel11Browse all award categories A-Z. Complete directory organized by occasion and activity. Find your category quickly and shop with confidence.1 🏆 Looking for more? Explore our full Full Selection of Trophies and Awards by style. ]]>noindexed-items10.31TrophyCentral Offers A Huge Selection At Discounted Prices And Top-Rated Customer Service. Shop With Confidence At TrophyCentral!1custom-pagegavelplaques12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
plaques105503-610.451828.45ClassicPlaquesKey Plaques1:22%This shovel plaque is a perfect gift for ground breaking and building ceremonies. Each shovel plaque includes free engraving!shovel plaqueShovel
show-multis11custom-pagemedallion-inserts-fraternal-organizational-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "Clubs, Organizations, Charities"Buy these quality Shriner Inserts (Litho) at TrophyCentral. Each Shriner Insert can be used to create a unique plaque, medal or trophy.491510
custom-pagebottles-st72"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14142013.6Glass AmericaPromotional ProductsSports / Water Bottles1:14%,576:40%Find These Black Stainless Steel Sidekick Water Bottles Discounted at TrophyCentral. Price Includes Color Imprint!23077Sports / Water Bottlescustom-pagebottles-st72"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14142013.6Glass AmericaPromotional ProductsSports / Water Bottles1:14%,576:40%Stainless Steel Sidekick Bottle - Blue from TrophyCentral.23084Sports / Water Bottlescustom-pagebottles-st72"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14142013.6Glass AmericaPromotional ProductsSports / Water Bottles1:14%,576:40%Stainless Steel Sidekick Bottle - Orange from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.23085Sports / Water Bottlescustom-pagebottles-st72"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14142013.6Glass AmericaPromotional ProductsSports / Water Bottles1:14%,576:40%Stainless Steel Sidekick Bottle - Purple from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.23032Sports / Water Bottlescustom-pagebottles-st72"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14142013.6Glass AmericaPromotional ProductsSports / Water Bottles1:14%,576:40%Stainless Steel Sidekick Bottle - Lime from TrophyCentral.23088Sports / Water Bottlescustom-pagecrystalgifts6"7-10 business days" "Kentucky" "UPS (FedEx available on request)"personalized gifts410187-1010.4569.45JcharlesGiftsCrystal Gifts1:22%,100:22%"personalized gifts"This Optic crystal paperweight represents quality and value. At 3/4 inches thick, this crystal clear gem is a gift of distinction. Pleasingly gift boxed.Crystal Giftscustom-pageindoor-enclosed-bulletin-boards14512310-171 3 5 6 7 8 9 10 22 2301Bulletin Boards11Find the Ghent Silhouette 1 Door Enclosed Chocolate Cork Bulletin Board with Black Frame, 4'H x 2'W discounted at TrophyCentral.1silh20494Enclosed - 1 Door, Indoorcustom-pageindoor-enclosed-bulletin-boards1Bulletin Boards4512310-171 3 5 6 7 8 9 10 22 2301Bulletin Boards11Find the Ghent Silhouette 1 Door Enclosed Chocolate Cork Bulletin Board with Satin Frame, 4'H x 2'W discounted at TrophyCentral.silh20494Enclosed - 1 Door, Indoorcustom-pageindoor-enclosed-bulletin-boards14512310-171 3 5 6 7 8 9 10 22 2301Bulletin Boards11Find the Ghent Silhouette 1 Door Enclosed Vinyl Bulletin Board with Black Frame, 4'H x 2'W, Caramel discounted at TrophyCentral.1silh20476Enclosed - 1 Door, Indoorcustom-pageindoor-enclosed-bulletin-boards14512310-171 3 5 6 7 8 9 10 22 2301Bulletin Boards11Find the Ghent Silhouette 1 Door Enclosed Vinyl Bulletin Board with Black Frame, 4'H x 2'W, Ebony discounted at TrophyCentral.1silh20476Enclosed - 1 Door, Indoorcustom-pageindoor-enclosed-bulletin-boards14512310-171 3 5 6 7 8 9 10 22 2301Bulletin Boards11Find the Ghent Silhouette 1 Door Enclosed Vinyl Bulletin Board with Black Frame, 4'H x 2'W, Ivory discounted at TrophyCentral.1silh20476Enclosed - 1 Door, Indoorcustom-pageindoor-enclosed-bulletin-boards14512310-171 3 5 6 7 8 9 10 22 2301Bulletin Boards11Find the Ghent Silhouette 1 Door Enclosed Vinyl Bulletin Board with Black Frame, 4'H x 2'W, Navy discounted at TrophyCentral.1silh20476Enclosed - 1 Door, Indoorcustom-pageindoor-enclosed-bulletin-boards14512310-171 3 5 6 7 8 9 10 22 2301Bulletin Boards11Find the Ghent Silhouette 1 Door Enclosed Vinyl Bulletin Board with Black Frame, 4'H x 2'W, Ocean discounted at TrophyCentral.1silh20476Enclosed - 1 Door, Indoorcustom-pageindoor-enclosed-bulletin-boards1Bulletin Boards4512310-171 3 5 6 7 8 9 10 22 2301Bulletin Boards11Find the Ghent Silhouette 1 Door Enclosed Vinyl Bulletin Board with Black Frame, 4'H x 2'W, Silver discounted at TrophyCentral.silh20476Enclosed - 1 Door, Indoorcustom-pageindoor-enclosed-bulletin-boards14512310-171 3 5 6 7 8 9 10 22 2301Bulletin Boards11Find the Ghent Silhouette 1 Door Enclosed Vinyl Bulletin Board with Black Frame, 4'H x 2'W, Stone discounted at TrophyCentral.1silh20476Enclosed - 1 Door, Indoorcustom-pageindoor-enclosed-bulletin-boards14512310-171 3 5 6 7 8 9 10 22 2301Bulletin Boards11Find the Ghent Silhouette 1 Door Enclosed Vinyl Bulletin Board with Satin Frame, 4'H x 2'W, Caramel discounted at TrophyCentral.1silh20476Enclosed - 1 Door, Indoorcustom-pageindoor-enclosed-bulletin-boards14512310-171 3 5 6 7 8 9 10 22 2301Bulletin Boards11Find the Ghent Silhouette 1 Door Enclosed Vinyl Bulletin Board with Satin Frame, 4'H x 2'W, Ebony discounted at TrophyCentral.1silh20476Enclosed - 1 Door, Indoorcustom-pageindoor-enclosed-bulletin-boards14512310-171 3 5 6 7 8 9 10 22 2301Bulletin Boards11Find the Ghent Silhouette 1 Door Enclosed Vinyl Bulletin Board with Satin Frame, 4'H x 2'W, Ivory discounted at TrophyCentral.1silh20476Enclosed - 1 Door, Indoorcustom-pageindoor-enclosed-bulletin-boards14512310-171 3 5 6 7 8 9 10 22 2301Bulletin Boards11Find the Ghent Silhouette 1 Door Enclosed Vinyl Bulletin Board with Satin Frame, 4'H x 2'W, Navy discounted at TrophyCentral.1silh20476Enclosed - 1 Door, Indoorcustom-pageindoor-enclosed-bulletin-boards14512310-171 3 5 6 7 8 9 10 22 2301Bulletin Boards11Find the Ghent Silhouette 1 Door Enclosed Vinyl Bulletin Board with Satin Frame, 4'H x 2'W, Ocean discounted at TrophyCentral.1silh20476Enclosed - 1 Door, Indoorcustom-pageindoor-enclosed-bulletin-boards14512310-171 3 5 6 7 8 9 10 22 2301Bulletin Boards11Find the Ghent Silhouette 1 Door Enclosed Vinyl Bulletin Board with Satin Frame, 4'H x 2'W, Silver discounted at TrophyCentral.1silh20476Enclosed - 1 Door, Indoorcustom-pageindoor-enclosed-bulletin-boards14512310-171 3 5 6 7 8 9 10 22 2301Bulletin Boards11Find the Ghent Silhouette 1 Door Enclosed Vinyl Bulletin Board with Satin Frame, 4'H x 2'W, Stone discounted at TrophyCentral.1silh20476Enclosed - 1 Door, Indoorcustom-pageart-trophies1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Art epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Art, Academiccustom-pagetrophies-music1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Band Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Music / Band / Choruscustom-pagetrophies-beer-pong1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Beer Pong Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Beer Pongcustom-pagetrophies-cheerleading-spirit1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Cheer / Spirit Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Cheerleading, Sportscustom-pagetrophies-chess1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Chess Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Chesscustom-pagecornhole-medals1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Cornhole Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Cornholecustom-pagepickleball-trophiestr7220wincooltrop1silplatsteeltr7219tr7218trsaawcu1silvertraynoname271cup-trophies-large-and-small1Elegant Designs & Premium Craftsmanship

Each silver cup in our collection showcases meticulous craftsmanship and superior quality that stands the test of time. Our range includes classic perpetual trophy cup styles, sophisticated championship trays, and distinctive wine cooler designs that suit any recognition ceremony.

Every piece is constructed with durable materials and finished to create a lasting impression that recipients will treasure for years to come. These premium trophy cup designs make ideal awards for golf tournaments, corporate milestones, employee recognition programs, and championship celebrations.

Customization & Engraving Options

Transform your silver cup trophy into a personalized masterpiece with our complimentary engraving services included with every purchase. Our skilled craftsmen can add names, dates, achievement types, and custom messages to create meaningful awards that tell your unique story.

All engraving details are handled with precision, ensuring crisp, professional results that enhance the overall presentation of your recognition piece.

Why Choose Trophy Central?

With decades of experience in creating memorable awards, Trophy Central combines competitive pricing with exceptional quality and outstanding customer service.

We offer free engraving on every cup trophy, fast turnaround times, and expert guidance to help you select the perfect piece for your event. Our commitment to excellence ensures that every trophy cup meets the highest standards and exceeds your expectations.

Order Your Silver Cup Trophy Today

Browse our extensive collection of silver cup trophies and discover the perfect piece to commemorate your special achievement or event. Our user-friendly ordering process makes it easy to customize your selection and complete your purchase with confidence.

Start creating lasting memories with a premium silver cup that truly reflects the significance of the moment being celebrated.

Frequently Asked Questions

Is engraving included with every silver cup trophy purchase?

Yes, engraving is included free of charge with every trophy cup order at no additional price, allowing you to personalize your award without additional costs. This complimentary service allows customers to add names and dates to their awards without extra fees.

However, certain advanced personalization options may incur additional charges. Please check individual product descriptions for specific pricing information.

Can I add my company logo to trophy cups and awards?

Yes, customers can add custom logos to most trophy cup styles. Our engraving team can reproduce your company or organization logo on trophies at an affordable price. Contact us for pricing and logo artwork requirements. These personalized awards create impressive display pieces that showcase your brand.

Do you offer bulk pricing for multiple trophy orders?

Yes, we provide attractive volume discounts and competitive pricing for bulk orders of trophy cups and awards, making it cost-effective to recognize multiple winners or participants. Many customers order multiple trophies at reduced prices for tournaments, corporate recognition programs, and team awards.

What materials are used in your trophy cup collection?

Our trophy cups and awards are crafted from high-quality materials, including silver-plated metal, pewter, and polished aluminum. Each trophy cup is selected for durability and elegant display presentation.

All trophies feature sturdy bases and quality construction designed to maintain their appearance for years. Material specifications are available on individual product pages.

]]>
champion-perpetual-trophies crystalcups
custom-pagetrophies-bicycle-cycling1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Cycling Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Bicycling / Cycling, Sportscustom-pagetrophies-drama1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Drama Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Dramacustom-pagetrophies-music1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Music Lyre Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Music / Band / Choruscustom-pagetrophies-golf1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%2 3/4" Silver Frame Medal: Golf. Ideal for leagues, schools, and tournaments. Fast shipping.Golf, Sportscustom-pagequickshiptrophies-graduate1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Graduation Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Graduation, Academiccustom-pagetrophies-gymnastics1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Gymnastics Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Gymnastics, Sportscustom-pagehorseshoes1498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Horseshoes Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Horseshoescustom-pagetrophies-karate-martial-arts1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Karate Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Karate / Martial Arts, Sportscustom-pagetrophies-math1medals498551-2120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Math Excellence Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Shipping is free over $99.Mathcustom-pageglass-crystal-awards1"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"458221510.45629.25Vision AwardsTrophies1:22%,26:33%The Silver Mountain Award combines metal, stone and glass in this spectacular freestanding award honoring those who have made the long, hard climb to reach their goals.custom-pagetrophies-music1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Music Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Music / Band / Choruscustom-pageflstpi3siandplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsGeneral1:30%,50:34%,100:38%"Star Pins" "Star Lapel Pins" "Star Award Pins"Find silver star pins discounted at TrophyCentral. Each silver star pin features a smooth finish, a clutch back and measures 1 inch. Ships in just 1-2 days.br298sStar, Generalcustom-pageflstpi3siandplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsGeneral1:30%,50:34%,100:38%"Star Pins" "Star Lapel Pins" "Star Award Pins"Find these silver star pins discounted at TrophyCentral. Each silver star pin features a smooth finish, a clutch back and measures 3/4 inch. Ships in just 1-2 days.br464sStar, Generalcustom-pagesilver-cup-trophies1trophies105503-6121626Classic Medallics1:22%custom-pagechampion-perpetual-trophies1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"perpetual trophies105503-610.451 2 3 4 5 6 7 8 9110.85Classic MedallicsTrophies1:30%"Minuteman"Shop for Silver Revere Bowl Perpetual Trophies from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.See more greatcup-trophies-large-and-small09-03-2012Cupcustom-pagehigh-end-awards11"7-10 business days w/engraving" "Kentucky" "UPS (FedEx available on request)"general410187-1010.45417.25JcharlesGeneral Awards1:22%,25:25%"Corporate Awards"Silver Ribbon Jade from TrophyCentral. Also see our great selection of engraved and personalized gifts!custom-pagetrophies-softball1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Softball Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Softball, Sportscustom-pagequickshiptrophies-spelling1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Spelling Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Spellingcustom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsGeneral1:22%Buy these high-quality Silver Star Award Inserts at TrophyCentral. Each Silver Star Award Insert can be used to create a unique plaque, medal or trophy.518593General, Star
custom-pagegold-starsplastic-pinbox-t10star-pinslapel pins498552-30.3102300031TClapel-award-pins11:22%,100:38%,250:42%,500:52%,1000:59%Find These Silver Stars Discounted At TrophyCentral! Each Silver Star Includes A Clutch-Back For Easy Attachment to Clothing. Large Quantity Discounts.Silver Stars | Silver Star Pins|TrophyCentralSilver Stars | TrophyCentralSee our entiresection for other styles and finishes.star-pinsStarcustom-pagestars-wreathplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsGeneral1:30%,50:34%,100:38%"Star Pins" "Star Lapel Pins" "Star Award Pins"Find these silver stars with a wreath design discounted at TrophyCentral! Each silver star and wreath measures 7/8".br476s02-15-2014Star, Generalcustom-page3-4-stars-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsGeneral1:22%,50:25%,100:29%,500:32%"Star Pins" "Star Lapel Pins" "Star Award Pins"Find this Silver Stars - 3/4 Inch Pin at TrophyCentral. Silver Stars - 3/4 Inch and other pins ship in just 1-2 business days!br199sStar, Generalcustom-pagetrophies-swimming-diving1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Swimming Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Swimming / Diving, Sportscustom-pagetrophies-t-ball1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these T-Ball Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.T-Ball, Sportscustom-page1st-place-medals11-2 business days
With engraving:
1-3 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals498552-30.371 3 4 5 6 7 8 930042.37Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,25:24%Find these silver torch medals discounted at Trophy Central. Optional engraving. Fast 1-2 day shipping.Torch, 1st / 2nd / 3rd / Etc.
custom-pagetrophies-track-field1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Track Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.custom-pageweddingfavors1"3-4 business days" "Medina, MN" "UPS (FedEx available on request)"553404-710.453618.45JDSGiftsBridesmaids / Groomsmen1:22%Silver Train Bank from TrophyCentral. Also see our great selection of engraved and personalized gifts!12-20-2020Bridesmaids / Groomsmencustom-pagechampion-perpetual-trophies1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.451 2 3 4 5 6 7 8 9110.85Classic MedallicsTrophies1:30%"Minuteman"Shop for Silver Wine Cooler Perpetual Trophies from TrophyCentral. Fast Shipping on Wine Cooler Trophies.Return to thecategory for additional styles and sizes.champion-perpetual-trophies06-20-2011Cupcustom-pagetrophies-wrestling1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Wrestling Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Wrestling, Sportscustom-pagegrbrgi1"3-4 business days" "Medina, MN" "UPS (FedEx available on request)"personalized gifts553404-710.557236.55JDSGiftsBridesmaids / Groomsmen1:22%Find these fabulous Silver Plated Key Chain discounted at TrophyCentral. TrophyCentral is known for its top-rated customer serviceBridesmaids / Groomsmencustom-pagesilver-cup-trophies11trophies105503-610.61410.6Classic Medallics1:22%Cupcustom-pagesilver-cup-trophies11trophies105503-6121222.8Classic Medallicstrophies1:22%1:20%1:20%Find this steal bowl championship trophy discounted at TrophyCentral. Features silver-plating and includes free engraving!Generalcustom-pageclocks1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"410187-1010.45654.45JcharlesCrystal Awards1:22%,25:25%"crystal awards" "sales awards" "service awards" "corporate sales awards" "corporate service awards" "sales award" "service award" "corporate sales award" "corporate service award" "Desk Clocks"Silvertone Clock from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.custom-pagetrophies-bmx1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with BMX figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-bmx-scbBMXcustom-pagetrophies-curling1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Curling figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-curl-scbCurling, Sportscustom-pagetrophies-marksman-shooting-rifle1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Marksman figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-marksman-scbcustom-pagetrophies-track-field1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Running single column insert trophy features a choice of column color, a marble base and free trophy engraving.custom-pagepickleball-trophies1trophies498552-310.45Trophy CentralTrophies1This popular pickleball award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.Pickleball, Sportscustom-pageart-trophies1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Art single column insert trophy features a choice of column color, a marble base and free trophy engraving.Art, Academiccustom-pageart-trophies1trophies498551-310.71217.38trophies1Art, Academiccustom-pagetrophies-dance1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesMusic, Drama, Art, Dance1:14%,10:18%,50:24%,100:28%"Ballet Trophies" "Ballet Trophy"This popular Ballet Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtballescDancecustom-pagetrophies-baseball1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Single Column Cup Baseball Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.cup-baseb-scbBaseball / T-Ball, Sportscustom-pagetrophies-baseball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%"Baseball Trophies" "Cheap Baseball Trophies" "Buy Baseball Trophies" "Purchase Baseball Trophies" "Discount Baseball Trophies" "Baseball Trophies" "Baseball Trophy"Single Column Trophy - Baseball Glove. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.qtbasebglscBaseball / T-Ball, Golden Glovecustom-pagetrophies-basketball1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Single Column Insert Trophy - Basketball. Ideal for leagues, schools, and tournaments. Fast shipping.Single Column Insert Trophy - BasketballBasketball, Sportscustom-pagetrophies-basketball1cl143 1034 cogi24kgowh sports qushbame1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%Single Column Trophy - Basketball. Ideal for leagues, schools, and tournaments. Fast shipping.qtbaskscIn addition to our single column style, be sure to see all of ourtrophies-basketballBasketball, Sportscustom-pagetrophies-basketball1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Single Column Budget Trophy - Basketball. Ideal for leagues, schools, and tournaments. Fast shipping.mqtbaskscbBasketball, Sportscustom-pagetrophies-bmx1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%Find these popular BMX single column trophies discounted and with free personalization at TrophyCentral.qtbmxscBMXcustom-pagetrophies-bmx1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these BMX budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtbmxscbBMXcustom-pagetrophies-bowling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%"Bowling Trophies" "Trophies, Bowling" "Bowling Trophy"This popular Bowler Figure Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtbowlscSee more:trophies-bowlingBowlingcustom-pagetrophies-bowling1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these bowler budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtbowlscbBowlingcustom-pagetrophies-bowling1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Bowler figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-bowl-scbBowlingcustom-pagetrophies-dance1trophies498852-312421.33TrophiesMusic, Drama, Art, Dance1Find these couples dancing budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtdancescbDancecustom-pagetrophies1trophies498551-310.45TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy column insert trophy comes with a large choice of subject inserts and features a choice of column color, a marble base and free trophy engraving. Fast 1-2 day shipping.custom-pagequickshiptrophies-chevy1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these 57 chevy budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtchevyscbcustom-pagetrophies-archery1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these archery budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtarchscbArchery, Sportscustom-pagetrophies-badminton1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these badminton budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtbadmscbBadminton, Sportscustom-pagetrophies-bocce-ball1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these bocce ball budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtboccescbBoccecustom-pagetrophies-boxing1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these boxing budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtboxscbBoxingcustom-pagetrophies-broomball1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these broomball budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtbroomscbBroomballcustom-pagequickshiptrophies-bull1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these bull figure budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtbullscbcustom-pagequickshiptrophies-camero1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these Camaro budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtcamaroscbcustom-pagequickshiptrophies-cow1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these cow budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtcowscbcustom-pagetrophies-cricket1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these cricket budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtcrickscbCricketcustom-pagetrophies-cross-country-skiing1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these cross country skiing budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtskiccscbSkiing (Cross Country), Sportscustom-pagetrophies-darts1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these darts budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtdartsscbDartscustom-pagetrophies-equestrian-horse1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these equestrian budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtequestscbEquestrian, Sportscustom-pagetrophies-figure-skating1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these figure skating budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtskatescbFigure Skating, Sportscustom-pagetrophies-go-kart1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these go kart budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtcartscbGo Kartcustom-pagetrophies-lacrosse1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these lacrosse budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtlacrossescbLacrosse, Sportscustom-pagetrophies-marksman-shooting-rifle1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these marksman budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtmarksmanscbcustom-pagetrophies-motocross1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these motocross bike budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtmotorscbMotocross, Sportscustom-pagetrophies-racquetball1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these racquetball budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtramqtscbRacquetball, Sportscustom-pagetrophies-roller-hockey1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these roller hockey budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtrollerscbRoller Hockey, Sportscustom-pagequickshiptrophies-sheep1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these sheep budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtsheepscbcustom-pagetrophies-skateboarding1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these skateboarding budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtskateboardscbSkateboardingcustom-pagetrophies-snowboarding1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these snowboarder budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtsnowboardscbSnowboarding, Sportscustom-pagequickshiptrophies-steer1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these steer figure budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtsteerscbcustom-pagequickshiptrophies-street1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these street rod budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtstreetrodscbcustom-pagetrophies-cheerleading-spirit1cl50 cl107 1035"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%"Cheerleader Trophies" "Cheerleading Trophies" "Cheerleader Trophy" "Cheerleading Trophy" "Trophies, Cheerleader" "Trophies, Cheerleading"Find these popular Cheerleading Elite Series trophies discounted and with free personalization at TrophyCentral.qtcheerscIn addition to these classic trophies, be sure to see all of ourtrophies-cheerleading-spiritCheerleading, Sportscustom-pagetrophies-cheerleading-spirit1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Cheerleading single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - CheerCheerleading, Sportscustom-pagetrophies-cheerleading-spirit1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these cheerleading budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtcheerscbCheerleading, Sportscustom-pagetrophies-chess1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Chess single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - ChessChesscustom-pagecitizenship-awards1498551-210.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Citizenship single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - CitizenshipCitizenshipcustom-pagecitizenship-awards1498551-210.71217.38trophies1Citizenshipcustom-pagetrophies-cornhole1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Cornhole single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - CornholeCornholecustom-pagetrophies-cornhole1trophies498552-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1This popular cornhole award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.Single Column Trophy - CornholeCornholecustom-pagetrophies-cornhole1trophies498552-310.52421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find these cornhole budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Single Column Budget Trophy - CornholeCornholecustom-pagetrophies-cornhole1trophies498551-310.71217.38trophies1Cornholecustom-pagetrophies-dance1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.452421.33Quick TrophyTrophiesMusic, Drama, Art, Dance1:14%,10:18%,50:24%,100:28%"Dance Trophy" "Trophies, Dance" "Dancing Trophies" "Trophies, Dancing"This popular Couples Dancing Trophy from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtdancescNot exactly what you want? See other popularin a variety of sizes and styles.trophies-danceDancecustom-pagetrophies-music1trophies498551-310.71217.38trophies1Music / Band / Choruscustom-pagetrophies-baseball1trophies498551-310.71217.38trophies1Baseball / T-Ball, Sportscustom-pagetrophies-dance1trophies498551-310.71217.38trophies1Dancecustom-pagetrophies-gymnastics1trophies498551-310.71217.38trophies1Gymnastics, Sportscustom-pagetrophies-marksman-shooting-rifle1trophies498551-310.71217.38trophies1custom-pagetrophies-music1trophies498551-310.71217.38trophies1Music / Band / Choruscustom-pagetrophies-swimming-diving1trophies498551-310.71217.38trophies1Swimming / Diving, Sportscustom-pagetrophies-drama1trophies498551-310.71217.38trophies1Dramacustom-pageplace-trophies1trophies498551-310.71217.38trophies11st / 2nd / 3rd / Etc., Sportscustom-pageall-star-trophies1trophies498551-310.71217.38trophies1All Starcustom-pagetrophies-cooking-culinary1trophies498551-310.71217.38trophies1Cooking / Culinarycustom-pagetrophies-basketball1trophies498551-310.71217.38trophies1Basketball, Sportscustom-pagetrophies-chess1trophies498551-310.71217.38trophies1Chesscustom-pagetrophies-coach1trophies498551-310.71217.38trophies1Coach, Sportscustom-pagetrophies-cooking-culinary1trophies498551-310.71217.38trophies1Cooking / Culinarycustom-pagereligioustrophies1trophies498551-310.71217.38trophies1Religiouscustom-pagedebate-trophies1trophies498551-310.71217.38trophies1Debatecustom-pagequickshiptrophies-fireman1trophies498551-310.71217.38trophies1Firefightercustom-pagetrophies-bass-fishing1trophies498551-310.71217.38trophies1Fishing, Sportscustom-pagetrophies-football1trophies498551-310.71217.38trophies1Football, Sportscustom-pagetrophies-golf1trophies498551-310.71217.38trophies1Golf, Sportscustom-pagetrophies-general1trophies498551-310.71217.38trophies1custom-pagetrophies-honor-roll-society1trophies498551-310.71217.38trophies1Honor Roll, Academiccustom-pagetrophies-honor-roll-society1trophies498551-310.71217.38trophies1Honor Society, Academiccustom-pagetrophies-karate-martial-arts1trophies498551-310.71217.38trophies1Karate / Martial Arts, Sportscustom-pagemvp-trophies1trophies498551-310.71217.38trophies1MVP, Sportscustom-pagephotography-trophies-and-awards1trophies498551-310.71217.38trophies1Photographycustom-pagetrophies-marksman-shooting-rifle1trophies498551-310.71217.38trophies1custom-pageracing-trophies-awards1trophies498551-310.71217.38trophies1Racing, Sportscustom-pagereadingawards1498551-310.71217.38trophies1Readingcustom-pagetrophies-drama1trophies498551-310.71217.38trophies1Starcustom-pagetrophies-soccer1trophies498551-310.71217.38trophies1Soccer, Sportscustom-pagetrophies-drama1trophies498551-310.71217.38trophies1Starcustom-pagetrophies-tennis1trophies498551-310.71217.38trophies1Tennis, Sportscustom-pagetrophies-weightlifting-power1trophies498551-210.71217.38trophies1Weightlifting, Sportscustom-pagetrophies-baseball1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Single Column Cup Trophy - Baseball Glove. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.cup-basebgl-scbBaseball / T-Ball, Golden Glovecustom-pagetrophies-dance1trophies498552-311218.84TrophiesMusic, Drama, Art, Dance1Find this unique cup trophy with Dance figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-dancer-scbDancecustom-pagequickshiptrophies-chevy1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with 57 Chevy figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-chevy-scbcustom-pagetrophies-academic1trophies498552-311218.84TrophiesAcademic1Find this unique cup trophy with Academic Lamp figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-acad-scbAcademiccustom-pagetrophies-archery1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Archery figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-arch-scbArchery, Sportscustom-pagetrophies-badminton1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Badminton figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-badm-scbBadminton, Sportscustom-pagetrophies-dance1trophies498552-311218.84TrophiesMusic, Drama, Art, Dance1Find this unique cup trophy with Ballet figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-balle-scbDancecustom-pagetrophies-basketball1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Single Column Cup Trophy - Basketball. Ideal for leagues, schools, and tournaments. Fast shipping.cup-bask-scbBasketball, Sportscustom-pagetrophies-bass-fishing1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Bass figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-bass-scbFishing, Sportscustom-pagetrophies-beauty-queen1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Beauty Queen figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-beaut-scbBeauty Queencustom-pagetrophies-billiards1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Billiards figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-billi-scbBilliardscustom-pagetrophies-bocce-ball1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Bocce Ball figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-bocce-scbBoccecustom-pagetrophies-boxing1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Boxing figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-box-scbBoxingcustom-pagequickshiptrophies-bull1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Bull Figure figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-bull-scbcustom-pagequickshiptrophies-camero1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Camaro figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-camaro-scbcustom-pagequickshiptrophies-stock-car1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Car Show / Stock Car figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-scar-scbcustom-pagequickshiptrophies-wheel1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Car Show, Winged Wheel figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-wingedwheel-scb03-15-2022custom-pagetrophies-cards-poker1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Cards figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-cards-scbcustom-pagequickshiptrophies-chicken1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Chicken Figure figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-chicken-scbcustom-pagetrophies-dance1trophies498852-311218.84TrophiesMusic, Drama, Art, Dance1Find this unique cup trophy with Couples Dancing figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-dance-scbDancecustom-pagequickshiptrophies-cow1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Cow figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-cow-scbcustom-pagetrophies-cricket1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Cricket figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-crick-scbCricketcustom-pagetrophies-cross-country-skiing1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Cross Country Skiing figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-skicc-scbSkiing (Cross Country), Sportscustom-pagetrophies-darts1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Darts figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-darts-scbDartscustom-pagetrophies-disc-golf1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Single Column Cup Trophy - Disc Golf. Ideal for leagues, schools, and tournaments. Fast shipping.cup-disc-scbDisc Golfcustom-pagetrophies-downhill-skiing1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Downhill Skiing figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-skidown-scbSkiing (Downhill), Sportscustom-pagetrophies-equestrian-horse1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Equestrian figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-equest-scbEquestrian, Sportscustom-pagetrophies-figure-skating1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Figure Skating figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-skate-scbFigure Skating, Sportscustom-pagequickshiptrophies-fireman1trophies498552-311218.84TrophiesHero1Find this unique cup trophy with Fireman figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-fireman-scbFirefighter, Herocustom-pagetrophies-football1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Single Column Cup Trophy - Football. Ideal for leagues, schools, and tournaments. Fast shipping.cup-foot-scbFootball, Sportscustom-pagetrophies-funny-horses-rear1trophies498552-311218.84TrophiesGeneral1Find this unique cup trophy with Gag Horses-Rear figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-horse-scbFunny / Gagcustom-pagetrophies-go-kart1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Go Kart figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-cart-scbGo Kartcustom-pagequickshiptrophies-goat1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Goat Figure figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-goat-scbcustom-pagetrophies-golf1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Single Column Cup Trophy - Golf. Ideal for leagues, schools, and tournaments. Fast shipping.cup-golf-scbGolf, Sportscustom-pagetrophies-golf1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Hole-in-One figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-hole-scb1-10-2022Golf, Sports, Hole-In-Onecustom-pagetrophies-karate-martial-arts1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Karate figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-karate-scbKarate / Martial Arts, Sportscustom-pagetrophies-lacrosse1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Lacrosse figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-lacrosse-scbLacrosse, Sportscustom-pagetrophies-marlin-fishing1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Marlin Fish figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-marlin-scbFishing, Sportscustom-pagetrophies-motocross1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Motocross Bike figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-motor-scbMotocross, Sportscustom-pagequickshiptrophies-pig1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Pig figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-pig-scbcustom-pagequickshiptrophies-rabbit1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Bunny Rabbit figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-rabbit-scbcustom-pagetrophies-racquetball1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Racquetball figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-racup--scbRacquetball, Sportscustom-pagereligioustrophies1trophies498552-311218.84TrophiesReligious1Find this unique cup trophy with Religious Cross figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-cross-scbReligiouscustom-pagetrophies-roller-hockey1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Roller Hockey figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-roller-scbRoller Hockey, Sportscustom-pagetrophies-sailing-boat1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Sailboat figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-sailboat-scbBoating / Sailing, Sportscustom-pagequickshiptrophies-sheep1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Sheep figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-sheep-scbcustom-pagetrophies-skateboarding1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Skateboarding figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-skateboard-scbSkateboardingcustom-pagetrophies-snowboarding1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Snowboarder figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-snowboard-scbSnowboarding, Sportscustom-pagetrophies-snowmobile1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Snowmobile Figure figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-snow-scbSnowmobilecustom-pagequickshiptrophies-steer1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Steer Figure figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-steer-scbcustom-pagequickshiptrophies-street1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Street Rod figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-streetrod-scbcustom-pagetrophies-table-tennis-ping-pong1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Table Tennis / Ping Pong figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-ttennis-scbTable Tennis / Ping Pong, Sportscustom-pagetrophies-tennis1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Tennis figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-tennis-scbTennis, Sportscustom-pagequickshiptrophies-tractor1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Tractor figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-tractor-scbcustom-pagetrophies-trap-skeet-shooting1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Trap Skeet Shooting figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-shoot-scbcustom-pagetrophies-victory1trophies498552-311218.84TrophiesGeneral1Find this unique cup trophy with Victory figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-vict-scbGeneralcustom-pagequickshiptrophies-pickup1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Car Show, Vintage Pick-up Truck figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-vintagepickup-scbcustom-pagetrophies-weightlifting-power1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Weightlifting figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-lift-scbWeightlifting, Sportscustom-pagetrophies-curling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%This popular Curling Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtcurlscCurling, Sportscustom-pagetrophies-curling1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these curling budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtcurlscbCurling, Sportscustom-pagetrophies-chess1trophies498552-312421.33TrophiesSchool1This popular chess award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.mqt-chess-p-scChesscustom-pagetrophies-bicycle-cycling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:32%Find these popular Bicycle single column trophies discounted and with free personalization at TrophyCentral.qtbikesc01-25-2012Bicycling / Cycling, Sportscustom-pagetrophies-bicycle-cycling1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Bicycle figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-bike-scbBicycling / Cycling, Sportscustom-pagetrophies-bicycle-cycling1trophies498551-310.71217.38trophies1Bicycling / Cycling, Sportscustom-pagetrophies-bicycle-cycling1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these bicycle budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtbikescbBicycling / Cycling, Sportscustom-pagetrophies-dance1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Dance single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - CheerDancecustom-pagetrophies-dance1trophies498552-312421.33TrophiesMusic, Drama, Art, Dance1This popular Dance Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.mqt-dancer-scDancecustom-pagetrophies-dance1trophies498552-312421.33TrophiesMusic, Drama, Art, Dance1Find these dance / jazz budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqt-dancer-scbDancecustom-pagetrophies-drama1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Drama single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - CheerDramacustom-pagetrophies-drama1trophies498552-312421.33TrophiesSchool1This popular drama award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.mqt-drama-p-scDramacustom-pagetrophies-bocce-ball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%Find these popular Bocce Ball Single Column Elite Series Trophies discounted and with free personalization at TrophyCentral.qtboccescBoccecustom-pagetrophies-broomball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)""PT1=Trophies" "PC12=498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:28%Find these popular Broomball Single Column Elite Series trophies discounted and with free personalization at TrophyCentral.qtbroomsc12-20-2040Broomballcustom-pagetrophies-disc-golf1"1-4 (typically 1-2) business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:28%Single Column Elite Series Trophy - Disc Golf. Ideal for leagues, schools, and tournaments. Fast shipping.qtdiscscDisc Golfcustom-pagetrophies-figure-skating1"1-4 (typically 1-2) business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%Find these popular Figure Skating Single Column Elite Series trophies discounted and with free personalization at TrophyCentral.qtskatescFigure Skating, Sportscustom-pagetrophies-go-kart1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:22%Find these popular Go Kart Single Column Elite Series trophies discounted and with free personalization at TrophyCentral.qtcartscGo Kartcustom-pagequickshiptrophies-graduate1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.452421.33Quick TrophyTrophiesAcademic1:14%,10:18%,50:24%,100:28%"Graduation Gifts" "Graduation Gift"Find these popular Graduate Elite Series trophies discounted and with free personalization at TrophyCentral.qtgradscGraduation, Academiccustom-pagequickshiptrophies-marlin1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%Find these popular Marlin Fish Single Column Elite Series trophies discounted and with free personalization at TrophyCentral.qtmarlinscFishing, Sportscustom-pagetrophies-sailing-boat1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%Find these popular Sailboat Single Column Elite Series Trophies discounted and with free personalization at TrophyCentral.qtsailboatscBoating / Sailing, Sportscustom-pagetrophies-skateboarding1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%Find these popular Skateboarding Single Column Elite Series trophies discounted and with free personalization at TrophyCentral.qtskateboardscSkateboardingcustom-pagetrophies-snowboarding1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:26%Find these popular Snowboarding Single Column Elite Series Trophies discounted and with free personalization at TrophyCentral.qtsnowboardscSnowboarding, Sportscustom-pagetrophies-football1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%Single Column Trophy - Football. Ideal for leagues, schools, and tournaments. Fast shipping.qtfootscSee more fabulousin other great styles.trophies-footballFootball, Sportscustom-pagetrophies-hockey-goalie1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%This popular Goalie Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtgoalscHockey, Sportscustom-pagetrophies-hockey-goalie1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these goalie budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtgoalscbHockey, Sportscustom-pagetrophies-hockey-goalie1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Goalie figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-goal-scbHockey, Sportscustom-pagetrophies-golf1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Single Column Budget Trophy - Golf. Ideal for leagues, schools, and tournaments. Fast shipping.mqtgolfscbGolf, Sportscustom-pagequickshiptrophies-graduate1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Graduation single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - GraduationGraduation, Academiccustom-pagequickshiptrophies-graduate1trophies498552-312421.33TrophiesAcademic1Find these graduate budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtgradscbGraduation, Academiccustom-pagequickshiptrophies-graduate1trophies498552-311218.84TrophiesAcademic1Find this unique cup trophy with Graduate figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-grad-scbGraduation, Academiccustom-pagetrophies-gymnastics1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Gymnastics single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - GymnasticsGymnastics, Sportscustom-pagetrophies-gymnastics1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Gymnastics figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-gym-scbGymnastics, Sportscustom-pagetrophies-gymnastics1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%"Gymnastics Awards" "Gymnastics Trophies" "Gymnast Trophies" "Gymnastics Trophy" "Gymnast Trophy"This popular Gymnastics Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtgymscGymnastics, Sportscustom-pagetrophies-gymnastics1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these gymnastics budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtgymscbGymnastics, Sportscustom-pagetrophies-ice-hockey1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Hockey figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-hock-scbHockey, Sportscustom-pagetrophies-ice-hockey1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%"Hockey Awards" "Hockey Trophies" "Ice Hockey Trophies" "Hockey Trophy" "Ice Hockey Trophy"This popular Hockey Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qthockscHockey, Sportscustom-pagetrophies-ice-hockey1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these hockey budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqthockscbHockey, Sportscustom-pagehorseshoes1498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Horseshoes single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - HorseshoesHorseshoescustom-pagehorseshoes1498551-310.71217.38trophies1Horseshoescustom-pagetrophies-marksman-shooting-rifle1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Shooting single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - Shootingcustom-pagetrophies-music1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Band single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - BandMusic / Band / Choruscustom-pagetrophies-beer-pong1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Beer Pong single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - Beer PongBeer Pongcustom-pagetrophies-karate-martial-arts1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these karate budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtkaratescbKarate / Martial Arts, Sportscustom-pagetrophies-karate-martial-arts1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Karate single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - KarateKarate / Martial Arts, Sportscustom-pagetrophies-marksman-shooting-rifle1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%This popular Marksman Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtmarksmansccustom-pagetrophies-math1trophies498551-210.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Math single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - MathMathcustom-pagetrophies-math1trophies498551-210.71217.38trophies1Mathcustom-pagetrophies-music1trophies498552-311218.84TrophiesMusic, Drama, Art, Dance1Find this unique cup trophy with Music figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-music-scbMusic / Band / Choruscustom-pagetrophies-music1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Music single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - MusicMusic / Band / Choruscustom-pagetrophies-music1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Music Lyre single column insert trophy features a choice of column color, a marble base and free trophy engraving.Music / Band / Choruscustom-pagetrophies-music1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesMusic, Drama, Art, Dance1:14%,10:18%,50:24%,100:28%"Music Trophies" "Music Trophy" "Band Awards"This popular Music Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtmusicscMusic / Band / Choruscustom-pagetrophies-music1trophies498552-312421.33TrophiesMusic, Drama, Art, Dance1Find these music budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtmusicscbMusic / Band / Choruscustom-pagetrophies-paintball1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Paintball figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-paint-scbPaintballcustom-pagetrophies-paintball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%This popular Paintball Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtpaintscPaintballcustom-pagepickleball-trophies1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Pickleball single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - PickleballPickleball, Sportscustom-pagepickleball-trophies1trophies498552-31Trophy CentralTrophies1Find these pickleball budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Pickleball, Sportscustom-pagepickleball-trophies1trophies498551-310.71217.38trophies1Pickleball, Sportscustom-pagetrophies-pinewood-derby-scouts1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.452421.33Quick TrophyTrophiesAcademic1:14%,10:18%,50:24%,100:28%This popular Pinewood Derby Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtpinescPinewood Derbycustom-pagetrophies-pinewood-derby-scouts1trophies498552-312421.33TrophiesAcademic1Find these pinewood derby budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtpinescbPinewood Derbycustom-pagetrophies-pinewood-derby-scouts1trophies498552-311218.84TrophiesAcademic1Find this unique cup trophy with Pinewood Derby figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-pine-scbPinewood Derbycustom-pagescienceawards1498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Science single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - ScienceSciencecustom-pagescienceawards1498551-310.71217.38trophies1Sciencecustom-pagetrophies-soccer1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Single Column Soccer Cup Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.cup-soccer-scbSoccer, Sportscustom-pagetrophies-soccer1soccer-participation-trophies double-platform-trophies-soccer year-indicator-trophies-soccer soccer-trip-trophiestrophies498552-310.452421.33Trophy CentralTrophiesSports, Hobby, Org, Livestock1"Soccer Trophies" "Cheap Soccer Trophies" "Buy Soccer Trophies" "Purchase Soccer Trophies" "Discount Soccer Trophies"Single Column Soccer Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagetrophies-softball1trophies498552-310.45TrophiesSports, Hobby, Org, Livestock1This popular Softball Glove Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.Softball, Golden Glovecustom-pagetrophies-softball1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Softball Glove figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-softbgl-scbSoftball, Golden Glovecustom-pagetrophies-softball1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Softball single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - SoftballSoftball, Sportscustom-pagetrophies-softball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%"Softball Trophies" "Softball Trophy" "Trophies, Softball"This popular Softball Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtsoftscReturn to oursection for more great choices.trophies-softballSoftball, Sportscustom-pagetrophies-softball1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these softball budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtsoftscbSoftball, Sportscustom-pagetrophies-softball1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Softball figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-soft-scbSoftball, Sportscustom-pagetrophies-softball1trophies498551-310.71217.38trophies1Softball, Sportscustom-pagequickshiptrophies-spelling1trophies498552-311218.84TrophiesAcademic1Find this unique cup trophy with Spelling Bee figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-spell-scbSpellingcustom-pagequickshiptrophies-spelling1trophies498551-310.71217.38trophies1Spellingcustom-pagetrophies-swimming-diving1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Swimming single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - SwimmingSwimming / Diving, Sportscustom-pagetrophies-swimming-diving1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451224.45Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%Find these popular Swimmer Elite Series trophies discounted and with free personalization at TrophyCentral.qtswimscReturn to thesection for more great choices.trophies-swimming-divingSwimming / Diving, Sportscustom-pagetrophies-swimming-diving1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Swimmer figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-swim-scbSwimming / Diving, Sportscustom-pagetrophies-t-ball1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our T-Ball single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - T-BallT-Ball, Sportscustom-pagetrophies-t-ball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:32%This popular T-Ball Figure Elite Series Trophy features a choice of column size and color, a marble base and free trophy engraving!qttballscSee more fabulousin a huge variety of sizes and styles.trophies-t-ballBaseball / T-Ball, Sportscustom-pagetrophies-t-ball1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find this budget t-ball trophy with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqttballscbBaseball / T-Ball, Sportscustom-pagetrophies-t-ball1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with T-Ball figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-tball-scbBaseball / T-Ball, Sportscustom-pagetrophies-t-ball1trophies498551-310.71217.38trophies1Baseball / T-Ball, Sportscustom-pagetrophies-track-field1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1mqttrackscbcustom-pagetrophies-track-field1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Track single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - Trackcustom-pagetrophies1trophies498551-310.45TrophyCentralTrophies1:14%,10:18%,50:24%,100:28%This popular single column trophy from TrophyCentral features a choice of column color, column size, a marble base and free trophy engraving. Fast 1-2 day shipping.custom-pagequickshiptrophies-chevy1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:21%,100:24%This popular 57 Chevy Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtchevysccustom-pagetrophies-academic1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesAcademic1:14%,10:18%,50:24%,100:28%Find these popular Academic Lamp single column trophies discounted and with free personalization at TrophyCentral.qtacadscSee more:trophies-schoolAcademiccustom-pagetrophies-archery1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:19%,50:26%,100:31%Find these popular Archery single column trophies discounted and with free personalization at TrophyCentral.qtarchscArchery, Sportscustom-pagetrophies-badminton1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%This popular Badminton Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtbadmscBadminton, Sportscustom-pagetrophies-baseball1trophies498552-310.451011.45Trophy CentralTrophiesSports, Hobby, Org, Livestock1"Most Popular Items" "Baseball Trophies" "Cheap Baseball Trophies" "Buy Baseball Trophies" "Purchase Baseball Trophies"Single Column Baseball Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Baseball / T-Ball, Sportscustom-pagequickshiptrophies-bass1"1-4 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%This popular Bass Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtbassscFishing, Sportscustom-pagetrophies-beauty-queen1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:28%This popular Beauty Queen Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtbeautscBeauty Queencustom-pagetrophies-billiards1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%This popular Billiards Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtbilliscBilliardscustom-pagetrophies-boxing1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%This popular Boxing Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtboxscBoxingcustom-pagetrophies1trophies498551-310.5TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our single column budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.custom-pagequickshiptrophies-bull1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:21%,100:24%These popular Bull Figure Elite Series Trophies feature a choice of column size and color, a white marble base and free trophy personalization!custom-pagequickshiptrophies-rabbit1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:21%,100:24%These popular Bunny Rabbit Figure Elite Series Trophies feature a choice of column size and color, a white marble base and free trophy personalization!qtrabbitsccustom-pagequickshiptrophies-camero1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:21%,100:24%This popular Camaro Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtcamarosccustom-pagequickshiptrophies-stock-car1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:22%This popular Car Show / Stock Car Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtscarsccustom-pagequickshiptrophies-pickup1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:21%,100:24%This popular Car Show, Vintage Pick-up Truck Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtvintagepickupsccustom-pagequickshiptrophies-wheel1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:21%,100:24%This popular Car Show, Winged Wheel Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtwingedwheelsc03-15-2022custom-pagetrophies-cards-poker1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%This popular Cards Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtcardssccustom-pagequickshiptrophies-chicken1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:21%,100:24%These popular Chicken Figure Elite Series Trophies feature a choice of column size and color, a white marble base and free trophy personalization!custom-pagetrophies-coach1trophies498552-312421.33TrophiesSchool1This popular coach / judge / referee award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.mqt-whistle-p-scCoach, Whistle, Sportscustom-pagetrophies-funny-horses-rear1trophies498553-Feb10.45Trophy CentralTrophies1This popular comic turkey award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.Funny / Gagcustom-pagequickshiptrophies-cow1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:21%,100:24%This popular Cow Figure Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtcowsccustom-pagetrophies-cricket1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%Find these popular Cricket single column trophies discounted and with free personalization at TrophyCentral.qtcrickscCricketcustom-pagetrophies-cross-country-skiing1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:28%"Skiing Trophies" "Skiing Trophy" "Skier Trophies" "Ski Trophies"This popular Cross Country Skiing Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtskiccscSkiing (Cross Country), Sportscustom-pagequickshiptrophies-cup1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophies1:14%,10:18%,50:24%,100:28%This popular Cup Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtcupscIn addition to our plastic cups, we have a great selection metalcup-trophies-large-and-smallGeneral, Academiccustom-pagetrophies-darts1"1-4 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%This popular Darts Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtdartsscDartscustom-pagetrophies-downhill-skiing1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:28%"Skiing Trophies" "Skiing Trophy" "Skier Trophies" "Ski Trophies"This popular Downhill Skiing Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtskidownscSkiing (Downhill), Sportscustom-pagetrophies-equestrian-horse1"1-4 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:26%This popular Equestrian Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtequestscEquestrian, Sportscustom-pagequickshiptrophies-fireman1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesHero1:14%,10:18%,50:24%,100:28%This popular Fireman Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtfiremanscFirefighter, Herocustom-pagetrophies-funny-horses-rear1"1-4 (typically 1-2) business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.452421.33Quick TrophyTrophiesGeneral1:14%,100:28%"Gag Trophies" "Gag Trophy" "Joke Trophies" "Joke Trophy" "Funny Trophies" "Funny Trophy"This popular Gag Horses-Rear Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qthorsescFunny / Gagcustom-pagequickshiptrophies-goat1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:21%,100:24%These popular Goat Figure Elite Series Trophies feature a choice of column size and color, a white marble base and free trophy personalization!custom-pagetrophies-golf1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%Single Column Trophy - Golf. Ideal for leagues, schools, and tournaments. Fast shipping.qtgolfscSee our other populartrophies-golfGolf, Sportscustom-pagetrophies-golf1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%"Hole-in-One Awards"This popular Hole-in-One Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtholesc1-10-2022Golf, Sports, Hole-In-Onecustom-pagetrophies-karate-martial-arts1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%This popular Karate Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtkaratescKarate / Martial Arts, Sportscustom-pagetrophies-lacrosse1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:28%This popular Lacrosse Figure Single Column Trophy features a choice of column size and color, a marble base and free trophy engraving!qtlacrossescReturn to thesection for other great choices.trophies-lacrosseLacrosse, Sportscustom-pagegeneral-corporate-awards1498552-312421.33TrophiesCorporate1This popular corporate leadership award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.mqt-leadership-p-scCoach, Leadership, Sportscustom-pagetrophies-motocross1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%Find these popular Motocross Bike Elite Series trophies discounted and with free personalization at TrophyCentral.qtmotorscMotocross, Sportscustom-pagequickshiptrophies-pig1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:21%,100:24%This popular Pig Figure Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtpigsccustom-pagetrophies-racquetball1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:19%,50:28%,100:35%This popular Racquetball Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtraqtscRacquetball, Sportscustom-pagereligioustrophies1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesReligious1:14%,10:18%,50:24%,100:28%"Religious Awards"This popular Religious Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtcrossscReligiouscustom-pagetrophies-roller-hockey1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%This popular Roller Hockey Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtrollerscRoller Hockey, Sportscustom-pagequickshiptrophies-sheep1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:21%,100:24%This popular Sheep Figure Single Column Trophy features a choice of column size and color, a marble base and free trophy engraving!qtsheepsccustom-pagetrophies-snowmobile1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:22%These popular Snowmobile Figure Elite Series Trophies feature a choice of column size and color, a white marble base and free trophy personalization!Snowmobilecustom-pagetrophies-drama1trophies498552-312421.33TrophiesMusic, Drama, Art, Dance1This popular Star Performer Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.mqt-star-p-scDrama, Dance, Schoolcustom-pagequickshiptrophies-steer1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:21%,100:24%These popular Steer Figure Elite Series Trophies feature a choice of column size and color, a white marble base and free trophy personalization!custom-pagequickshiptrophies-street1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:21%,100:24%This popular Street Rod Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtstreetrodsccustom-pagetrophies-table-tennis-ping-pong1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:24%This popular Table Tennis / Ping Pong Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtttennisscTable Tennis / Ping Pong, Sportscustom-pagetrophies-tennis1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%"Tennis Trophies" "Tennis Trophy" "Trophies, Tennis"This popular w/Tennis Figure Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qttennisscSee our complete selection of popularin large variety of styles and sizes.trophies-tennisTennis, Sportscustom-pagetrophies-funny-horses-rear1trophies498552-310.45Trophy CentralTrophies1This popular toilet bowl award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.Toilet Bowlcustom-pagetrophies-track-field1trackmedals1 1041 eventribbons 9x12cherryp sports"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%qttracksccustom-pagequickshiptrophies-tractor1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:21%,100:24%This popular Tractor Figure Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qttractorsccustom-pagetrophies-trap-skeet-shooting1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%This popular Trap Skeet Shooting Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtshootsccustom-pagetrophies-victory11"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452413.89Quick TrophyTrophiesGeneral1:14%,10:19%,50:28%,100:35%This popular column trophy with a victory figure features a choice of column color, a marble base, free trophy engraving and quick shipping. Perfect for any general recognition.vitrsicoGeneralcustom-pagetrophies-weightlifting-power1"1-4 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:22%This popular Weightlifting Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtliftscWeightlifting, Sports1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)""PT1=Trophies" "PC12=498551-210.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:19%,50:28%,100:35%This popular Single Column Trophy features a choice of column color, a marble base and free trophy engraving. Ships in Just 1-2 Business Days!1single-trophiescustom-pagetrophies-volleyball1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Volleyball figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-volly-scbVolleyball, Sportscustom-pagetrophies-volleyball1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Volleyball single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - VolleyballVolleyball, Sportscustom-pagetrophies-volleyball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:19%,50:28%,100:35%This popular Volleyball Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtvollyscVolleyball, Sportscustom-pagetrophies-volleyball1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these volleyball budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtvollyscbVolleyball, Sportscustom-pagetrophies-volleyball1trophies498551-310.71217.38trophies1Volleyball, Sportscustom-pagetrophies-wrestling1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Wrestling figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-wrest-scbWrestling, Sportscustom-pagetrophies-wrestling1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Wrestling single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - WrestlingWrestling, Sportscustom-pagetrophies-wrestling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:19%,50:28%,100:35%"Wrestling Trophies" "Trophies, Wrestling" "Wrestling Trophy"This popular Wrestling Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtwrestscSee more individual and teamin a variety of styles.trophies-wrestlingWrestling, Sportscustom-pagetrophies-wrestling1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these wrestling budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtwrestscbWrestling, Sportscustom-pagetrophies-wrestling1trophies498551-310.71217.38trophies1Wrestling, Sportscustom-pagetrophies-track-field1trophies498551-310.71217.38trophies1custom-pagetrophies-track-field1trophies498551-310.71217.38trophies1custom-pagetrophies-cheerleading-spirit1trophies498551-310.71217.38trophies1Cheerleading, Sportscustom-pagetrophies-track-field1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1cup-track-scbcustom-pagetrophies-cheerleading-spirit1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Cheerleading figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-cheer-scbCheerleading, Sportscustom-pagehockeypuckdisplays1"7-10 business days w/Logo, 4-6 without" "Apopka, FL 32712" "UPS (FedEx available on request)"327765-101 3 22 2311619Perfect CaseDisplay Cases1:14%,10:21%Single Hockey Puck Glass Display Cases from TrophyCentral.hockeydisplay-sHockey, Sportscustom-pagefirst-place-ribbons10"1-2 business days" "Topeka, Indiana" "UPS (Post Office Priority Mail may also be available)"ribbons465711-21 260.363636.36Tower RibbonRibbons1:22%,100:26%Shop for single streamer rosette award ribbons, both stock and custom, in a variety of colors at TrophyCentral. Fast Shipping on all awards and rosettes.rosette ribbons, award ribbons, rosettes, rosette award ribbons, ribbons and rosettes, rosette ribbon, ribbons and medals, awardsBlue Ribbon, Red Ribbon, Exhibitor, 1st / 2nd / 3rd / Etc., 4th Place, 5th Place, 6th Place, 7th Place, 8th Place, 9th Place, 10th Place, Honorable Mention, Participant, Achievement, Assistant, Chairman, Board Member, Best of Show, Chairperson, Co-Chairman, Co-Chairperson, Committee, Contestant, Director, Excellent, Exhibitor, Facilitator, Finalist, Grand Price, Good, Grand Champion, Hostess, Hospitality, Guest, Speaker, Host, Judge, Participation, Past President, Perfect Attendance, Official, Presenter, President, Press, Reserve Champion, Secretary, Treasurer, Staff, Steward, Sponsor, Usher, Vice President, Visitor, Volunteer, Winner, Merit12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
498555-8.52This is the site map for the TrophyCentral.com website. Use the Site Map as a Table of Contents for TrophyCentral's Key Sections.
custom-pagebaseballdisplay11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 23119Perfect CaseDisplay Cases11:14%,5:18%Six Baseball Glass Display Case. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.basedisplay-6Baseball / T-Ball, Sportscustom-pageshop-by-categoryqtskateboardncqtskateboardscqtskateboarddmqtskateboardplqtskateboardyrqtskateboardttqtskateboardttwqtskateboard3cmqtskateboardscbcup-skateboard-pcup-skateboard-scb1trophies1See a fabulous selection of Skateboarding Trophies at TrophyCentral. Free engraving on Skateboard Trophies!

Skateboarding Recognition Trophies

Do you have your own Tony Hawk to recognize? TrophyCentral has a great online selection of discounted skateboarding trophies. Be sure to see our Skateboarding Participation Trophies, popular with younger children. Our Single Column Trophies with a skateboarding figure is also a customer favorite. All of our trophies include up to three lines of free personalization (larger awards include additional lines). ]]>
custom-pagetrophies-skateboarding1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:38%Our popular Skateboarding participation trophies feature a real slant-front marble base and free engraving.qtskateboardncSkateboardingcustom-pagetrophies-skateboarding1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular skateboarding figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!qtskateboardplSkateboarding, 1st / 2nd / 3rd / Etc.custom-pagetrophies-skateboarding1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%This popular Skateboarding Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!qtskateboardyrSkateboardingcustom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%501431
custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%502041
custom-pagetrophies-trap-skeet-shooting1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%,25:23%,50:29%,100:34%Our popular Skeet Shooting Participation Trophies feature a real slant-front White Marble base and free personalization. Significant quantity discounts available.qtshootnccustom-pagetrophies-trap-skeet-shooting1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular skeet shooting figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!qtshootplcustom-pagetrophies-trap-skeet-shooting1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%This popular Skeet Shooting Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!qtshootyrcustom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Ski Racing (Female) Inserts (Litho) at TrophyCentral. Each Ski Racing (Female) Insert can be used to create a unique plaque, medal or trophy.507401Skiing (Downhill), Sports
custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Skiing and Snow Sports Medals"Buy these quality Ski Racing (Male) Inserts (Litho) at TrophyCentral. Each Ski Racing (Male) Insert can be used to create a unique plaque, medal or trophy.507400Skiing (Downhill), Sports
custom-pagetrophies-snowmobileqtskiccncqtskiccscqtskiccyrqtskiccplqtskiccttqtskiccttwqtskicc3cacrylic-triangle-allqtskiccdmmqtskiccscbcup-skicc-pcup-skicc-scbbdg-skicc1trophies1Shop for Cross Country Skiing Trophies at TrophyCentral. Skiing Trophies Include Free Engraving!Cross Country Skiing Awards TrophyCentral has a great selection of cross country skiing awards and trophies. Be sure to see our popular Single Column Cross Country Trophies, available in several sizes and with several different color columns, and our place trophies – with a choice of 1st, 2nd or 3rd place trim. These awards are perfect for a race or club event.
All of our skiing trophies include up to three lines of FREE ENGRAVING (larger trophies include additional lines). ]]>
trophies skiingmedals trophies-downhill-skiing
custom-pagetrophies-snowmobileqtskidownncqtskidownscqtskidowndmqtskidownyrqtskidownplqtskidownttqtskidownttwqtskidown3cqtdowntrmqtskidownscbcup-skidown-pcup-skidown-scbbdg-skidownd-skiing-part-id-skiing-single-id-skiing-champ-id-skiing-e-part-id-skiing-e-single-id-skiing-plaque-i1trophies1Downhill Skiing Trophies from TrophyCentral. Most Skiing Trophies Ship in 1-2 Days and Include Engraving!Downhill Skiing Trophies TrophyCentral carries a large variety of skiing trophies and awards for all of your needs. The section above includes our selection of downhill skiing medals and trophies in a variety of sizes and styles to meet your recognition needs. Whether you want to recognize the ski race winner or participation in ski school, you have come to the right place!
We also have sections for cross country skiing and snowboarding.]]>
skiingmedals trophies-cross-country-skiing
custom-pageaward-medalsd-skiing-jigfd-skiing-jisfd-skiing-jibfd-skiing-mcd-skiing-mc-pre9266e927411Find downhill skiing medals discounted at TrophyCentral. Each medal features a free neck ribbon. Shop For Custom Skiing Medals With Ease TrophyCentral has a great selection of high quality ski medals, low prices and top-rated customer service. We have been helping customers since 1999 and we would be happy to serve you, too.

Frequently Asked Questions (FAQ)

What types of skiing medals do you offer?

We offer a variety of skiing medals, including designs for alpine skiing, cross-country skiing, and freestyle events. Choose from gold, silver, and bronze finishes.

Can I customize my skiing medals?

Yes! Our skiing medals can be customized with engraving, personalized ribbons, and even event logos to make them unique to your competition.

How fast do skiing medals ship?

Most in-stock skiing medals ship within 1-2 business days. Custom engraved medals may take slightly longer depending on the design.

Do you offer bulk discounts for ski competitions?

Yes! We provide special pricing for bulk orders, making it easy to award medals at large ski events. Contact us for details.

Are your skiing medals suitable for youth and adult competitions?

Absolutely! Our skiing medals are perfect for youth ski leagues, school competitions, and professional events.

Do you offer other winter sports awards?

Yes! In addition to skiing medals, we offer a wide selection of award medals and skiing trophies for various winter sports, including snowboarding and hockey.

]]>
custom-pageeagle-trophies1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"trophies410187-1010.45428.45JcharlesCrystal Awards1:22%,25:25%"crystal awards" "sales awards" "service awards" "corporate sales awards" "corporate service awards" "sales award" "service award" "corporate sales award" "corporate service award"Sky Master Awards from TrophyCentral. Discounted Trophies, Awards and Promotional Products.241custom-pagegeneral-corporate-awards1"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"458221513219Vision AwardsTrophies1:22%,26:40%"New Products" "Award for Business" "Awards for Business" "Achievement Awards" "Achievement Award" "Awards for Achievement"Find this Slate Ace Recognition Awards from TrophyCentral. Also see our great selection of engraved and personalized gifts!custom-pagefloating-plaques1"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"plaques458221510.45315.45Vision AwardsTrophies1:22%,6:28%,26:37%,51:43%Buy this Slate Star Plaque and other Star Plaques at Discounted Prices from TrophyCentral.Business, General, Starcustom-pagehonorrollpinsplastic-pinbox-t10lapel pins498551-30.5200040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find these 4.0 Gold Enamel Lapel Pins discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Honor Roll, Academiccustom-pagehonorrollpinsplastic-pinbox-t1498551-30.5200040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find these sleek black honor roll lapel Pins discounted at TrophyCentral. Each pin features a clutch back for easy attachment to clothing. Fast 1-2 day shipping.1honor-roll-u-pbHonor Roll, Academiccustom-pagehonorrollpinsplastic-pinbox-t10498551-30.5200040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find these sleek black honor society lapel pins discounted at TrophyCentral. Each pin features a clutch back for easy attachment to clothing. Fast 1-2 day shipping.1honor-soc-u-pbHonor Society, Academiccustom-pageghent-new-whiteboardshsm2-46hsm2-48hsm2-410hsm2-41211Find sliding whiteboards discounted at TrophyCentral. Each horizontal sliding whiteboard is made in the USA. Fast shipping. Start browsing now!1

Horizontal Dry Erase Sliders for Schools & Offices

See our fabulous selection in a huge number of styles, with great features:

  • Horizontal sliding system with porcelain magnetic surfaces

  • 2" Maprails

  • Heavy-duty anodized aluminum trim

  • 50-year guarantee!

and much more!

Shop With Confidence at TrophyCentral

We have great customer service, discounted prices and bulk discounts. Do you need help with some ideas or with ordering? Yes, we sell online, but we have real people who would love to help you! Feel free to call our customer service experts in Michigan, New York and online. TrophyCentral - delivering smiles since 1999!


]]>
custom-pageglass-crystal-awards11general105503-610.451612.45Classic MedallicsCrystal Awards1:30%,3:33%"Crystal Awards"Small Diamond-Shaped Crystal on Black Base. Discounted Trophies, Awards and Promotional Products.custom-pagegold-pins-lapelplasticpinboxvelapinbox151-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsGeneral1:30%,50:36%,100:39%,500:42%,1000:48%Find this fabulous Small Gold Service Bar letter pin at TrophyCentralcl53Service / Retirement Bar
custom-pagegold-pins-lapelplasticpinboxvelapinbox151-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsGeneral1:30%,50:36%,100:39%,500:42%,1000:48%Find this fabulous Small Textured Service Bar letter pin at TrophyCentralcl105Service / Retirement Bar
custom-pageengraved-frames11personalized gifts105503-610.4511813.05Classic MedallicsGiftsEngraved Frames1:22%"Father's Day Gifts"Small Pewter Golf Frame. Ideal for leagues, schools, and tournaments. Fast shipping.Engraved Framescustom-pagetrophies-snowmobileqtsnowboardncqtsnowboardscqtsnowboarddmqtsnowboardplqtsnowboardyrqtsnowboardttqtsnowboardttwqtsnowboard3cqtsnowboperpmqtsnowboardscbcup-snowboard-scbcup-snowboard-p1trophies1See a fabulous selection of Snowboarding Trophies at TrophyCentral. Each snowboarding trophy includes free engraving! Fast 1-2 day shipping!Custom Snowboarding Trophies & Awards TrophyCentral has a great selection of snowboarding awards and medals. Be sure to see our popular Single Column Snowboarding Trophies, available in several sizes and with several different color columns, and our place trophies – with a choice of 1st, 2nd or 3rd place trim. These awards are perfect for a race or club event. All of our snowboarding awards include up to three lines of FREE ENGRAVING (larger trophies include additional lines). We also offer FREE GROUND SHIPPING on orders over $100 shipping to the continental U.S. ]]>custom-pagetrophies-snowboarding1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:28%Find this awesome Snowboarding two-tier championship trophy discounted, and with free engraving, at TrophyCentral!qtsnowboardttwSnowboarding, Sportscustom-pagefree-sports-templates1"Download Only"free-sports49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Snowboarding template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Snowboarding-Certificatesnowboarding-freeSnowboarding, Sportscustom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Skiing and Snow Sports Medals"Buy these quality Snowboarding Inserts (Litho) at TrophyCentral. Each Snowboarding Insert can be used to create a unique plaque, medal or trophy.507557Snowboarding, Sports
custom-pageeawardmedals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "Sports Medals"These inexpensive 1 1/4 inch Snowboarding Medals offer a high quality, but low price for those on a tight budget.e9813Snowboarding, Sports
custom-pagetrophies-snowboarding1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:35%Our Snowboarding Participation Trophies feature a real slant-front white marble base and free personalization. Significant quantity discounts available.qtsnowboardncSnowboarding, Sportscustom-pagetrophies-snowboarding1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Fabulous Snowboarding Place Trophy with 1st, 2nd or 3rd Place Trim, Marble Base and Free personalization. Ships in a fast 1-2 days!qtsnowboardplSnowboarding, 1st / 2nd / 3rd / Etc., Sportscustom-pagetrophies-snowboarding1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%This popular Snowboarding Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!qtsnowboardyrSnowboarding, Sportscustom-pagetrophies-snowboardingqtsnowncqtsnowscqtsnowdmqtsnowyrqtsnowplqtsnowttqtsnowttwqtsnow3cqtsnowmobperpmqtsnowscbcup-snow-pcup-snow-scb1trophies1Find Snowmobile Trophies Discounted At TrophyCentral. Each Snowmobile Trophy Includes Free Personalization. Fast 1-2 Day Shipping!

Custom Snowmobile Recognition Trophies

TrophyCentral has a great online selection of discounted snowmobile trophies. Be sure to see our snowmobile participation trophies, popular with younger children. Our single column trophy with a snowmobile figure is also a customer favorite. All of our trophies include up to three lines of free personalization (larger awards include additional lines). ]]>
trophies-downhill-skiing trophies-cross-country-skiing
custom-pagetrophies-snowmobile1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with snowmobile figure discounted at TrophyCentral. Includes free text engraving!cup-snow-pSnowmobilecustom-pagetrophies-snowmobile1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.05Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:16%Find These Popular Snowmobile Figure Deluxe Platform Trophies Discounted at TrophyCentral. Real Marble; Free Engraving!qtsnowdmSnowmobilecustom-pagetrophies-snowmobile1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:25%Our popular Snowmobile Figure participation trophies feature a real slant-front marble base and free engraving.qtsnowncSnowmobilecustom-pagetrophies-snowmobile1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:16%Fabulous Snowmobile Place Trophy with 1st, 2nd or 3rd Place Trim, Marble Base and Free Engraving!qtsnowplSnowmobile, 1st / 2nd / 3rd / Etc.custom-pagetrophies-snowmobile1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these snowmobile figure budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtsnowscbSnowmobilecustom-pagetrophies-snowmobile1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:16%This popular Snowmobile Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!qtsnowyrSnowmobilecustom-pagefree-sports-templates1"Download Only"free-sports4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Snowmobiling template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Snowmobiling-Certificatesnowmobiling-freeSnowmobilingcustom-pagemedallion-inserts-general-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these quality Soaring Eagle Inserts (Litho) at TrophyCentral. Each Soaring Eagle Insert can be used to create a unique plaque, medal or trophy.507439Eagle
custom-pagetrophies-basketball1037soccer-plaque-iqsinplaq3dsoccerqsinplaqsoccerqtdogsocrsoccer-ei1trophies1Shop soccer trophies, medals and plaques for every level of play. Hundreds of styles for players, leagues and schools. Free engraving. Fast shipping.trophies-soccer

Why Choose Our Soccer Trophies?

Our soccer trophies are crafted to celebrate every level of the beautiful game, from first-year recreational players taking the field for the first time to competitive club and high school programs chasing championships. Whether you need participation awards that make every player feel valued, tiered trophies for division finishers, or a standout perpetual trophy for your league champion, we have styles and sizes to fit every program and budget.

Every soccer trophy includes free engraving personalized with player names, team names, and season details. With fast production times and reliable shipping, your awards will be ready when your season ends. Browse our complete collection of boy's and girl's soccer trophies, medals, and plaques and find the perfect recognition for your team.

Order your custom soccer awards today and give your players something they'll be proud to display for years to come.

Frequently Asked Questions

What styles of soccer trophies work best for different leagues and age groups?

Column trophies with soccer figurines are the most popular choice for recreational and youth leagues - they are affordable, available in multiple heights for 1st, 2nd, and 3rd place, and include free engraving for team names, player names, and season dates. Resin soccer trophies featuring action-pose sculptures are a great option for travel teams and club programs where a more distinctive award is expected. Cup trophies and perpetual designs work well for competitive league championships where the same award is presented year after year. For individual player awards like MVP, Most Improved, and Golden Boot, insert medals and plaques offer a clean, professional look at a price that works even for large rosters. Budget participation trophies ensure every player on every team goes home with something to be proud of.

How do I choose the right size soccer trophy for my event?

For younger players in recreational and house leagues, 6 to 10 inch trophies are ideal - they feel substantial to a young athlete without being awkward to carry or display. For middle school and high school programs, 10 to 14 inch trophies are the standard range, especially when ordering tiered sets for champions, runners-up, and third place finishers. Competitive club and travel team championships call for 14 to 20 inch trophies that look impressive at an awards banquet and hold up as a long-term display piece. For league or tournament grand champions, a two-tier trophy or large cup in the 20 to 24 inch range creates a standout presentation moment. When ordering for a full season, many leagues pair a larger trophy for the champion team with individual medals for every player on the roster.

What engraving options are available for soccer trophies and awards?

All soccer trophies include free engraving, and the best awards are personalized with more than just a name. For team trophies, include the league name, team name, season year, and finishing position - for example: Spring Soccer League, FC United, Division 1 Champions, 2025. For individual player awards, add the player name, award title, and season. Coach awards benefit from a short line of recognition alongside the season and program name. For tournament directors ordering across multiple divisions and age groups, our team can help you plan engraving text that works consistently across a large order without slowing down your turnaround time.

Do you offer bulk pricing for soccer league and tournament orders?

Yes - prices drop significantly as quantities increase, which is especially valuable for soccer given the large rosters and multiple teams most leagues are recognizing at end-of-season events. Most league coordinators order a combination of team trophies for division winners and individual medals or participation trophies for every player. Orders over $99 qualify for free economy shipping, and our team can provide a custom quote for large multi-team or multi-division orders. We have worked with recreational leagues, club programs, school athletic departments, and tournament organizers for over 25 years and can help you build a complete recognition program that fits your budget from participation through championship.

]]>
custom-pagemedals-j-series12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
"PT1=Medals" "PC12=105503-60.515014Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,50:28%,100:34%,500:41%"Soccer Medals" "Soccer Awards" "Award Medals - All Subjects" "Sports Medals" "Purchase Soccer Trophies" "Discount Soccer Trophies" "Soccer Medals and Trophies" "Soccer Trophies and Medals"Find our Soccer (General) 2" Olympic-Style J-Series Medals at a super price point at TrophyCentral. Large quantity discounts available!j956612-20-2040Soccer, Sports
custom-pagetrophies-soccer11"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"medals498852-30.3716021.6Quick Trophyaward-medalsSports, Hobby, Org, Livestock1:14%,10:25%,100:36%"Soccer Medals" "Soccer Awards" "Most Popular Items" "Award Medals - All Subjects" "Sports Medals" "Soccer Medals and Trophies" "Soccer Trophies and Medals"Soccer - 2 Inch Antique Series Medals. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.soccer1Soccer, Sportscustom-pagetrophies-soccer20498552-40.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Soccer Epoxy Decal (2 Inch). Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagetrophies-soccer1"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"medals498552-30.3716021.6Trophy Centralaward-medalsSports, Hobby, Org, Livestock1:14%,10:19%,50:28%,100:34%,500:42%"Soccer Medals"Soccer 3D Relief Medals (2 Inch). Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.qush3dsoccermeSoccer, Sportscustom-pagetrophies-soccersoccerfr1soccerfrcertificates290631-31 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,25:27%,100:40%,500:50%Achievement Soccer Certificate. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.1037Soccer, Sportscustom-pagetrophies-soccer1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Achievement Cup Soccer Trophy. Ideal for leagues, schools, and tournaments. Free engraving. Fast shipping.cup-soccer-pSoccer, Sportscustom-pagefree-sports-templates1"Download Only"free-sports49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Free printable soccer certificate template to recognize players, teams, and coaches. Download and customize for leagues, schools, and clubs at no cost.soccerfrSoccer, Sportscustom-pagecoaching-teaching-guides11Soccer Awards Guide. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.custom-pagenoname111"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.5116.5Perfect CaseDisplay Cases11:14%,5:16%Soccer Ball Display Case (Glass, Octagon). Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagesports-inserts1105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Soccer Ball Litho Medal Insert. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.492691Soccer, Sportscustom-pagesoccerpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsSports, Hobby, Org, Livestock1:22%,50:30%,100:33%,500:47%Soccer Ball-Shaped Letter Pin. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.ec01Soccer, Sports111037 wvl455"3-4 business days + shipping time" "Marquette, MI" "UPS (FedEx available on request)""PT1=Trophies" "PC12=498552-310.451224.5JDS-STrophiesSports, Hobby, Org, Livestock1:22%,12:32%"Soccer Medals and Trophies" "Soccer Trophies and Medals"Kids love our engraved soccer bank trophy! Soccer bank trophies are made of resin and the baseball figure is hand-painted.1soccerbank12-20-2020Soccer, Sportscustom-pagetrophies-soccer1trophies-soccertrophies498552-310.453631.05JDS-STrophiesSports, Hobby, Org, Livestock1"Soccer Awards" "Soccer Medals and Trophies" "Soccer Trophies and Medals"Soccer Bobble Head Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.soccer-bobble-head-trophySoccer, Sportscustom-pagetrophies-soccer1trophies105503-610.4511230.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1"Soccer Awards"Soccer Cast Stone Series Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagenoname111"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.5116.5Perfect CaseDisplay Cases11:14%,5:15%Soccer Display Case (Glass, Wall-Mounted). Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagetrophies-soccer1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"498852-30.38150030Quick TrophyDog TagsSports, Hobby, Org, Livestock1:14%,10:15%Soccer Dog Tag. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.qtdogsocrSoccer, Sportscustom-pagetrophies-soccer1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Economy Soccer Column Insert Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagesoccerpinsplastic-pinbox-t10lapel pins498551-30.5200040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Soccer Gold Enamel Lapel Pin. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagetrophies-soccer1"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498852-310.45811.6Quick TrophyPlaquesInsert1:14%,3:14%"Soccer Awards"Soccer Holographic Decal Plaque. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagetrophies-soccer1medals498552-30.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Soccer Insert Medal. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagetrophies-soccer1medals498552-40.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Soccer Insert Medal with Personalized Rim. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagetrophies-soccer1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Soccer Insert Plaque (Multiple Styles). Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagetrophies-soccer12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,100:28%,500:34%,1000:45%"Soccer Medals" "Soccer Awards" "Award Medals - All Subjects" "Sports Medals" "Soccer Medals and Trophies" "Soccer Trophies and Medals"Soccer Medal (1 1/4 Inch). Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.e902306-15-2013Soccer, Sports
custom-pagetrophies-soccer1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%2 3/4" T-Series Medal with Bronze Frame: Soccer. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagetrophies-soccer1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%2 3/4" T-Series Medal with Gold Frame: Soccer. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagetrophies-soccer1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%2 3/4" Silver Frame Medal: Soccer. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagetrophies-soccer50"Standard Service: 8 Business Days from Receipt of Artwork, Rush Service (Extra Charge): 3 Business Days from Receipt of Artwork" "Oxnard, CA" "UPS (FedEx available on request)"medals930335-1010.630033.6Simba Calaward-medalsSports, Hobby, Org, Livestock1:22%,300:40%,500:51%,1000:54%"Soccer Medals" "Soccer Awards"Soccer Medal with Personalized School, Team or Event Name. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.qcm-28Soccer, Sports1sports-medals1Find soccer medals your players will love discounted at TrophyCentral. Each soccer medal features a free neck ribbon.Shop for Soccer Award Medals with Ease at TrophyCentral! TrophyCentral has an industry-leading selection that will fit any budget, low prices and bulk discounts. Our top-rated customer service team will be happy to assist you with all of your needs.

Frequently Asked Questions (FAQ)

🏆 Who typically receives soccer medals?

Soccer medals are awarded to players for outstanding performance, teamwork, and participation. They are commonly given for MVP, Best Offense, Best Defense, Most Improved, and for championship teams at the end of the season.

🎨 Can I customize soccer medals with engraving?

Yes! Our custom soccer medals can be personalized with player names, team names, tournament details, and special achievements. Many of our medals come with free engraving options.

📦 Do you offer bulk discounts for teams and leagues?

Absolutely! We provide bulk pricing for teams, schools, and leagues. Contact us for special discounts on large orders of soccer team medals and awards.

🥇 What are the best soccer medals for youth leagues?

For youth soccer, we recommend lightweight and durable medals with colorful designs. Options like full-color soccer medals or those with bright, customizable ribbons are great for young players.

🚚 How fast can I receive my soccer medals?

Most of our soccer medals ship within 1-2 business days. Custom-engraved medals may take a little longer, so we recommend ordering early to ensure they arrive before your award ceremony or tournament.

]]>
soccerinsertmedals soccerpins
custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Soccer Mylar Decal Medal Insert. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.489612Soccer, Sports
custom-pagetrophies-soccer1"10 business days" "Aliquippa, PA" "UPS"trophies1500110-1410.45424.45Glass AmericaCrystal Awards1:22%,10:25%"Soccer Awards" "Soccer Medals and Trophies" "Soccer Trophies and Medals"Soccer Optical Crystal Award. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.8988Soccer, Sportscustom-pagetrophies-soccer1498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Budget-Friendly Soccer Participation Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.1trophies-soccerSoccer, Sportscustom-pagetrophies-soccer1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Participation Insert Trophy - Soccer. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Participation Insert Trophy - SoccerSoccer, Sportscustom-pagetrophies-soccer1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Economy Soccer Participation Insert Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagekeychains21105502-40.39125035.39Classic MedallicsGiftsKeychains1:22%,10:25%,25:32%,50:39%,100:47%"Soccer Awards"Soccer Pewter Keychains. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.pk68-cmKeychainscustom-pagetrophies-soccercl08ec01soccer-pb11Soccer pins in a variety of styles, finishes and sizes. Each soccer pin features a clutch back for easy attachment to clothing.Lapel Pins: Soccer TrophyCentral has a great selection of stock and custom soccer pins. Our soccer letter pins are available with a color or chenille gold finish and are available in several styles. Each soccer pin features a clutch-pin back for safe and easy attachment to clothing.

Shop with Confidence at TrophyCentral!

TrophyCentral has a great online selection that will fit any budget. Our top-rated representatives are happy to assist you. Our experts in New York and Michigan have been providing suggestions and guidance since 1999!]]>
custom-pageaward-ribbons-printed1"1-2 business days" "Topeka, Indiana" "UPS (Post Office Priority Mail may also be available)"ribbons465711-21 26120030.36Tower RibbonRibbons11:22%,50:46%Soccer Award Ribbons. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagetrophies-soccer1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Single Soccer Column Insert Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Single Column Insert Trophy - SoccerSoccer, Sportscustom-pagetrophies-soccer1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Single Column Budget Soccer Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.mqtsoccerscbSoccer, Sportscustom-pagetrophies-soccer1trophies498551-311821.06TrophyCentraltrophies1Soccer, Sportscustom-pagetrophies-soccer1trophies498552-310.451623.65Trophy CentralTrophiesSports, Hobby, Org, Livestock1"Soccer Trophies" "Cheap Soccer Trophies" "Buy Soccer Trophies" "Purchase Soccer Trophies" "Discount Soccer Trophies"Double Platform Soccer Award in 3 Sizes. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagesports-resource-hub11Discover fun and creative soccer recognition ideas for kids, teens, and adults. Learn about different styles, how to choose the right award, and tips for unforgettable end of season ceremonies.custom-pagetrophies-soccer1"PT1=Trophies" "PC12=498552-310.451622.85Trophy CentralTrophiesSports, Hobby, Org, Livestock1"Soccer Trophies" "Cheap Soccer Trophies" "Buy Soccer Trophies" "Purchase Soccer Trophies" "Discount Soccer Trophies"Soccer Place (1st, 2nd, 3rd) Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.1trophies-soccerSoccer, 1st / 2nd / 3rd / Etc., Sportscustom-pagetrophies-soccer1trophies498552-310.451622.85Trophy CentralTrophiesSports, Hobby, Org, Livestock1"Soccer Trophies" "Cheap Soccer Trophies" "Buy Soccer Trophies" "Purchase Soccer Trophies" "Discount Soccer Trophies"Year Indicator Trim Soccer Trophy - Custom Engraved League Award. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pageawardcertificates11certificates290631-31 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,25:24%,100:40%,500:50%Find these Social Studies certificates discounted at TrophyCentral. Each Social Studies certificate is beautifully printed and measures 11 x 8 1/2 inches.929Social Studiescustom-pageschool-pinsplasticpinboxvelapinbox1"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:30%,100:35%,500:48%"School Pins"Find these popular Social Studies HP Series Pins Discounted at TrophyCentral. Fast 1-2 Days Shipping! Large Quantity Discounts Are Available.hp1906-15-2013Social Studiescustom-pageschool-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:28%,100:32%,500:42%"School Pins"Find these popular Social Studies AP Series Lapel Pins discounted at TrophyCentral. Fast 1-2 day shipping!al82Social Studiescustom-pagetrophies-softball1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with softball figure discounted at TrophyCentral. Includes free text engraving!cup-soft-pSoftball, Sportscustom-pagecoaching-teaching-guides11Creative softball award categories for banquets. Fun ideas like Dugout Energy and Home Run Queen, plus exact engraving examples. Perfect planning guide.custom-pagetrophies-softball1498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Find this budget softball award trophy discounted at Trophy Central. Features a real marble base and plastic softball figure. Engraving is free. Fast 1-2 day shipping.1trophies-softballSoftball, Sportscustom-pagefree-sports-templates1"Download Only"free-sports4985501Trophy CentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Softball template is free and designed exclusively for Trophy Central. Softball certificate templates measure 11" x 8 1/2" and can be easily downloaded and printed.softball-certificatesoftball-frSoftball, Sportscustom-pagefree-sports-templates1"Download Only"free-sports49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Softball template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Softball-Certificatesoftball-freeSoftball, Sportscustom-pagesporcer1certificates290631-31 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,25:27%,100:40%,500:50%"Softball Awards"Give your softball players the recognition they deserve with softball certificates from Trophy Central. Shop our discounted softball certificates today!1038Softball, Sportscustom-pagetrophies-softball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-30.38150030Quick TrophyDog TagsSports, Hobby, Org, Livestock1:14%,10:15%Find these popular softball dog tags discounted at TrophyCentral. The price of each softball dog tag includes chain and custom engraving!qtdogsoftSoftball, Sportscustom-pagebaseballdisplay11"7-10 business days w/Logo, 4-6 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 2311413Perfect CaseDisplay Cases1:14%,5:21%Softball Glass Display Cases from TrophyCentral. Discounted Trophies, Awards and Promotional Products.Softball, Sportscustom-pagetrophies-softball1trophies498552-310.45TrophiesSports, Hobby, Org, Livestock1Our popular Softball Glove participation trophies feature a real slant-front marble base and free engraving.Return to oursection for more great choices!trophies-softballSoftball, Golden Glove11Find a Great Selection of Softball Glove Trophies Discounted at TrophyCentral. Each Softball Glove Trophy Includes Free Personalization! Fast 1-2 Day Shipping!1Softball, Golden Glovecustom-pagetrophies-softball1trophies498552-310.45TrophiesSports, Hobby, Org, Livestock1Find this popular softball glove figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!1st / 2nd / 3rd / Etc., Softball, Golden Glovecustom-pagetrophies-softball1trophies498552-310.45TrophiesSports, Hobby, Org, Livestock1This popular Softball Glove Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!See more great league, team and individualin other popular styles.trophies-softballSoftball, Golden Glovecustom-pageholographic-insert-plaques1"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498852-310.45811.6Quick TrophyPlaquesInsert1:14%,3:14%"Softball Awards"See this stunning Softball plaque and other Holographic Plaques at TrophyCentral.qsinplaq3dsoftballSoftball, Sportscustom-pagetrophies-softball1medals498553-Feb0.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these colorful Softball insert medals discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Softball, Sportscustom-pagetrophies-softball1medals498553-Feb0.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Softball insert medals with a personalized front rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Softball, Sportscustom-pagecherry-insert-plaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these softball insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Softball, Sportscustom-pagetrophies-softball489634497659507391504531softball-ei1trophies-softball1"Softball Medals"See these Softball Inserts discounted at TrophyCentral. Each Softball Insert measures 2" and can be used in medals, trophies and plaques.Softball Medal Insert Awards If you are looking for a budget-friendly alternative to trophies, our softball insert medals are the perfect solution. Many softball medals come in gold, silver and bronze finishes and offer optional engraving to keep the price as low as possible. Be sure to check out our 1 1/4 Inch Medals and our Custom Ring Medals. All of our medals include a neck ribbon, and many offer a choice of ribbon color. Without engraving, your order will typically ship in just 1-2 business days, so no need to worry if you have waited for the last minute.]]>custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these high-quality Softball Inserts (497659) at TrophyCentral. Each Softball Inserts (497659) can be used to create a unique plaque, medal or trophy.497659Softball, Sports
11Find softball medals in a large variety of styles, prices and finishes. Each softball medal features a free neck ribbon.Shop for Softball Award Medals with Ease at TrophyCentral! If you are looking to buy softball medals and awards online, look no further! TrophyCentral has an industry-leading selection that will fit any budget and that your softball players and team will love. We also have a top-rated customer service team. Our experts in New York and Michigan have been providing suggestions and guidance since 1999 and they would be happy to help you as well!]]>trophies-softballcustom-pagetrophies-softball1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our softball insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - SoftballSoftball, Sportscustom-pagetrophies-softball1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy softball insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Softball, Sportscustom-pagekeychains21105502-40.39125035.39Classic MedallicsGiftsKeychains1:22%,10:25%,25:32%,50:39%,100:47%"Softball Awards"Find these popular Pewter Softball Key Chains at TrophyCentral; discounted prices!pk87-cm12-20-2020Keychainscustom-pagesports-pinsec04cl09cpx11Find softball pins discounted at TrophyCentral. Each softball pin features a clutch-pin back for easy and safe attachment to clothing and letters.trophies-softball softball-pinscustom-pagetrophies-softball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%,25:23%,50:29%,100:34%"Softball Trophies" "Softball Trophy" "Trophies, Softball" "Softball Awards"Our Softball Player Participation Trophies feature a real slant-front white marble base and free personalization. Significant quantity discounts available.qtsoftncLooking for something a bit different? See morehere.trophies-softballSoftball, Sportscustom-pageaward-medalsqtsoftnciasofmmxx02qtsoftscqtsoftdmqtsoftyrqtsoftplqtsoftttqtsoftttwqtsoft3cqtsofttrqtsoftperptr6097mqtsoftscbcup-soft-scbcup-soft-pcup-softbgl-scbcup-softbgl-psoftball-part-isoftball-single-isoftball-champ-isoftball-plaque-isoftball-e-part-isoftball-e-single-icup-softball-scb-icup-softball-inbdg-softballqtsoftbgl3cqtsoftbgldmqtsoftbglncqtsoftbglplqtsoftbglscqtsoftbglttqtsoftbglttwqtsoftbglyrtm9988gj9790qush3dsoftmez9014softballmedalssoftball-mcsoftball-mc-prsoftball-jigfsoftball-jibfsoftball-jisf1trophies1"Softball Awards" "Sports Trophies" "Trophies" "Softball Trophies"Find a great selection of softball trophies at TrophyCentral. Each softball trophy and award includes free engraving. Softball medals include a ribbon.

At TrophyCentral, we understand the importance of recognizing excellence in softball. Our diverse selection of trophies caters to all levels of play, from youth leagues to adult tournaments. Whether you're looking for participation awards, MVP trophies, or team recognition pieces, we have the perfect award to commemorate every achievement.

Choose from a variety of styles, including traditional column trophies, modern resin designs, and sophisticated plaques. Each trophy is fully customizable with free engraving, allowing you to add names, dates, and special messages. We also offer bulk pricing to accommodate large events or league-wide recognition.

With fast processing times and reliable shipping, you can trust that your awards will arrive on time for your event. Let TrophyCentral help you celebrate the dedication and sportsmanship of your softball players with awards they'll cherish.

]]>
trophies 1st-place-medals mvp-trophies
custom-pagetrophies-softball1trophies498551-311821.06TrophyCentraltrophies1Softball, Sportscustom-pagetrophies-softball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%"Softball Trophies" "Softball Trophy" "Trophies, Softball"Find this popular softball figure trophy with a gold place trim, marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!qtsoftplSoftball, 1st / 2nd / 3rd / Etc., Sportscustom-pagetrophies-softball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%"Softball Trophies" "Softball Trophy" "Trophies, Softball"This popular Softball Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!qtsoftyrReturn to oursection.trophies-softballSoftball, Sportscustom-pagecustom-pom-poms1muimse1100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Texas" "UPS (FedEx available on request)"7745310-1410.454811.97PepcoPromotional ProductsSpirit1Find These Solid Handle Advertising Poms and other Custom Poms at TrophyCentral.Spiritcustom-pagecolor-wall-plaques1"1-2 business days" "Marquette, MI" "UPS"plaques498852-310.51022.50Quick TrophyPlaquesColor Plaques1:14%,3:17%"New Products"Solid walnut wall-mount engraved plaque with choice of engraving plate. Price includes up to 13 lines of engraving. Horizontal, measures 10"x8". Shop today!10x8walnutsolidBlank, Generalcustom-pagecolor-wall-plaques1"1-2 business days" "Marquette, MI" "UPS"plaques498852-310.51034.50Quick TrophyPlaquesColor Plaques1:14%,3:17%"New Products"These beautiful 12 x 9 horizontal oriented plaques feature a fabulous walnut finish. Price includes free engraving. Fast 1-2 day shipping!12x9walnutsolidBlank, Generalcustom-pagecolor-wall-plaques1"1-2 business days" "Marquette, MI" "UPS"plaques498852-310.51013.50Quick TrophyPlaquesColor Plaques1:14%,3:17%"New Products"These beautiful 7 x 9 vertical plaques feature a fabulous walnut finish. Price includes personalization! Fast 1-2 day shipping!7x9walnutsolidBlank, Generalcustom-pagecolor-wall-plaques1"1-2 business days" "Marquette, MI" "UPS"plaques498852-310.51022.50Quick TrophyPlaquesColor Plaques1:14%,3:17%"New Products"Find these 8" x 10" solid walnut plaques discounted at TrophyCentral. Price includes free engraving! Optional full color logo.Blank, Generalcustom-pagecolor-wall-plaques1"1-2 business days" "Marquette, MI" "UPS"plaques498852-310.51034.50Quick TrophyPlaquesColor Plaques1:14%,3:17%"New Products"Find these beautiful 9 x 12 solid Walnut vertical oriented plaques discounted at TrophyCentral. Price includes free engraving!9x12walnutsolidBlank, Generalcustom-pagecolor-wall-plaques1"1-2 business days" "Marquette, MI" "UPS"plaques498852-310.51013.50Quick TrophyPlaquesColor Plaques1:14%,3:17%"New Products"These beautiful 9 x 7 (horizontal) plaques feature a fabulous walnut finish. Price includes free engraving! Fast 1-2 day shipping9x7walnutsolidBlank, Generalcustom-pagemusicartpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsMusic, Drama, Art, Dance1:22%,50:30%,100:33%,500:45%"Music Lapel Pins" "Band Lapel Pins" "Music Pins"Find These Sousaphone Lapel Pins Discounted at TrophyCentral. Features a Clutch-Pin Back and Fast 1-2 Day Shipping!mp910-13-2017Music / Band / Choruscustom-pagecrystalgifts6"7-10 business days" "Kentucky" "UPS (FedEx available on request)"personalized gifts410187-1010.45515.45JcharlesGiftsCrystal Gifts1:22%,100:22%"personalized gifts"A series of sparkling prism cuts encircling the perimeter creates a feeling of richness and depth with our Illuminate Paperweight. Made of optical crystal.54Crystal Giftscustom-pageachievement-pins1"1-2 business days" "Columbia, SC"lapel pins292121-31 2 3 230.4150030.4Certificate Sourcelapel-award-pinsGeneral1:22%,50:28%,100:32%,500:36%"Achievement Award" "Achievement Awards"Find These Sparkling and Colorful Star-Shaped Achievement Pins at Discounted TrophyCentral.custom-pagemascot-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Spartan Mascot Badges Discounted At TrophyCentral.mascotbadges-spartancustom-pagecorporatepins1plasticpinboxvelapinbox5"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsBusiness1:30%,50:32%,100:35%,500:39%"Employee Lapel Pins" "Corporate Lapel Pins"Find this US Air Force Pin at TrophyCentral. US Air Force and other pins ship in just 1-2 business days!spawlapinBusinesscustom-pagedebate-medals-pins12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsGeneral1:22%Buy these high-quality Speaker's Award Inserts at TrophyCentral. Each Speaker's Award Insert can be used to create a unique plaque, medal or trophy.518760General
custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsGeneral1:22%Buy these high-quality Special Achievement Award at TrophyCentral. Each Special Achievement Award can be used to create a unique plaque, medal or trophy.518288General, Business, Leadership
custom-page10-unique-pickleball-awards1appreciation-templates"Download Only"free-appreciation49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"See this Special Achievement Certificate designed exclusively for TrophyCentral! Special Achievement Certificates can be downloaded for free! Each Achievement Certificate measures 11 x 8 1/2 inches.specialAchievementcustom-pagewalnut-insert-plaques1"3-6 business days with engraving, Without engraving: 1-3 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"plaques105503-610.4511219.65Classic MedallicsPlaquesInsert1:22%,3:24%,5:27%Genuine Walnut Special Achievement Award Plaque with 2 Inch Insert and Free Engraving.51-8288Volunteercustom-pageeawardmedals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsGeneral1:22%,100:28%,500:34%,1000:45%"Swimming Awards" "General Medals"These inexpensive 1 1/4 inch Special Achievement Medals with a torch design, offer a high quality, but low price for those on a tight budget.e903502-09-2012General, Academic
custom-pageeawardmedals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsGeneral1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "School Medals"These inexpensive 1 1/4 inch Special Achievement Medals, with a Handshake Design, offer a high quality, but low price for those on a tight budget.e942306-20-2019General
11"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)""PC10=458221510.45624.45Vision AwardsTrophies1:22%,26:33%Find The Special Delivery Envelope Award Discounted At TrophyCentral. Price Includes Etching and Gift Box! Available in 3 sizes.12-20-2040custom-pageappreciation-templates1"Download Only"free-appreciation4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Special Person template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Special-Person-Certificatespecial-person-freeAchievement, Thank Youcustom-pageschool-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins"Find this Special Person Pin at TrophyCentral. Special Person and other pins ship in just 1-2 business days!br40512-20-2040General11These awards have been especially selected for their price and style. Each award includes engraving!custom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these quality Mylar Special Recognition Award Decal Inserts at TrophyCentral. Each decal can be used to create a unique plaque, medal or trophy.489903Achievement
custom-pageawardcertificates11certificates290631-31 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,25:24%,100:40%,500:50%Find these Printed Special Recognition certificates at TrophyCentral. Each Special Recognition certificate measures 11 x 8 1/2 inches.918Generalcustom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceCertificates / CoversEmbosser Seals1:22%,3:28%,5:31%Find these Special Recognition of Excellence Embossed Certificate Seals discounted at TrophyCentral. Seals are easy to apply with a pressure-sensitive backing.803sreGeneralcustom-pageawardcertificates11certificates290631-31 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,25:24%,100:40%,500:50%Find these Special Recognition Cow Certificates discounted at TrophyCentral. Each Special Recognition Cow Certificate measures 8 1/2" x 11".966Academiccustom-pageachievement-medals102-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.5115014Classic Medallicsaward-medalsAcademic1:22%,25:24%,50:30%,100:36%,500:42%"School Medals" "School Award Medals" "Scholastic Medals" "Scholastic Award Medals" "Academic Medals" "Academic Award Medals" "Medals, School"Your students will love these colorful Mylar Special Recognition Medals from TrophyCentral. Each Special Recognition medal includes a neck ribbon!tm990307-22-2015General, Academic
custom-pagelapel-award-pins1250"14 Business Days from Receipt of Artwork" "Charlotte, NC or Oxnard, CA" "UPS (FedEx available on request)"lapel pins9303314-1510.46Simba Callapel-award-pinsGeneral1:22%,500:29%,1000:38%,2500:46%"Custom Lapel Pins" "Lapel Pins, Custom" "Custom Trading Pins"Find Special Shaped pins discounted at TrophyCentral. Choose your shape - house, state, ice cream cone - whatever you need!fucocushpiCustom Pinscustom-pageachievement-certificates-awards1"Download Only"free-academic4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Special Student template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Special-Student-Certificatespecial-student-freeAchievement, Academiccustom-pageteacher-appreciation1498552-311623.65TrophiesSchool1This quick-ship trophy from TrophyCentral features an apple figure, real marble base and marble trophy figure platform, choice of column size and color.mqt-apple-dmApplecustom-pageachievement-certificates-awards1"Download Only"free-academic49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our special teacher template (female) is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-female-special-teacher-certificatefemale-special-teacher-freeAcademic, Teacher Appreciation, Appreciationcustom-pageachievement-certificates-awards1"Download Only"free-academic49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our special teacher template (male) is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-male-special-teacher-certificatemale-special-teacher-freeTeacher, Appreciation, Academiccustom-pageteacher-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"Find Special Teacher pins discounted at TrophyCentral. Each Special Teacher lapel pin features a quality clutch-back. Fast 1-2 day shipping.br297Teacher's Award, Academiccustom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsGeneral1:22%Buy these high-quality Special Thanks Inserts at TrophyCentral. Each Special Thanks Insert can be used to create a unique plaque, medal or trophy.518726General, Volunteer, Thank You
custom-pagevolunteerpinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"Find these Special Thanks pins discounted at TrophyCentral. Each Special Thanks lapel pin features a gold finish and clutch-back. Fast 1-2 day shipping!br559Volunteer, Thank You, Generalcustom-pagemath-medalsspelling-plaque-ispelling1trophies-academic1"Spelling Awards"Spelling bee trophies, medals, and awards for classroom, school, and district competitions. Free engraving, fast 1–2 day production. Shop now at TrophyCentral. spelling bee trophies, spelling bee trophy, spelling bee awards, spelling bee trophies and awardsFind Spelling Trophies, Medals, and Awards With Ease Trophy Central offers a huge selection across all categories, including medals, at discounted prices and with knowledgeable customer service. Our team of experts is always ready to help you find the right awards for your event. Browse our selection and add your favorite spelling awards to your cart today!

Frequently Asked Questions (FAQ)

What types of spelling bee trophies do you offer?

Our collection includes traditional column trophies, spelling-themed resin awards featuring designs like open books, stars, and alphabet motifs, and sleek modern styles suited for all age groups. Whether you need a compact 6-inch participation trophy for a classroom bee or an impressive 18-inch champion's column for a district-wide competition, we have options to fit every event and budget. Browse our trophy shop to compare styles and sizes.

How fast can I receive my spelling bee trophies and medals?

Most spelling bee trophies and medals ship within one to two business days after your order is placed. If you are working toward a specific competition date, check the estimated delivery time at checkout and reach out to our team if you need help planning your order timeline.

Can I personalize my spelling bee trophies?

Yes, all of our spelling bee trophies come with free engraving. You can add the recipient's name, placement, competition name, school name, and event date to create a truly personalized keepsake. For example: Emma Johnson, First Place, Lincoln Elementary Spelling Bee, March 2026. Our streamlined engraving process helps keep turnaround times low without any added cost.

Do you offer bulk discounts for schools and competitions?

Yes, we offer discounts on bulk orders to help schools and organizers save more. Whether you are running a single-school bee or a district-wide competition with dozens of participants, contact us by phone or email for special pricing on larger orders. Many programs order a mix of medals for all participants and trophies for top finishers to maximize recognition while staying within budget.

Be sure to see our spelling resource guides: ]]>
trophies
custom-pagespelling-medals20medals498552-40.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find these colorful Spelling 2" Epoxy-covered insert decals discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Spellingcustom-pagespelling-pins-medalsplastic-pinbox-t5medals498551-30.550040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find our 3D Series gold spelling pins discounted at TrophyCentral. Fast 1-2 day shipping.6072024Spellingcustom-pagecoaching-teaching-guides11Creative spelling bee award ideas with engraving templates for competitions and classroom champions. From Word Wizard to Spelling Superstar, celebrate your spellers with meaningful recognition and free engraving.custom-pageachievement-certificates-awards1"Download Only"free-academic49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates" "Spelling Awards"See this Spelling Certificate designed exclusively for TrophyCentral! Spelling Certificates can be downloaded for free! Each Spelling Certificate measures 11 x 8 1/2 inches.spellingSpelling, Academiccustom-pageachievement-certificates-awards1"Download Only"free-academic4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Spelling template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Spelling-Certificatespelling-freeSpelling, Academiccustom-pagequickshiptrophies-spelling1trophies498552-311821.06TrophiesAcademic1Find this achievement cup trophy with spelling bee figure discounted at TrophyCentral. Includes free text engraving!cup-spell-pSpellingcustom-pagespelling-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-30.3713003.37Classic MedallicsInsertsAcademic1:22%"Spelling Pins and Medals" "Award Medals" "School Medals" "Award Medals - All Subjects" "Spelling Bee Award" "Spelling Bee Awards" "Awards, Spelling Bee" "Spelling Bee Trophies" "Spelling Bee Trophy" "Spelling Awards" "Spelling Award" "Spelling Trophies" "Spelling Bee Medals" "Spelling Medals"Buy these quality Mylar Spelling Bee Award Decal Inserts at TrophyCentral. Each Spelling Bee Award Decal can be used to create a unique plaque, medal or trophy.489904Spelling
custom-pagespelling-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Spelling Pins and Medals" "Award Medals" "School Medals" "Award Medals - All Subjects" "Spelling Awards" "Spelling Medals"Buy these quality Spelling Bee Inserts (Litho) at TrophyCentral. Each Spelling Bee Insert can be used to create a unique plaque, medal or trophy.496090Spelling
custom-pagequickshiptrophies-spellingcomsoonecsch10br381 comsoonecsch scholmed2-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.5115014Classic Medallicsaward-medalsAcademic1:22%,25:24%,50:30%,100:36%,500:42%"Spelling Pins and Medals" "School Medals" "School Award Medals" "Scholastic Medals" "Scholastic Award Medals" "Academic Medals" "Academic Award Medals" "Medals, School" "Spelling Bee Award" "Spelling Bee Awards" "Awards, Spelling Bee" "Spelling Bee Trophies" "Spelling Bee Trophy" "Spelling Awards" "Spelling Award" "Spelling Trophies" "Spelling Bee Medals" "Spelling Medals"Your students will love these colorful Mylar Spelling Bee Medals from TrophyCentral. Each Spelling Bee medal includes a neck ribbon!quickshiptrophies-spellingSpelling
custom-pagequickshiptrophies-spelling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453633.4Quick TrophyTrophiesSchool11:14%,10:17%,25:23%,50:29%,100:34%Our popular spelling bee participation trophies feature a real slant-front marble base and free engraving. Fast 1-2 day shipping.Spellingcustom-pagequickshiptrophies-spelling1trophies498552-312421.33TrophiesAcademic1Find these spelling bee budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtspellscbSpellingcustom-pagetm9904plasticpinboxvelapinbox10ap83 em17 tm9904"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"Spelling Pins and Medals" "Spelling Bee Award" "Spelling Bee Awards" "Awards, Spelling Bee" "Spelling Bee Trophies" "Spelling Bee Trophy" "Spelling Awards" "Spelling Award" "Spelling Trophies" "Spelling Bee Medals" "Spelling Medals" "School Pins"Find these Spelling Whiz Pins discounted at TrophyCentral. Spelling award pins feature a quality clutch back and ship in 1-2 days. Large quantity discounts.br38104-15-2020Spellingcustom-pagespelling-pins-medalsplastic-pinbox-t10498551-30.5200040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find these Spelling Gold Enamel Lapel Pins discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.1spelling-u-pbSpellingcustom-pagequickshiptrophies-spelling1medals498552-30.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Colorful Spelling Insert Medals Discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Spellingcustom-pagequickshiptrophies-spelling1medals498552-40.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Spelling Insert Medals With A Personalized Front Rim Discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Spellingcustom-pagecherry-insert-plaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these spelling insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Spellingcustom-pagespelling-pins-medalsplastic-pinbox-t5lapel pins498551-20.550040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find these Spelling Gold Enamel Lapel Pins discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.spelling-u-pbSpellingcustom-pagespelling-pins-medalsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:28%,100:32%,500:42%"School Pins" "Spelling Pins and Medals" "Spelling Medals and Pins"Find Spelling pins at TrophyCentral. Each AP Series Spelling pin includes a clutch back.ap83Spelling11Order custom spelling medals with free ribbon - ideal for spelling bees, academic awards, and schools. Fast processing and bulk pricing at TrophyCentral.

Honor Spelling Excellence with Custom Medals

At TrophyCentral, our spelling medals are designed to recognize hard work, knowledge, and academic achievement. Whether you're organizing a spelling bee, honoring classroom excellence, or celebrating reading milestones, our medals make every achievement memorable.

Available in timeless styles - from classic antique gold frames to vibrant epoxy dome inserts - each medal comes complete with a free red-white-blue ribbon and optional engraving on the back. Choose from budget-friendly options or standout designs, all available at volume pricing for schools and districts.

Be sure to also find see our Spelling Trophies section and our spelling resource guides:

Frequently Asked Questions (FAQ)

📖 What types of spelling medals do you offer?

Our spelling bee medals come in gold, silver, and bronze finishes, perfect for recognizing top performers in school and regional spelling competitions. Many designs feature books, letters, and bees to celebrate academic excellence.

🏆 Can I customize my spelling bee medals?

Yes! We offer custom engraving on most spelling medals, allowing you to add student names, competition dates, or school names. This makes them a perfect keepsake for spelling champions.

🚚 How fast can I receive my spelling medals?

Most spelling medals ship within 1-2 business days. If you need them quickly, select expedited shipping at checkout to ensure they arrive before your spelling bee event.

]]>
custom-pagequickshiptrophies-spelling1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our spelling insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - SpellingSpellingcustom-pagereadingpinsap83br381spelling-pbspelling-u-pb3d-spelling1school-pins1Find a great selection of spelling pins discounted at TrophyCentral. Each spelling lapel pin features a clutch back for easy attachment to clothing.Shop for Spelling Pins with Confidence at TrophyCentral! If you are looking to buy spelling lapel pins online, look no further! TrophyCentral has a great selection of awards for your spelling bees that will fit any budget. Be sure see our spelling medals and spelling trophies. We have great customer service. Our experts in New York and Michigan have been providing suggestions and guidance since 1999!]]>quickshiptrophies-spelling spelling-medalscustom-pagequickshiptrophies-spelling1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Spelling single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - SpellingSpellingcustom-pagequickshiptrophies-spelling1trophies498551-311821.06TrophyCentraltrophies1Spellingcustom-pagequickshiptrophies-spelling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.05Quick TrophyTrophiesAcademic1:14%,10:18%Find Our Spelling Deluxe Platform Series Trophies Discounted at TrophyCentral. Real Marble Base; Free Personalization!qtspelldmSpellingcustom-pagequickshiptrophies-spelling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451014.85Quick TrophyTrophiesAcademic1:14%,10:18%,50:22%,100:25%Find this popular spelling bee figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!quickshipstrophies-spellingSpelling, 1st / 2nd / 3rd / Etc.custom-pagequickshiptrophies-spelling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesAcademic1:14%,10:18%,50:22%,100:25%This popular Spelling Bee Figure Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!qtspellyrSpellingcustom-pagetrophies-baseball1trophies498552-310.451614.05Trophy CentralTrophiesSports, Hobby, Org, Livestock1Baseball Spinner Trophy with Column. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Baseball / T-Ball, Sportscustom-pagetrophies-basketball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451614.05Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,50:28%Spinner Trophy with Column - Basketball. Ideal for leagues, schools, and tournaments. Fast shipping.qtbaskspscSee our other fabuloustrophies-basketballBasketball, Sportscustom-pagetrophies-football1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452417.25Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,50:31%Spinner Participation Trophies - Football. Ideal for leagues, schools, and tournaments. Fast shipping.qtfootspncFootball, Sportscustom-pagetrophies-football1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451614.05Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,50:28%Spinner Trophy with Column - Football. Ideal for leagues, schools, and tournaments. Fast shipping.qtfootspscFootball, Sportscustom-pagetrophies-baseball1trophies498552-310.552417.35Trophy CentralTrophiesSports, Hobby, Org, Livestock1Spinner Participation Baseball Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Baseball / T-Ball, Sportscustom-pagetrophies-basketball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.452417.25Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,50:31%Spinner Participation Trophy - Basketball. Ideal for leagues, schools, and tournaments. Fast shipping.qtbaskspncBasketball, Sportscustom-pagetrophies-soccer1trophies498552-310.452417.25Trophy CentralTrophiesSports, Hobby, Org, Livestock1Spinner Participation Trophy - Soccer. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.spinner-participation-trophies-soccer09-15-2022Soccer, Sportscustom-pagetrophies-soccer1trophies498552-310.451614.05Trophy CentralTrophiesSports, Hobby, Org, Livestock1Spinning Soccer Ball Trophy with Column - Unique Soccer Award. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.09-15-2022Soccer, Sportscustom-pagegeneral-corporate-awards1606307-101 3 235233RS Owens1The exuberant spirit of these awards are a synthesis of metal and crystal. Choose from silver or 24k gold on a black nickel base.custom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-gd-bk.13174mb-gd-grFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-gd-bk.3175mb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-gd-bk.13176mb-bz-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-bz-bk.3174mb-bz-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-bz-bk.3175mb-bz-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-bz-bk.3176mb-bz-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-sn-bk.3174mb-sn-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-sn-bk.3175mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-sn-bk.13176mb-bz-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-gd-bk.3174pb-gd-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-gd-bk.3175pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-gd-bk.13176mb-bz-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-bz-bk.3174pb-bz-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-bz-bk.3175pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-bz-bk.13176mb-bz-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-sn-bk.3174pb-sn-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-sn-bk.3175pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-sn-bk.13176mb-bz-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-gd-bk.3174wb-gd-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-gd-bk.3175wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-gd-bk.13176mb-bz-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-bz-bk.3174wb-bz-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-bz-bk.3175wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-bz-bk.13176mb-bz-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-sn-bk.3174wb-sn-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-sn-bk.3175wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-sn-bk.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-gd-bk.1374mb-bz-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-gd-bk.375mb-gd-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-gd-bk.376mb-gd-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-bz-bk.374mb-bz-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-bz-bk.375mb-bz-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-bz-bk.376mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-sn-bk.1374mb-bz-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-sn-bk.375mb-sn-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-sn-bk.376mb-sn-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-gd-bk.374pb-gd-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-gd-bk.375pb-gd-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-gd-bk.376pb-gd-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-bz-bk.374pb-bz-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-bz-bk.375pb-bz-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-bz-bk.376pb-bz-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-sn-bk.374pb-sn-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-sn-bk.375pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-sn-bk.1376pb-sn-grFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-gd-bk.374wb-gd-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-gd-bk.375wb-gd-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-gd-bk.376wb-gd-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-bz-bk.374wb-bz-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-bz-bk.375wb-bz-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-bz-bk.376wb-bz-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-sn-bk.374wb-sn-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-sn-bk.375wb-sn-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit black display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-sn-bk.376wb-sn-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-gd-gr.3174mb-gd-grFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-gd-gr.13175mb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-gd-gr.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-bz-gr.13174mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-bz-gr.13175mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-bz-gr.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-sn-gr.13174mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-sn-gr.13175mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-sn-gr.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-gd-gr.13174pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-gd-gr.13175pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-gd-gr.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-bz-gr.13174pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-bz-gr.13175pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-bz-gr.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-sn-gr.13174pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-sn-gr.13175pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-sn-gr.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-gd-gr.13174wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-gd-gr.13175wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-gd-gr.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-bz-gr.13174wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-bz-gr.13175wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-bz-gr.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-sn-gr.13174wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-sn-gr.13175wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-sn-gr.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-gd-gr.1374mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-gd-gr.1375mb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-gd-gr.1376mb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-bz-gr.1374mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-bz-gr.1375mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-bz-gr.1376mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-sn-gr.1374mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-sn-gr.1375mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-sn-gr.1376mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-gd-gr.1374pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-gd-gr.1375pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-gd-gr.1376pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-bz-gr.1374pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-bz-gr.1375pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-bz-gr.1376pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-sn-gr.1374pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-sn-gr.1375pb-sn-bkFloor-Standingcustom-pagetrophycases151display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-sn-gr.376pb-sn-grFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-gd-gr.1374wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-gd-gr.1375wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-gd-gr.1376wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-bz-gr.1374wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-bz-gr.1375wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-bz-gr.1376wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-sn-gr.1374wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-sn-gr.1375wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit goldenrod display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-sn-gr.1376wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-gd-kg.13174mb-gd-grFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-gd-kg.13175mb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-gd-kg.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-bz-kg.13174mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-bz-kg.13175mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-bz-kg.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-sn-kg.13174mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-sn-kg.13175mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-sn-kg.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-gd-kg.13174pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-gd-kg.13175pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-gd-kg.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-bz-kg.13174pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-bz-kg.13175pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-bz-kg.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-sn-kg.13174pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-sn-kg.13175pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-sn-kg.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-gd-kg.13174wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-gd-kg.13175wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-gd-kg.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-bz-kg.13174wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-bz-kg.13175wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-bz-kg.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-sn-kg.13174wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-sn-kg.13175wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-sn-kg.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-gd-kg.1374mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-gd-kg.1375mb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-gd-kg.1376mb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-bz-kg.1374mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-bz-kg.1375mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-bz-kg.1376mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-sn-kg.1374mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-sn-kg.1375mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-sn-kg.1376mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-gd-kg.1374pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-gd-kg.1375pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-gd-kg.1376pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-bz-kg.1374pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-bz-kg.1375pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-bz-kg.1376pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-sn-kg.1374pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-sn-kg.1375pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-sn-kg.1376pb-sn-grFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-gd-kg.1374wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-gd-kg.1375wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-gd-kg.1376wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-bz-kg.1374wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-bz-kg.1375wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-bz-kg.1376wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-sn-kg.1374wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-sn-kg.1375wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit kelly green display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-sn-kg.1376wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-gd-mn.13174mb-gd-grFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-gd-mn.13175mb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-gd-mn.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-bz-mn.13174mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-bz-mn.13175mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-bz-mn.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-sn-mn.13174mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-sn-mn.13175mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-sn-mn.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-gd-mn.13174pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-gd-mn.13175pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-gd-mn.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-bz-mn.13174pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-bz-mn.13175pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-bz-mn.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-sn-mn.13174pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-sn-mn.13175pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-sn-mn.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-gd-mn.13174wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-gd-mn.13175wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-gd-mn.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-bz-mn.13174wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-bz-mn.13175wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-bz-mn.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-sn-mn.13174wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-sn-mn.13175wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-sn-mn.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-gd-mn.1374mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-gd-mn.1375mb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-gd-mn.1376mb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-bz-mn.1374mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-bz-mn.1375mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-bz-mn.1376mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-sn-mn.1374mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-sn-mn.1375mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-sn-mn.1376mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-gd-mn.1374pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-gd-mn.1375pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-gd-mn.1376pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-bz-mn.1374pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-bz-mn.1375pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-bz-mn.1376pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-sn-mn.1374pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-sn-mn.1375pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-sn-mn.1376pb-sn-grFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-gd-mn.1374wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-gd-mn.1375wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-gd-mn.1376wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D . Model: 374wb-bz-mn.1374wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-bz-mn.1375wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-bz-mn.1376wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-sn-mn.1374wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-sn-mn.1375wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit maroon display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-sn-mn.1376wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-gd-ny.13174mb-gd-grFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-gd-ny.13175mb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-gd-ny.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-bz-ny.13174mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-bz-ny.13175mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-bz-ny.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-sn-ny.13174mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-sn-ny.13175mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-sn-ny.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-gd-ny.13174pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-gd-ny.13175pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-gd-ny.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-bz-ny.13174pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-bz-ny.13175pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-bz-ny.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-sn-ny.13174pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-sn-ny.13175pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-sn-ny.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-gd-ny.13174wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-gd-ny.13175wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-gd-ny.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-bz-ny.13174wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-bz-ny.13175wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-bz-ny.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-sn-ny.13174wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-sn-ny.13175wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-sn-ny.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-gd-ny.1374mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-gd-ny.1375mb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-gd-ny.1376mb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-bz-ny.1374mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-bz-ny.1375mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-bz-ny.1376mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-sn-ny.1374mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-sn-ny.1375mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-sn-ny.1376mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-gd-ny.1374pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-gd-ny.1375pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-gd-ny.1376pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-bz-ny.1374pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-bz-ny.1375pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-bz-ny.1376pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-sn-ny.1374pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-sn-ny.1375pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-sn-ny.1376pb-sn-grFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-gd-ny.1374wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-gd-ny.1375wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-gd-ny.1376wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-bz-ny.1374wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-bz-ny.1375wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-bz-ny.1376wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-sn-ny.1374wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-sn-ny.1375wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit navy display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-sn-ny.1376wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-gd-or.13174mb-gd-grFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-gd-or.13175mb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-gd-or.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-bz-or.13174mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-bz-or.13175mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-bz-or.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-sn-or.13174mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-sn-or.13175mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-sn-or.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-gd-or.13174pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-gd-or.13175pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-gd-or.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-bz-or.13174pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-bz-or.13175pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-bz-or.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-sn-or.13174pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-sn-or.13175pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-sn-or.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-gd-or.13174wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-gd-or.13175wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-gd-or.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-bz-or.13174wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-bz-or.13175wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-bz-or.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-sn-or.13174wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-sn-or.13175wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-sn-or.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-gd-or.1374mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-gd-or.1375mb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-gd-or.1376mb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-bz-or.1374mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-bz-or.1375mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-bz-or.1376mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-sn-or.1374mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-sn-or.1375mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-sn-or.1376mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-gd-or.1374pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-gd-or.1375pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-gd-or.1376pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-bz-or.1374pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-bz-or.1375pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-bz-or.1376pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-sn-or.1374pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-sn-or.1375pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-sn-or.1376pb-sn-grFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-gd-or.1374wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-gd-or.1375wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-gd-or.1376wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-bz-or.1374wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-bz-or.1375wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-bz-or.1376wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-sn-or.1374wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-sn-or.1375wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit orange display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-sn-or.1376wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-gd-pe.13174mb-gd-grFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-gd-pe.13175mb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-gd-pe.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-bz-pe.13174mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-bz-pe.13175mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-bz-pe.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-sn-pe.13174mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-sn-pe.13175mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-sn-pe.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-gd-pe.13174pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-gd-pe.13175pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-gd-pe.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-bz-pe.13174pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-bz-pe.13175pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-bz-pe.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-sn-pe.13174pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-sn-pe.13175pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-sn-pe.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-gd-pe.13174wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-gd-pe.13175wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-gd-pe.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-bz-pe.13174wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-bz-pe.13175wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-bz-pe.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-sn-pe.13174wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-sn-pe.13175wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-sn-pe.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-gd-pe.1374mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-gd-pe.1375mb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-gd-pe.1376mb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-bz-pe.1374mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-bz-pe.1375mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-bz-pe.1376mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-sn-pe.1374mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-sn-pe.1375mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-sn-pe.1376mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-gd-pe.1374pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-gd-pe.1375pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-gd-pe.1376pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-bz-pe.1374pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-bz-pe.1375pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-bz-pe.1376pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-sn-pe.1374pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-sn-pe.1375pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-sn-pe.1376pb-sn-grFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-gd-pe.1374wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-gd-pe.1375wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-gd-pe.1376wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-bz-pe.1374wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-bz-pe.1375wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-bz-pe.1376wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-sn-pe.1374wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-sn-pe.1375wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit purple display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-sn-pe.1376wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-gd-rd.13174mb-gd-grFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-gd-rd.13175mb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-gd-rd.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-bz-rd.13174mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-bz-rd.13175mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-bz-rd.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-sn-rd.13174mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-sn-rd.13175mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-sn-rd.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-gd-rd.13174pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-gd-rd.13175pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-gd-rd.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-bz-rd.13174pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-bz-rd.13175pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-bz-rd.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-sn-rd.13174pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-sn-rd.13175pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-sn-rd.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-gd-rd.13174wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-gd-rd.13175wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-gd-rd.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-bz-rd.13174wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-bz-rd.13175wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-bz-rd.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-sn-rd.13174wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-sn-rd.13175wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-sn-rd.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-gd-rd.1374mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-gd-rd.1375mb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-gd-rd.1376mb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-bz-rd.1374mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-bz-rd.1375mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-bz-rd.1376mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-sn-rd.1374mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-sn-rd.1375mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-sn-rd.1376mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-gd-rd.1374pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-gd-rd.1375pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-gd-rd.1376pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-bz-rd.1374pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-bz-rd.1375pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-bz-rd.1376pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-sn-rd.1374pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-sn-rd.1375pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-sn-rd.1376pb-sn-grFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-gd-rd.1374wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-gd-rd.1375wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-gd-rd.1376wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-bz-rd.1374wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-bz-rd.1375wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-bz-rd.1376wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-sn-rd.1374wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-sn-rd.1375wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit red display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-sn-rd.1376wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-gd-ry.13174mb-gd-grFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-gd-ry.13175mb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-gd-ry.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-bz-ry.13174mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-bz-ry.13175mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-bz-ry.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174mb-sn-ry.13174mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175mb-sn-ry.13175mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176mb-sn-ry.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-gd-ry.13174pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-gd-ry.13175pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-gd-ry.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-bz-ry.13174pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-bz-ry.13175pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-bz-ry.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174pb-sn-ry.13174pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175pb-sn-ry.13175pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176pb-sn-ry.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-gd-ry.13174wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-gd-ry.13175wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-gd-ry.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-bz-ry.13174wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-bz-ry.13175wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-bz-ry.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 48"W x 16"D. Model: 3174wb-sn-ry.13174wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 60"W x 16"D. Model: 3175wb-sn-ry.13175wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 80"H x 72"W x 16"D. Model: 3176wb-sn-ry.13176mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-gd-ry.1374mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-gd-ry.1375mb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-gd-ry.1376mb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-bz-ry.1374mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-bz-ry.1375mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-bz-ry.1376mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374mb-sn-ry.1374mb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375mb-sn-ry.1375mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376mb-sn-ry.1376mb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-gd-ry.1374pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-gd-ry.1375pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-gd-ry.1376pb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-bz-ry.1374pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-bz-ry.1375pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-bz-ry.1376pb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374pb-sn-ry.1374pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375pb-sn-ry.1375pb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376pb-sn-ry.1376pb-sn-grFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-gd-ry.1374wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-gd-ry.1375wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-gd-ry.1376wb-gd-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-bz-ry.1374wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-bz-ry.1375wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-bz-ry.1376wb-bz-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 48"W x 16"D. Model: 374wb-sn-ry.1374wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 60"W x 16"D. Model: 375wb-sn-ry.1375wb-sn-bkFloor-Standingcustom-pagetrophycases15145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Spirit royal blue display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 72"H x 72"W x 16"D. Model: 376wb-sn-ry.1376wb-sn-bkFloor-Standingcustom-pagedisplaycases13174mb-gd-rd3175mb-gd-rd3176mb-gd-rd374mb-gd-rd375mb-gd-rd376mb-gd-rd3174mb-gd-ny3175mb-gd-ny3176mb-gd-ny374mb-gd-ny375mb-gd-ny376mb-gd-ny3174mb-gd-bk3175mb-gd-bk3176mb-gd-bk374mb-gd-bk375mb-gd-bk376mb-gd-bk3174mb-gd-mn3174mb-gd-or3174mb-gd-pe3175mb-gd-mn3175mb-gd-or3175mb-gd-pe3176mb-gd-mn3176mb-gd-or3176mb-gd-pe374mb-gd-mn374mb-gd-or374mb-gd-pe375mb-gd-mn375mb-gd-or375mb-gd-pe376mb-gd-mn376mb-gd-or376mb-gd-pe3174mb-gd-gr3175mb-gd-gr3176mb-gd-gr374mb-gd-gr375mb-gd-gr376mb-gd-gr3174mb-gd-ry3175mb-gd-ry3176mb-gd-ry374mb-gd-ry375mb-gd-ry376mb-gd-ry3174mb-gd-kg3175mb-gd-kg3176mb-gd-kg374mb-gd-kg375mb-gd-kg376mb-gd-kg3174mb-bz-rd3175mb-bz-rd3176mb-bz-rd374mb-bz-rd375mb-bz-rd376mb-bz-rd3174mb-bz-ny3175mb-bz-ny3176mb-bz-ny374mb-bz-ny375mb-bz-ny376mb-bz-ny3174mb-bz-bk3175mb-bz-bk3176mb-bz-bk374mb-bz-bk375mb-bz-bk376mb-bz-bk3174mb-bz-mn3174mb-bz-or3174mb-bz-pe3175mb-bz-mn3175mb-bz-or3175mb-bz-pe3176mb-bz-mn3176mb-bz-or3176mb-bz-pe374mb-bz-mn374mb-bz-or374mb-bz-pe375mb-bz-mn375mb-bz-or375mb-bz-pe376mb-bz-mn376mb-bz-or376mb-bz-pe3174mb-bz-gr3175mb-bz-gr3176mb-bz-gr374mb-bz-gr375mb-bz-gr376mb-bz-gr3174mb-bz-ry3175mb-bz-ry3176mb-bz-ry374mb-bz-ry375mb-bz-ry376mb-bz-ry3174mb-bz-kg3175mb-bz-kg3176mb-bz-kg374mb-bz-kg375mb-bz-kg376mb-bz-kg3174mb-sn-rd3175mb-sn-rd3176mb-sn-rd374mb-sn-rd375mb-sn-rd376mb-sn-rd3174mb-sn-ny3175mb-sn-ny3176mb-sn-ny374mb-sn-ny375mb-sn-ny376mb-sn-ny3174mb-sn-bk3175mb-sn-bk3176mb-sn-bk374mb-sn-bk375mb-sn-bk376mb-sn-bk3174mb-sn-mn3174mb-sn-or3174mb-sn-pe3175mb-sn-mn3175mb-sn-or3175mb-sn-pe3176mb-sn-mn3176mb-sn-or3176mb-sn-pe374mb-sn-mn374mb-sn-or374mb-sn-pe375mb-sn-mn375mb-sn-or375mb-sn-pe376mb-sn-mn376mb-sn-or376mb-sn-pe3174mb-sn-gr3175mb-sn-gr3176mb-sn-gr374mb-sn-gr375mb-sn-gr376mb-sn-gr3174mb-sn-ry3175mb-sn-ry3176mb-sn-ry374mb-sn-ry375mb-sn-ry376mb-sn-ry3174mb-sn-kg3175mb-sn-kg3176mb-sn-kg374mb-sn-kg375mb-sn-kg376mb-sn-kg3174pb-gd-rd3175pb-gd-rd3176pb-gd-rd374pb-gd-rd375pb-gd-rd376pb-gd-rd3174pb-gd-ny3175pb-gd-ny3176pb-gd-ny374pb-gd-ny375pb-gd-ny376pb-gd-ny3174pb-gd-bk3175pb-gd-bk3176pb-gd-bk374pb-gd-bk375pb-gd-bk376pb-gd-bk3174pb-gd-mn3174pb-gd-or3174pb-gd-pe3175pb-gd-mn3175pb-gd-or3175pb-gd-pe3176pb-gd-mn3176pb-gd-or3176pb-gd-pe374pb-gd-mn374pb-gd-or374pb-gd-pe375pb-gd-mn375pb-gd-or375pb-gd-pe376pb-gd-mn376pb-gd-or376pb-gd-pe3174pb-gd-gr3175pb-gd-gr3176pb-gd-gr374pb-gd-gr375pb-gd-gr376pb-gd-gr3174pb-gd-ry3175pb-gd-ry3176pb-gd-ry374pb-gd-ry375pb-gd-ry376pb-gd-ry3174pb-gd-kg3175pb-gd-kg3176pb-gd-kg374pb-gd-kg375pb-gd-kg376pb-gd-kg3174pb-bz-rd3175pb-bz-rd3176pb-bz-rd374pb-bz-rd375pb-bz-rd376pb-bz-rd3174pb-bz-ny3175pb-bz-ny3176pb-bz-ny374pb-bz-ny375pb-bz-ny376pb-bz-ny3174pb-bz-bk3175pb-bz-bk3176pb-bz-bk374pb-bz-bk375pb-bz-bk376pb-bz-bk3174pb-bz-mn3174pb-bz-or3174pb-bz-pe3175pb-bz-mn3175pb-bz-or3175pb-bz-pe3176pb-bz-mn3176pb-bz-or3176pb-bz-pe374pb-bz-mn374pb-bz-or374pb-bz-pe375pb-bz-mn375pb-bz-or375pb-bz-pe376pb-bz-mn376pb-bz-or376pb-bz-pe3174pb-bz-gr3175pb-bz-gr3176pb-bz-gr374pb-bz-gr375pb-bz-gr376pb-bz-gr3174pb-bz-ry3175pb-bz-ry3176pb-bz-ry374pb-bz-ry375pb-bz-ry376pb-bz-ry3174pb-bz-kg3175pb-bz-kg3176pb-bz-kg374pb-bz-kg375pb-bz-kg376pb-bz-kg3174pb-sn-rd3175pb-sn-rd3176pb-sn-rd374pb-sn-rd375pb-sn-rd376pb-sn-rd3174pb-sn-ny3175pb-sn-ny3176pb-sn-ny374pb-sn-ny375pb-sn-ny376pb-sn-ny3174pb-sn-bk3175pb-sn-bk3176pb-sn-bk374pb-sn-bk375pb-sn-bk376pb-sn-bk3174pb-sn-mn3174pb-sn-or3174pb-sn-pe3175pb-sn-mn3175pb-sn-or3175pb-sn-pe3176pb-sn-mn3176pb-sn-or3176pb-sn-pe374pb-sn-mn374pb-sn-or374pb-sn-pe375pb-sn-mn375pb-sn-or375pb-sn-pe376pb-sn-mn376pb-sn-or376pb-sn-pe3174pb-sn-gr3175pb-sn-gr3176pb-sn-gr374pb-sn-gr375pb-sn-gr376pb-sn-gr3174pb-sn-ry3175pb-sn-ry3176pb-sn-ry374pb-sn-ry375pb-sn-ry376pb-sn-ry3174pb-sn-kg3175pb-sn-kg3176pb-sn-kg374pb-sn-kg375pb-sn-kg376pb-sn-kg3174wb-gd-rd3175wb-gd-rd3176wb-gd-rd374wb-gd-rd375wb-gd-rd376wb-gd-rd3174wb-gd-ny3175wb-gd-ny3176wb-gd-ny374wb-gd-ny375wb-gd-ny376wb-gd-ny3174wb-gd-bk3175wb-gd-bk3176wb-gd-bk374wb-gd-bk375wb-gd-bk376wb-gd-bk3174wb-gd-mn3174wb-gd-or3174wb-gd-pe3175wb-gd-mn3175wb-gd-or3175wb-gd-pe3176wb-gd-mn3176wb-gd-or3176wb-gd-pe374wb-gd-mn374wb-gd-or374wb-gd-pe375wb-gd-mn375wb-gd-or375wb-gd-pe376wb-gd-mn376wb-gd-or376wb-gd-pe3174wb-gd-gr3175wb-gd-gr3176wb-gd-gr374wb-gd-gr375wb-gd-gr376wb-gd-gr3174wb-gd-ry3175wb-gd-ry3176wb-gd-ry374wb-gd-ry375wb-gd-ry376wb-gd-ry3174wb-gd-kg3175wb-gd-kg3176wb-gd-kg374wb-gd-kg375wb-gd-kg376wb-gd-kg3174wb-bz-rd3175wb-bz-rd3176wb-bz-rd374wb-bz-rd375wb-bz-rd376wb-bz-rd3174wb-bz-ny3175wb-bz-ny3176wb-bz-ny374wb-bz-ny375wb-bz-ny376wb-bz-ny3174wb-bz-bk3175wb-bz-bk3176wb-bz-bk374wb-bz-bk375wb-bz-bk376wb-bz-bk3174wb-bz-mn3174wb-bz-or3174wb-bz-pe3175wb-bz-mn3175wb-bz-or3175wb-bz-pe3176wb-bz-mn3176wb-bz-or3176wb-bz-pe374wb-bz-mn374wb-bz-or374wb-bz-pe375wb-bz-mn375wb-bz-or375wb-bz-pe376wb-bz-mn376wb-bz-or376wb-bz-pe3174wb-bz-gr3175wb-bz-gr3176wb-bz-gr374wb-bz-gr375wb-bz-gr376wb-bz-gr3174wb-bz-ry3175wb-bz-ry3176wb-bz-ry374wb-bz-ry375wb-bz-ry376wb-bz-ry3174wb-bz-kg3175wb-bz-kg3176wb-bz-kg374wb-bz-kg375wb-bz-kg376wb-bz-kg3174wb-sn-rd3175wb-sn-rd3176wb-sn-rd374wb-sn-rd375wb-sn-rd376wb-sn-rd3174wb-sn-ny3175wb-sn-ny3176wb-sn-ny374wb-sn-ny375wb-sn-ny376wb-sn-ny3174wb-sn-bk3175wb-sn-bk3176wb-sn-bk374wb-sn-bk375wb-sn-bk376wb-sn-bk3174wb-sn-mn3174wb-sn-or3174wb-sn-pe3175wb-sn-mn3175wb-sn-or3175wb-sn-pe3176wb-sn-mn3176wb-sn-or3176wb-sn-pe374wb-sn-mn374wb-sn-or374wb-sn-pe375wb-sn-mn375wb-sn-or375wb-sn-pe376wb-sn-mn376wb-sn-or376wb-sn-pe3174wb-sn-gr3175wb-sn-gr3176wb-sn-gr374wb-sn-gr375wb-sn-gr376wb-sn-gr3174wb-sn-ry3175wb-sn-ry3176wb-sn-ry374wb-sn-ry375wb-sn-ry376wb-sn-ry3174wb-sn-kg3175wb-sn-kg3176wb-sn-kg374wb-sn-kg375wb-sn-kg376wb-sn-kg11 2 3 4 5 6 7 8 9 10 221Find Spirit Series Display Cases at TrophyCentral. Also see our great selection of engraved and personalized gifts!displaycases1floor-standing-edge floor-standing-colossuscustom-pagehigh-end-awards1"14 business days" "Erlanger, KY" "UPS"general410187-1010.451 2 3 4 5 6 7 8 9642.45JcharlesGeneral Awards1:22%,25:25%Find the Spiro Composition Award Discounted at TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.noindexed-items12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
498555-8.521
custom-pageappreciation-templates1"Download Only"free-academic49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Sponsorship Award template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Sponsorship-Award-Certificatesponsorship-award-freeSponsorship, Thank Youcustom-pageinsertplaquesqsinplaq1stqsinplaq2ndqsinplaq3dbaseballqsinplaq3dbasketballqsinplaq3dbowlingqsinplaq3dfootballqsinplaq3dsoccerqsinplaq3dsoftballqsinplaq3rdqsinplaqacqsinplaqacstarqsinplaqarcheryqsinplaqbaseballqsinplaqbasketballqsinplaqbassfishqsinplaqbmxqsinplaqbowlingqsinplaqcheerleadingqsinplaqcoachqsinplaqdartsqsinplaqfootballqsinplaqgolfqsinplaqhockeyqsinplaqkartqsinplaqmotocrossqsinplaqmusicqsinplaqpinewoodqsinplaqsoccerqsinplaqstockcarqsinplaqswimmingqsinplaqtennisqsinplaqtrackqsinplaqvictoryqsinplaqvolleyball11Find Sports Plaques Discounted at TrophyCentral. Each Holographic Sports Plaque Features Free Engraving. Fast shipping!custom-pagetrophy-award-guidesfun-guide-to-goat-awardsgolf-award-resources-twofootball-guideguide-county-fair-awardsmusic-guide-vocalbest-golf-destinationscomplete-guide-to-cooking-competitionscomplete-guide-to-baseball-awardsgolf-tournament-planning-guidecheerleading-guidetennis-award-resource-guidegolf-resource-guidefantasy-football-guidepickleball-resource-guidecoach-resources-guidesoccer-trophy-guidecar-show-awards-guidephotography-awards-guidefun-event-guideyouth-sports-parent-guidesafe-sports-dayskeet-shooting-guidemarathon-pacing-mistakes-hitting-the-wallrunning-music-playlist-training-tips1trophy-award-guides1Explore our extensive selection of sports and hobby recognition resource guides. Get detailed guidance and advice on recognition from the experts.custom-pagesports-award-hub103210331034103510361037103810391041104270199191certificates"1-3 business days" "Columbia, South Carolina; Marquette, Michigan" "UPS (FedEx available on request)"1"Quick-Ship Items" "Award Certificates and Diploma Covers" "Award Certificates and Diploma Holders" "Award Certificates and Diploma Frames" "Award Certificate and Diploma Holders" "Certificate and Diploma Holders" "Certificates and Frames" "Certificates and Diploma Holders" "Diploma Covers and Certificates" "Diploma Covers and Award Certificates" "Diploma Covers, Frames and Holders" "Diploma Covers, Frames, Holders and Certificates"Find sports award certificates discounted at TrophyCentral. Prove you're the MVP with a TrophyCentral's sports certificate. Titles include: baseball, football, soccer and more!

Printed Sports Certificates & Templates

This section includes a fabulous selection of high-quality, sports certificate templates. Each sports certificate measures a standard 11" x 8 1/2", is printed on 60 lb. paper and includes a place to write or print the athlete's name, event, date and more.

Shop with Ease at TrophyCentral!

If you are looking to buy online, look no further! TrophyCentral has a great selection that will fit any budget. Our top-rated representatives are happy to assist you with all of your sports and school certificate and award needs. Our experts in New York and Michigan have been providing suggestions and guidance since 1999!

]]>
custom-pagetrophies-football11"7-10 business days w/engraving" "Chicago, Illinois" "UPS (FedEx available on request)"trophies606307-101 3 230.45218.25RS Owens1:22%11Complete selection of sports awards, medals, and trophies for teams and leagues. Custom engraving. Perfect for championships, tournaments, and participation recognition.

Awards for Every Sport & Every Achievement

Whether you're recognizing championship victories, individual excellence, or team participation, our sports awards collection provides the perfect way to celebrate athletic achievement. We understand that every sport has its unique culture and traditions, which is why we offer specialized awards for dozens of activities - from traditional team sports to individual competitions.

Every sports award includes free personalization with team names, player names, dates, and achievements. Our experienced team works with coaches, league organizers, and tournament directors to provide bulk pricing, rush delivery, and custom design services. With over [X years] of experience in sports recognition, we help make your awards ceremony memorable and meaningful.

Why Choose Our Sports Awards?

  • Complete Selection: Trophies, medals, plaques, and ribbons for 50+ sports
  • Quality Guaranteed: Durable construction and professional craftsmanship
  • Free Engraving: Personalize every award at no additional cost
  • Fast Delivery: Rush options available for last-minute tournaments
  • Bulk Pricing: Special rates for teams, leagues, and large orders
  • Expert Support: Award specialists to help with selection and customization

Don't see your sport listed? We carry awards for virtually every athletic activity. Contact our awards team for personalized recommendations, or explore our Academic Awards for scholastic recognition.

Ready to honor your athletes? Browse our sports awards collection and create lasting memories that celebrate dedication, teamwork, and achievement. Every champion deserves recognition - let us help you provide it.

If you need more information before deciding, see our expert resource section: ]]>
11Check out this great infographic relating to sports awards. Add some fun to your next awards ceremony by sharing these fun facts and trivia.custom-pageinserts150668149783350458150432151608850739849320150151502471495291498111507413502711507591507401504215060115065715182575014715013614896015066714930115020805059415012615074155013915113415063615063715066615024515182205011615071295047815074065074005070375075015181895181794898535173345176685049215048915016915074115074105036315060415044315038615014315020415075575176544896565056315073924976495061715020795065015022915034149314150719250281150207450752350662150153497658489678507464507390507453506945502031489612498170492691507396507174489690501425066514928715073974929915176605046015056915023715060715067315062015066415057515065015069734928414896895018314976615075195072015021085021105019715075355017114898245015250259151840450744050429150663150255149766548971350718350428150308150706048964550706950741250419150419150389149323150321150441149322148963449765950739150453148962350740549819150729650264111Browse our huge selection of sports inserts - 2" discs that can be used to create unique insert medals, trophies and plaques.sports-pins1award-medals1
  • Sports Awards Resource Hub
  • Engraving FAQs
  • Planning Award Ceremonies That People Actually Remember
  • Medal Buying Guide
  • ]]>
    custom-pagegold-pins-lapelgold-starsrising-star-pbbaseballpinsbasketballlapelpinscheerleadingpinsgolfpinsmascotpinspickleball-u-pbsoccerpinsswimmingpinstennis-u-pbtrackpinsvolleyballpinssoftball-pinscl20ec28rdec22ec90ec12ec11ec70ec69cl50cl51cl54cl47cl87cl951lapel-award-pins1Our sports pins are sure to get some attention. Each sports pin is discounted and features a clutch back for easy attachment to clothing.Letter and Jacket Sports Pins The section above includes our large selection of gold finish and color letter pins, in many popular sports, perfect for JV and Varsity jackets. In addition to traditional sports pins, like baseball, soccer and football, we also have a wide variety of sports related pins, like MVP, All Star, Champs, Coach and many more. These are high-quality gold and color finish pins that feature a clutch-pin back for easy and safe attachment to clothing. Stock sports lapel pins are quick-ship items and leave the factory in just 1-2 business days and often the same day.

    Shop with Confidence at TrophyCentral!

    If you are looking to buy sports pins online, look no further! TrophyCentral has a great selection that will fit any budget. Our top-rated representatives are happy to assist you with all of your needs. Our experts in New York and Michigan have been providing suggestions and guidance since 1999!]]>
    qsinplaqarcheryqsinplaqbaseballqsinplaq3dbaseballqsinplaqbasketballqsinplaq3dbasketballqsinplaqbmxqsinplaqbowlingqsinplaq3dbowlingqsinplaqcheerleadingqsinplaqcoachqsinplaqdartsqsinplaqbassfishqsinplaqfootballqsinplaq3dfootballqsinplaqgolfqsinplaqkartqsinplaqmotocrossqsinplaqpinewoodqsinplaqsoccerqsinplaq3dsoccerqsinplaq3dsoftballqsinplaqstockcarqsinplaqswimmingqsinplaqtennisqsinplaqtrackqsinplaqvictoryqsinplaqvolleyballqsinplaqhockeyqsinplaq1stqsinplaq2ndqsinplaq3rd11Find Sports Plaques Discounted at TrophyCentral. Each Sports Plaque Includes a 4" Insert and Free Engraving. Fast 1-2 day shipping.Colorful Holographic Sports Emblem Plaques These handsome looking plaques feature colorful 2" inserts in a variety of sports designs. Each plaque includes free engraving. Use our industry-leading engraving wizard to format your text, or leave it to the Experts at TrophyCentral! Don't hesitate to call us if you have any questions. Our customer service experts will be thrilled to assist you. TrophyCentral has been delivering smiles since 1999!]]>sports-award-hubtrophies-archerytrophies-badmintontrophies-baseballtrophies-basketballtrophies-bicycle-cyclingtrophies-billiardstrophies-bmxtrophies-bocce-balltrophies-bowlingtrophies-boxingtrophies-cheerleading-spirittrophies-coachtrophies-crickettrophies-curlingtrophies-dartstrophies-disc-golftrophies-equestrian-horsetrophies-figure-skatingtrophies-bass-fishingtrophies-marlin-fishingtrophies-footballtrophies-go-karttrophies-hockey-goalietrophies-golftrophies-gymnasticstrophies-ice-hockeytrophies-golf-hole-in-onetrophies-karate-martial-artstrophies-lacrossetrophies-marksman-shooting-rifletrophies-mascottrophies-motocrosstrophies-paintballracing-trophies-awardstrophies-racquetballtrophies-roller-hockeyrunning-trophiestrophies-sailing-boattrophies-skateboardingtrophies-cross-country-skiingtrophies-downhill-skiingtrophies-snowboardingtrophies-snowmobiletrophies-soccertrophies-softballtrophies-swimming-divingtrophies-t-balltrophies-table-tennis-ping-pongtrophies-tennistorch-trophiestrophies-track-fieldtrophies-trap-skeet-shootingtrophies-volleyballtrophies-weightlifting-powertrophies-wrestlingquickshiptrophies-goatresin-trophiestr-resin-trophies1trophies1Shop quality sports trophies and awards for all sports and age groups. Find custom designs, fast shipping, and unbeatable value at TrophyCentral.Sports Awards Resource Hub. There you will find expert guides on a variety of award recognition topics, including: ]]>custom-pageblog-trophycentral11Award ideas for spring youth baseball, softball, and T-ball leagues covering MVP, batting, pitching, sportsmanship, and participation. Budget tips for coaches and league organizers.custom-pageblog-trophycentral11Go beyond the blue ribbon with creative spring festival award ideas. Celebrate every participant with trophies, perpetual plaques, and volunteer recognition that build lasting traditions.custom-pagegift-certificate-templates1"Download Only"certificates4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Gift Certificate template (design 1) is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.gift-certificate-design-1gift-certificate-a1Gift Certificatecustom-pageblog-trophycentral11Build an end-of-season track and field awards program that honors every runner, jumper, and thrower on your roster. Award ideas for sprints, distance, hurdles, field events, relays, and special recognition categories.custom-pageengraved-frames1"3-4 business days" "Medina, MN" "UPS"personalized gifts553404-70.51832.9JDSGiftsEngraved Frames1:22%Springtime Celebration Frames from TrophyCentral. Also see our great selection of engraved and personalized gifts!gc744Engraved Framescustom-pagename-badges-tagswoyoulipr100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Square Badges Discounted At TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.namebadges-sqrcustom-pagedancemedals12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    medals105502-41130025Classic MedallicsInsertsMusic, Drama, Art, Dance1:22%"Award Medals" "Art / Dance / Drama Medals" "Award Medals - All Subjects" "Dance Awards"Buy these quality Square Dance Inserts (Litho) at TrophyCentral. Each Square Dance Insert can be used to create a unique plaque, medal or trophy.502611Dance
    custom-pagegeneral-corporate-awards1"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"458221512.0212.00Vision AwardsTrophies1:22%,26:41%Find this fabulous Cosmic World Award discounted at TrophyCentral. TrophyCentral is known for its top-rated customer service191custom-pagegeneral-corporate-awards1"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"4582215111 2 3 4 5 6 7 8 9622Vision AwardsTrophies11:22%,26:41%"Corporate Awards"custom-pagegroomsmengifts11personalized gifts105503-610.4513620.25Classic MedallicsGiftsGeneral Gifts1:22%Find this Stainless Steel Tankard at TrophyCentral. Add Engraving to the Tankard for a Special Touch!Groomsmencustom-pagesoccerwaterbottles7107071084710797107623088230852308423077230325608856085560845603256077113841137011376113794107041076410844107911Find stainless steel water bottles discounted at TrophyCentral. Each stainless sports water bottle is personalized with your logo or artwork.

    Shop For Stainless Water Bottles With Confidence at TrophyCentral

    We offer a huge selection, discounted prices and great customer service. Do you need help with some ideas or with ordering? Yes, we sell online, but we have real people who would love to help you! Feel free to call our customer service experts in Michigan, New York and online. TrophyCentral - delivering smiles since 1999!


    ]]>
    custom-pagegifts-desk-general11personalized gifts105503-610.4511219.65Classic MedallicsGiftsEngraved Gifts1:30%Shop for Stainless Steel Wine Cooler from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.12-20-2020Engraved Giftscustom-pagephotoplaques11"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498552-310.451020.45TrophyCentral1:22%Engraved Gifts, Coachcustom-pagetrophy-award-guidesbest-moment-capturedstandout-coachshare-your-best-thank-you11The TrophyCentral Standout Awards honor coaches, teachers, neighbors, and photographers who make a difference every day. Submit a photo, nominate someone, or vote for your favorite. Winners receive a real engraved trophy.custom-pagestandout-awards11Know a coach who changed someone's life? Nominate them for the TrophyCentral Standout Coach Award. Community nominated, judge scored, and the winner receives a real engraved trophy. Nominations open now.1custom-pagestar-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsGeneral1:30%,50:34%,100:38%"Star Pins" "Star Lapel Pins" "Star Award Pins"br28011-15-2010Star, Generalcustom-pagestar-trophies11"7-10 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498553-510.4548.45RS OwensTrophies1:22%"Star Award" "Achievement Award" "Achievement Awards" "Graduation Award" "Music Awards" "Drama Awards" "General Recognition Awards" "Art Awards" "Star Awards" "Leadership Recognition" "Drama Trophies" "Drama Trophy"Star Achievement Award: Visit TrophyCentral to see this and similar Trophies and AwardsDrama, Starcustom-pageacrylicawards11"1-2 business days" "Marquette, MI" "UPS"general498852-310.451021.45Quick TrophyCrystal Awards1:14%"New Products"The star achiever award features a brilliant gold star. 6 1/2" tall black acrylic on gold base. Includes 3 lines of engraving.12-20-2020Generalcustom-pagestar-trophies11trophies105503-611.51823.9Classic MedallicsTrophiesGeneral1:22%,20:29%Find Our Star Blazer Trophy Discounted at TrophyCentral. Features a Black Stone Finish. Free Engraving!05-15-2017custom-pagetrophies-drama1trophies498552-312421.33TrophiesMusic, Drama, Art, Dance1Find these star performer budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqt-star-p-scbDrama, Dance, Schoolcustom-pagestar-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsGeneral1:30%,50:34%,100:38%"Star Pins" "Star Lapel Pins" "Star Award Pins"Find these 3/8 inch star pins discounted at TrophyCentral. Each lapel pin features a quality clutch back. Large quantity discounts available.br290Star, Generalcustom-pagestar-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsGeneral1:30%,50:34%,100:38%"Star Pins" "Star Lapel Pins" "Star Award Pins"Find these 5/8 inch star pins discounted at TrophyCentral. Each lapel pin features a quality clutch back. Large quantity discounts available.br291Star, Generalcustom-pageblank-medals10medals498552-40.525033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%This medal features a a unique star frame and a personalized front for your logo or artwork.Starz9231e9231ir26star-performer-jigfstar-performer-jisfstar-performer-jibfstar-performer-mcstar-performer-mc-prrising-star-jigfrising-star-jisfrising-star-jibfrising-star-mcrising-star-mc-pr1achievement-medals1Find star medals discounted at TrophyCentral. Each star medal includes a free neck ribbon. Fast 1-2 day shipping.custom-pagereligioustrophies1plaques498552-41JDSPlaques1Find this Star of David plaque discounted at TrophyCentral. Our Star of David plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Religiouscustom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsGeneral1:22%Buy these high-quality Star Of Excellence Inserts at TrophyCentral. Each Star Of Excellence Insert can be used to create a unique plaque, medal or trophy.518645General, Star
    custom-pagestar-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:34%,100:39%,500:43%"Star Pins" "Star Lapel Pins" "Star Award Pins"Find these Star of Excellence pins at TrophyCentral. Each Star of Excellence lapel pin features a quality finish and clutch back.br54803-20-2011General, Starcustom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsGeneral1:22%Buy these quality Star Performer (498150) Inserts (Litho) at TrophyCentral. Each Star Performer (498150) Insert can be used to create a unique plaque, medal or trophy.498150General, Star
    custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsGeneral1:22%Buy these quality Star Performer (507574) Inserts (Litho) at TrophyCentral. Each Star Performer (507574) Insert can be used to create a unique plaque, medal or trophy.507574General
    custom-pagestar-trophies20medals498551-30.5100021TrophyCentralInsertsSports, Hobby, Org, Livestock1Find these colorful Star Performer 2" Epoxy-covered inserts discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Starcustom-pagetrophies-drama1498552-313633.4TrophiesMusic, Drama, Art, Dance1Find this budget star performer award trophy discounted at Trophy Central. Features a real marble base and plastic figure. Engraving is free. Fast 1-2 day shipping.1star-trophiesDrama, Dance, Schoolcustom-pagetrophies-drama1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy star-performer column insert trophy features a choice of column color, a marble base and free trophy engraving.Starcustom-pagestar-trophies1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Star Performer Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Starcustom-pagestar-trophies1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Star Performer Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Starcustom-pagestar-trophies1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Star Performer Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Starcustom-pagestar-trophies1medals498551-30.525035.5TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these colorful Star Performer insert medals discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Starcustom-pagestar-trophies1medals498551-30.525035.5TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Star Performer insert medals with a personalized front rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Starcustom-pagestar-trophies1plaques498551-311.11623.5TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these star performer insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Starcustom-pagestar-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsBusiness1:30%,50:32%,100:35%,500:39%"Star Awards" "Star Award"Find these Star Performer Pins discounted at TrophyCentral. Each Star Performer Lapel pin features a clutch-back. Be sure to browse all of our drama and music pins!br278General, Starcustom-pagestar-trophies12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    medals105503-60.75130033.75Classic Medallicsaward-medalsGeneral1:22%,100:28%,500:34%,1000:45%"Dance Medals" "Star Award" "General Award Medals" "Award Medals - All Subjects" "School Medals" "Music Awards" "General Recognition Awards" "Drama Awards" "Art Awards" "Art / Dance / Drama Medals" "Star Awards"These inexpensive 1 1/4 inch Star Performer Medals offer a high quality, but low price for those on a tight budget.e923110-01-2008General, Business, Academic
    custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsGeneral1:22%Buy these high-quality Star Performer Inserts (Etched, 517786) at TrophyCentral. Each Star Performer Inserts (Etched, 517786) can be used to create a unique plaque, medal or trophy.517786General, Star
    custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsGeneral1:22%Buy these high-quality Star Performer Inserts (Etched, 518367) at TrophyCentral. Each Star Performer Inserts (Etched, 518367) can be used to create a unique plaque, medal or trophy.518367General, Business
    custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-40.3713003.37Classic MedallicsInsertsGeneral1:22%Buy these quality Mylar Star Performer Decal Inserts at TrophyCentral. Each Star Performer Decal can be used to create a unique plaque, medal or trophy.489724Star
    custom-pagetrophies-drama1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our star-performer insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Starcustom-pagetrophies-drama1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy star-performer insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Starcustom-pagetrophies-drama1trophies498552-313633.4TrophiesMusic, Drama, Art, Dance1Our star performer participation trophies feature a real slant-front white marble base and free personalization. Significant quantity discounts available. Fast 1-2 shipping.mqt-star-p-ncDrama, Dance, Schoolcustom-pagekeychains21105502-40.39125035.39Classic MedallicsGiftsKeychains1:22%,10:25%,25:32%,50:39%,100:47%"Star Awards" "Star Award"Find these popular Pewter Star Performer Key Chains at TrophyCentral; discounted prices!pk88-cmKeychainscustom-pagesports-pinsplasticpinboxvelapinbox10star-pins"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsGeneral1:22%,50:30%,100:33%,500:47%"Star Awards" "Dance Awards" "Star Award" "Dance Pins" "Dance Lapel Pins" "Drama Pins"Star Performer Letter Pins: EC Series Star Performer Lapel Pins feature a high-quality enameled finish and ship in just 1-2 business days!ec69Dramacustom-pagestar-pinsplasticpinboxvelapinbox5"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsBusiness1:30%,50:32%,100:35%,500:39%"Star Awards" "Star Award"Find these Star Performer pins discounted at TrophyCentral. Each Star Performer lapel pin features a gold finish and clutch-back.br36803-06-2008Star, Generalcustom-pagestar-pinsplasticpinboxvelapinbox1"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsGeneral1:30%,50:34%,100:38%"Dance Awards" "Dance Pins" "Dance Lapel Pins" "Drama Pins"Find these 7/8" star performer pins discounted at TrophyCentral. Each star performer pin features a clutch-back and fast 1-2 day shipping!br412Star, Generalcustom-pagetrophies-drama1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Star Performer single column insert trophy features a choice of column color, a marble base and free trophy engraving.Starcustom-pagetrophies-drama1trophies498552-311622.85TrophiesMusic, Drama, Art, Dance1Find this popular star performer figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!mqt-star-p-plDrama, Dance, Schoolcustom-pagegold-pins-lapelsilver-starsbronze-starsbr280br583ec11ec12br592bbr592s1lapel-award-pins1Why Star Pins are a Powerful Recognition Tool Star pins are a simple yet highly effective way to recognize achievement and encourage positive behavior. Their small size makes them easy to wear and display, allowing recipients to feel proud of their accomplishment throughout the day. Unlike one-time rewards, star pins create ongoing visibility, reinforcing motivation each time they are seen by peers, teachers, or coworkers. They are also one of the most cost-effective recognition options available, making it easy to reward individuals frequently without stretching budgets. Whether used in classrooms, workplaces, or community programs, star pins provide a consistent and meaningful way to celebrate progress, effort, and success.

    Star Pins for Student and Employee Recognition

    If you are looking for quality star pins at a great price, you have come to the right place. Our star lapel pins and gold star pins come in many shapes, styles and sizes, with most orders shipping in just 1-2 business days (some stars even ship the same day).

    Our star lapel pins are a perfect way to recognize a special student achievement, such as completing homework assignments or doing well in a certain subject. These pins are also appropriate for athletics, military, and corporate recognition, for example, "the employee of the month".

    Many star pins are available in gold, silver, and bronze, so you can recognize different achievement levels. Be sure to see our popular raised stars, flat stars, rising stars, and star performer pins. What is our most popular star? The traditional gold star pin, of course.

    Shop With Confidence at Trophy Central

    If you are looking to buy star pins online, look no further. Trophy Central has the guaranteed lowest prices. Our top-rated representatives are happy to assist you with all of your star lapel pin needs. Our experts in New York and Michigan have been providing suggestions and guidance since 1999. To find the perfect star-shaped award pins, use our keyword search above, or for personal service, call us toll-free at 1-888-809-8800.

    Frequently Asked Questions

    What sizes are available for star pins?

    Star pins typically come in multiple sizes, ranging from 1/2" to 1" (or 7/8"), with specific dimensions listed on each product page for accurate selection.

    Can I order different colors in bulk quantities?

    Yes, bulk orders can include mixed colors and styles. Contact our team for custom bulk pricing on multi-color assortments to meet your specific event requirements.

    What's the difference between flat and raised star designs?

    Flat stars offer a sleek, modern appearance, while raised designs provide dimensional height and texture. Both styles maintain the same quality construction and secure attachment methods.

    How quickly can I receive my lapel pin order?

    Standard orders ship within 1-2 business days via our USA fulfillment centers, ensuring fast delivery for time-sensitive recognition events and ceremonies.

    ]]>
    star-trophies star-medals
    custom-pagesimenplaq11"2-4 business days" "Marquette, MI" "UPS"plaques498552-410.451016.45JDS-SPlaquesBlank Plaques1:30%,2:33%,10:38%"New Products"Find star plaques discounted at TrophyCentral. Each star plaque features free a beautiful wood finish, free engraving and fast 1 to 2 day shipping.Blank, Generalcustom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceCertificates / CoversEmbosser Seals1:22%,3:28%,5:31%Find these Star Certificate Seals discounted at TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.803stGeneralcustom-pagetrophies-football1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511224.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,6:24%,12:26%,24:29%,48:31%"Football Awards"Star Series - Star Series Resin Trophies - Football. Ideal for leagues, schools, and tournaments. Fast shipping.tr7002Football, Sportscustom-pagetrophies-basketball1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511224.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,6:24%,12:26%,24:29%,48:31%"Basketball Awards"Star Series Resin Basketball Trophy (Female). Ideal for leagues, schools, and tournaments. Fast shipping.tr7001Basketball, Sportscustom-pagetrophies-tennis1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.451 2 3 4 5 6 7 8 911224.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,6:24%,12:26%,24:29%,48:31%"Tennis Awards"Star Series female tennis trophies have been meticulously sculptured and hand painted in an antique gold finish with a star shape base.tr7006Tennis, Sportscustom-pagetrophies-volleyball1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.451 2 3 4 5 6 7 8 911224.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,6:24%,12:26%,24:29%,48:31%"Volleyball Awards"Star Series female volleyball trophies have been meticulously sculptured and hand painted in an antique gold finish with a star shape base.tr7008Volleyball, Sportscustom-pagetrophies-softball1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.451 2 3 4 5 6 7 8 911224.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,6:24%,12:26%,24:29%,48:31%Star Series male softball trophies have been meticulously sculptured and hand painted in an antique gold finish with a star shape base.tr6097Softball, Sportscustom-pagetrophies-swimming-diving1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.451 2 3 4 5 6 7 8 911224.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,6:24%,12:26%,24:29%,48:31%"Swimming Awards"tr7010Swimming / Diving, Sportscustom-pagetrophies-wrestling1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.451 2 3 4 5 6 7 8 911224.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,6:24%,12:26%,24:29%,48:31%"Wresling Awards"Star Series Wrestling - trophies have been meticulously sculptured and hand painted in an antique gold finish with a star shape base.tr7014Wrestling, Sportscustom-pagename-badges-tagswoyoulipr100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Star Shaped Badges Discounted At TrophyCentral.namebadges-suncustom-pagetrophies-cheerleading-spirit1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.45169.5Tower RibbonTrophies1:14%These Unique Star Shield Series Engraved Cheerleader Trophies Typically Ship in 1-2 Business Days!wssx60Cheerleading, Sportscustom-pagetrophies-swimming-diving1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.45169.5Tower RibbonTrophies1:14%These Unique Star Shield Series Engraved Swimming Trophies Typically Ship in 1-2 Business Days!wssx7909-30-24Swimming / Diving, Sportscustom-page1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"465713-410.4569.5Tower RibbonTrophies1:14%These Unique Star Shield Series Engraved Bowling Trophies Typically Ship in 1-2 Business Days!wssx6312-20-2040Bowlingcustom-pagetrophies-go-kart1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.45169.5Tower RibbonTrophies1:14%These Unique Star Shield Series Engraved Go Kart Trophies Typically Ship in 1-2 Business Days!wss698Go Kartcustom-page1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"465713-410.4569.5Tower RibbonTrophies1:14%These Unique Star Shield Series Engraved Hockey Trophies Typically Ship in 1-2 Business Days!wss66712-20-2040Hockey, Sportscustom-page1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"465713-410.4569.5Tower RibbonTrophies1:14%wssx7312-20-2040custom-pagetrophies-wrestling1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.45169.5Tower RibbonTrophies1:14%These Unique Star Shield Series Engraved Wrestling Trophies Typically Ship in 1-2 Business Days!wssx71Wrestling, Sportscustom-pageachievement-certificates-awards1"Download Only"free-academic4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Star Student Award template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Star-Student-Award-Certificatestar-student-award-freeAcademic, Studentcustom-pagestar-pinsstar-performer-plaque-irising-star-plaque-i1achievement-trophies-awards1Star trophies in multiple sizes with free engraving and logos. Competitive pricing. Fast 1-2 day shipping. Honor champions with quality star awards. Shop now!Celebrate Achievement with Radiant Star Designs

    Our eye-catching star-shaped trophies feature brilliant designs that symbolize excellence and outstanding performance across all fields. Each star trophy showcases meticulous craftsmanship with polished finishes that reflect light beautifully, creating an impressive display piece.

    The versatile star motif works perfectly for corporate recognition, academic achievements, sports victories, and special milestone celebrations. Available in multiple sizes and configurations, these awards honor champions across every industry and achievement level.

    Premium Materials & Customization Options

    Choose from high-quality crystal, metal, and acrylic materials available in multiple sizes with transparent pricing to fit any budget to suit your specific recognition needs and budget requirements.

    Every star trophy includes complimentary personalization services, allowing you to add custom text, names, dates, and company logos to create personalized awards with professional precision. Our expert engraving team ensures your message is perfectly crafted to create a lasting memento of achievement.

    Why Buy Star Trophies from Trophy Central?

    Trophy Central offers an unmatched variety of star trophies with competitive price points and clear pricing on all sizes and fast 1-2 day shipping to meet your urgent deadlines. Our experienced team provides personalized engraving assistance and expert guidance to help you select the perfect awards to honor your champions.

    With decades of trusted service and thousands of satisfied customers, we guarantee exceptional quality and complete satisfaction with every order. From budget-friendly options to premium star trophies, our extensive selection of awards ensures you'll find exactly what you need to recognize your teams in style.

    Order Your Star Trophy Today

    Browse our complete collection of star trophies and customize your perfect recognition solution with just a few clicks online. Compare prices across our full variety of sizes and styles to find the best fit for honoring your champions.

    Take advantage of our quick turnaround times and satisfaction guarantee to ensure your awards ceremony is absolutely memorable. Don't wait! Honor your deserving champions with beautiful star trophies and star medals that will be treasured for years to come.

    Frequently Asked Questions

    What personalization options are available for star trophies?

    All-star trophies include free engraving for names, dates, achievements, and company logos. Our skilled engraving team can accommodate custom text layouts and special formatting requests to create the perfect personalized star award.

    How quickly can star trophies be shipped?

    Most star trophies and awards in all sizes ship within 1-2 business days after order confirmation. Rush delivery options are available for urgent deadlines, ensuring your awards arrive exactly when you need them.

    Are bulk discounts available for large orders?

    Yes, we offer attractive volume pricing on star trophies and star medals for bulk orders. Contact our sales team for custom quotes on large quantities, and we'll work with your budget to provide the best possible pricing.

    What sizes are available for star trophies?

    Our star trophies range from compact desktop awards to impressive, large presentation pieces. Multiple size options ensure you'll find the best star trophy to match your ceremony's importance and budget requirements.

    ]]>
    trophies star-pins trophies-victory
    custom-pagemedallion-inserts-general-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these quality Star With Handshake Inserts (Litho) at TrophyCentral. Each Star With Handshake Insert can be used to create a unique plaque, medal or trophy.507472General
    custom-pagevolunteerpinsplasticpinboxvelapinbox10105502-30.31150030.3Classic Medallicslapel-award-pins11:22%,50:30%,100:33%,500:47%Find These Star-Shaped Volunteer Lapel Pins Discounted At TrophyCentral. Each Volunteer Pin Features A Clutch-Back. Fast 1-2 Day Shipping!Volunteer-HeartVolunteercustom-pagename-badges-tagswoyoulipr100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Starburst Badges Discounted At TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.namebadges-star11"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)""PC10=458221510.45319.95Vision AwardsTrophies1:22%,25:28%"Star Awards" "General Recognition Awards" "Star Award"The Starphire Award features glass with black crystal star accent and base. Includeds etching. Available in 2 sizes.12-20-2040custom-pagetrophies-cheerleading-spirit1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511230.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,6:23%,12:24%,24:26%"Cheerleader Awards"tr9915Cheerleading, Sportscustom-page3-4-stars-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsGeneral1:22%,50:25%,100:29%,500:32%"Star Pins" "Star Lapel Pins" "Star Award Pins"Find this Stars - 3/4 Inch Gold Pin at TrophyCentral. Stars - 3/4 Inch Gold and other pins ship in just 1-2 business days!br199gStar, Generalcustom-pageblog-trophycentral11From blue ribbons for every entry to Grand Champion trophies for your top livestock and project winners, here are the county fair and 4-H award ideas that match the effort these kids actually put in.custom-pagecounty-fair-awards1498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these County Fair Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.County Faircustom-pagecounty-fair-awards1498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these County Fair Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.County Faircustom-pagecounty-fair-awards1498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these County Fair Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.County Faircustom-pagemedallion-inserts-government-agencies-and-logos12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsHero1:22%"Award Medals" "Award Medals - All Subjects" "Medals - All Others"Buy these high-quality State Seal Of California Inserts at TrophyCentral. Each State Seal Of California Insert can be used to create a unique plaque, medal or trophy.515769General
    custom-pagemedallion-inserts-government-agencies-and-logos12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsHero1:22%"Award Medals" "Award Medals - All Subjects" "Medals - All Others"Buy these high-quality State Seal Of Florida Inserts at TrophyCentral. Each State Seal Of Florida Insert can be used to create a unique plaque, medal or trophy.51761512-20-2020General
    custom-pagemedallion-inserts-government-agencies-and-logos12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsHero1:22%"Award Medals" "Award Medals - All Subjects" "Medals - All Others"Buy these high-quality State Seal Of Pennsylvania Inserts at TrophyCentral. Each State Seal Of Pennsylvania Insert can be used to create a unique plaque, medal or trophy.5176137-15-2011General
    custom-pagemedallion-inserts-government-agencies-and-logos12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsHero1:22%"Award Medals" "Award Medals - All Subjects" "Medals - All Others"Buy these high-quality State Seal Of Texas Inserts at TrophyCentral. Each State Seal Of Texas Insert can be used to create a unique plaque, medal or trophy.517657General
    custom-pagemedallion-inserts-general-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these quality Statue Of Liberty Inserts (Litho) at TrophyCentral. Each Statue Of Liberty Insert can be used to create a unique plaque, medal or trophy.495335General
    custom-pagegeneral-corporate-awards11"15 business days w/engraving" "Kentucky" "UPS (FedEx available on request)"general410181510.45438.45J CharlesGeneral Awards1:22%,13:28%Find this Globe Trophy with a slender body at TrophyCentral This award is perfect for global recognition events.custom-pagebottles-st80"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14142014.8Glass AmericaPromotional ProductsSports / Water Bottles1:14%,640:26%Our custom red water bottle collection features retractable sipper straws with matching carabineers. Choice of imprint color choices. Buy bulk and save!11376Sports / Water Bottlescustom-pagebottles-st80"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14142014.8Glass AmericaPromotional ProductsSports / Water Bottles1:14%,640:26%Our custom steel gray water bottle features retractable sipper straw and matching carabineers. Choice of imprint color choices. Buy bulk and save!11370Sports / Water Bottlescustom-pagequickshiptrophies-steer1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:27%,100:32%Our popular Steer Figure participation trophies feature a real slant-front marble base and free engraving.qtsteernccustom-pagequickshiptrophies-steer1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Fabulous Steer Figure Place Trophy with 1st, 2nd or 3rd Place Trim, Marble Base and Free personalization. Ships in a fast 1-2 days!qtsteerplcustom-pagequickshiptrophies-steer1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find these popular Steer Figure year trim trophies discounted at TrophyCentral. Available in multiple sizes and includes free personalization. Features gold year of event trim.qtsteeryrcustom-pagequickshiptrophies-rabbitqtsteerncqtsteerscqtsteerdmqtsteeryrqtsteerttqtsteerttwqtsteer3cqtsteerplmqtsteerscbcup-steer-scbcup-steer-pbdg-steer11Find Steer Trophies discounted at TrophyCentral. Each Steer (Cow) Trophy includes free engraving. Fast 1-2 day shipping.

    Shop with Confidence at TrophyCentral

    We offer a huge selection, discounted prices and top-rated customer service. Do you need help with some ideas or with ordering? Yes, we sell online, but we have real people who would love to help you! Feel free to call our customer service experts in Michigan, New York and online. TrophyCentral - delivering smiles since 1999!


    ]]>
    quickshiptrophies-goat quickshiptrophies-bull.html
    custom-pageperplaq1"4-6 business days "Marquette, MI" "UPS"plaques498553-610.45315.45JDS-SPlaquesPerpetual Plaques1:22%"Minuteman" "New Products"Walnut plaque (perpetual) with 12 nameplates. Includes header plate and first nameplate engraving.wpp1209-06-2014Perpetual, Name Platecustom-pageperplaq1"4-6 business days "Marquette, MI" "UPS"plaques498553-610.45321.45JDS-SPlaquesPerpetual Plaques1:22%"Minuteman" "New Products"Walnut plaque (perpetual) with 45 nameplates. Includes header plate and first nameplate engraving.wpp4508-10-2011custom-pageperplaq1"4-6 business days "Marquette, MI" "UPS"perpetual plaques498553-610.45316.95JDS-SPlaquesPerpetual Plaques1:22%"Minuteman" "New Products"Find This Beautiful 18 Plate Step Edge Walnut Perpetual Plaque Discounted At TrophyCentral. Fast Shipping. Top-Rated Customer Service.wpp18Return to thesection for other great choices.perplaq08-20-2022Perpetual, Name Platecustom-pageperplaq1"4-6 business days "Marquette, MI" "UPS"perpetual plaques498553-610.45318.45JDS-SPlaquesPerpetual Plaques1:22%"New Products"Find This Beautiful 24 Plate Step Edge Walnut Perpetual Name Plaque Discounted At TrophyCentral. Fast Shipping. Top-Rated Customer Service.wpp2406-30-2022Perpetual, Name Platecustom-pageperplaq1"4-6 business days "Marquette, MI" "UPS"perpetual plaques498553-610.45319.95JDS-SPlaquesPerpetual Plaques1:22%"Minuteman" "New Products"Find This Beautiful 36 Plate Step Edge Walnut Perpetual Name Plaque Discounted At TrophyCentral. Fast Shipping. Top-Rated Customer Service.wpp3608-10-2011Perpetual, Name Platecustom-pagebadgeribbonsholders11"1-2 business days" "Topeka, Indiana" "UPS (FedEx available on request)"465711-21 260.3620030.36Tower RibbonRibbonsStock Ribbons1:22%,5:20%Find printed badge ribbons at TrophyCentral. Each badge ribbon is available in many colors and titles. Fast 1-2 day shipping.badgeribbbonscustom-pagequickshiptrophies-stock-car1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.05Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:16%Find These Popular Stock Car Deluxe Platform Trophies Discounted at TrophyCentral. Real Marble; Free Engraving!qtscardmcustom-pageholographic-insert-plaques1"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498852-310.45811.6Quick TrophyPlaquesInsert1:14%,3:14%See this stunning Stock Car plaque and other Holographic Plaques at TrophyCentral.qsinplaqstockcarcustom-pagequickshiptrophies-stock-car1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:25%Our popular Stock Car participation trophies feature a real slant-front marble base and free engraving.qtscarnccustom-pagequickshiptrophies-stock-car1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:16%Fabulous Stock Car Place Trophy with 1st, 2nd or 3rd Place Trim, Marble Base and Free Engraving. Ships in a fast 1-2 days!qtscarplcustom-pageracing-medalsqtscarncqtscarscqtscardmqtscaryrqtscarplqtscarttqtscarttwqtscar3cqtstockperpmqtscarscbcup-scar-pcup-scar-scb1trophies-car-truck1Find a great selection of stock car trophies discounted at TrophyCentral. Each stock car trophy includes free personalization! See our complete selection of stock car trophies, medals and awards.

    Shop For Car & Truck Awards With Confidence At TrophyCentral

    We offer a huge selection, discounted prices and great customer service. Do you need help with some ideas or with ordering? Yes, we sell online, but we have real people who would love to help you! Feel free to call our customer service experts in Michigan, New York and online. TrophyCentral - delivering smiles since 1999!


    ]]>
    custom-pagequickshiptrophies-stock-car1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:16%This popular Stock Car Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!qtscaryrcustom-pagefirst-place-ribbons11"1-2 business days" "Topeka, Indiana" "UPS (Post Office Priority Mail may also be available)"ribbons465711-21 260.3630021.36Tower RibbonRibbons1:22%,50:26%,100:31%See these fabulous mini-rosettes discounted at TrophyCentral. Mini rosettes are a fun and inexpensive way to recognize a special achievement!Blue Ribbon, Red Ribbon, 1st / 2nd / 3rd / Etc., Honorable Mention, Participant, Achievementcustom-pageofficesigns11240162-310.5183.38Roanoke1Find date stamps and custom rubber stamps at TrophyCentral.com at discounted prices. Fast shipping on all custom stamps.custom-pagename-badges-tagswoyoulipr100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Stop Sign Badges Discounted At TrophyCentral.namebadges-stopcustom-page11custom-pagequickshiptrophies-street1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Fabulous Street Rod Figure Trophy with choice of 1st, 2nd or 3rd place trim.qtstreetrodplcustom-pagequickshiptrophies-street1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%This popular Street Rod Figure Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!qtstreetrodyrcustom-pagequickshiptrophies-street1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:27%,100:32%Our popular Street Rod Participation Trophies feature a real slant-front marble base and free personalization. Significant quantity discounts available.qtstreetrodnccustom-pagetrophies-car-truckqtstreetrodncqtstreetrodscqtstreetroddmqtstreetrodplqtstreetrodyrqtstreetrodttqtstreetrodttwqtstreetrod3cmqtstreetrodscbcup-streetrod-scbcup-streetrod-p11See a fabulous selection of Street Rod Figure Trophies at TrophyCentral. Free engraving on Street Car Trophies.street rod trophies, street rod trophy, street rod awards, street rod trophies and awards

    Shop for Street Car Trophies with Confidence at TrophyCentral

    We offer a huge selection, discounted prices and free shipping on orders for trophies, awards and top-rated customer service. Do you need help with some ideas or with ordering? Yes, we sell online, but we have real people who would love to help you! Feel free to call our customer service experts in Michigan, New York and online. TrophyCentral - delivering smiles since 1999!


    ]]>
    quickshiptrophies-camero quickshiptrophies-stock-car
    custom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these high-quality Student Council Award Inserts at TrophyCentral. Each Student Council Award Insert can be used to create a unique plaque, medal or trophy.51816106-10-2014Student Council, Academic
    custom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-40.3713003.37Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these quality Mylar Student Council Award Decal Inserts at TrophyCentral. Each Student Council Award Decal can be used to create a unique plaque, medal or trophy.489812Student Council, Academic
    custom-pageawardcertificates115"1-3 business days" "Columbia, South Carolina; Marquette, Michigan" "UPS (FedEx available on request)"certificates290631-21 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,50:38%,100:42%Find these Student Council certificates discounted at TrophyCentral. Each Student Council certificate measures 8 1/2 x 11 inches and typically ships in 1-2 days.7010Student Council, Academiccustom-pagestudent-council-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:30%,100:33%,500:47%"School Pins"Student Council Letter Pins: EC Series Student Council Lapel Pins feature a high-quality enameled finish and ship in just 1-2 business days!ec36Student Council, Academiccustom-pageacademic-lamp-general102-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    medals105503-60.5115014Classic Medallicsaward-medalsAcademic1:22%,25:24%,50:30%,100:36%,500:42%"School Medals" "School Award Medals" "Scholastic Medals" "Scholastic Award Medals" "Academic Medals" "Academic Award Medals" "Medals, School"Your students will love these colorful Student Council Medals from TrophyCentral. Each Student Council medal includes a neck ribbon! Fast shipping.tm9812Student Council, Academic
    custom-pagestudent-council-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:28%,100:32%,500:42%"School Pins"Find Student Council pins at TrophyCentral. Each AP Series Student Council pin includes a clutch back.ap14Student Council, Academiccustom-pageschool-pinsstudent-council-pinap14ec36hp23br469br54111Find student council pins discounted at TrophyCentral. Each student council pin features a clutch-back for easy attachment to clothing.

    Lapel Pins: Student Council

    If you are looking for an inexpensive, yet quality way to recognize your students, you have come to the right place! Student council lapel pins typically ship in a quick 1-2 business days and often the same day an order is placed. We offer discounted and bulk prices and top-rated customer service. If you have a question, please call our experts. They would be happy to assist you!
    ]]>school-pinscustom-pagescholarship-resource-hub11Complete student nomination worksheet for teachers. Organize observations and gather specific examples before writing scholarship nominations. custom-pageawardcertificates11certificates290631-31 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,25:24%,100:40%,500:50%Find this student of the month certificate and other awards discounted at TrophyCentral. Student of the month certificates are beautifully printed and measure 11 x 8 1/2 inches.933Academiccustom-pageachievement-certificates-awards1"Download Only"free-academic49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"See this Student Of The Month Certificate designed exclusively for TrophyCentral! Student Of The Month Certificates can be downloaded for free!studentfrAcademic, Studentcustom-pageachievement-certificates-awards1"Download Only"free-academic49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our student of the month template (female) is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-female-student-of-the-month-certificatefemale-student-of-the-month-freeAcademic, Studentcustom-pageachievement-certificates-awards1"Download Only"free-academic49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our student of the month template (male) is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-male-student-of-the-month-certificatemale-student-of-the-month-freeAppreciation, Academiccustom-pageawardcertificates115"1-3 business days" "Columbia, South Carolina; Marquette, Michigan" "UPS (FedEx available on request)"certificates290631-21 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,50:38%,100:42%Find these Student of the Month certificates discounted at TrophyCentral. Each Student of the Month certificate measures 8 1/2 x 11 inches and typically ships in 1-2 days.7030Academiccustom-pagemedals-general102-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    medals105503-60.5115014Classic Medallicsaward-medalsAcademic1:22%,25:24%,50:30%,100:36%,500:42%"School Medals" "School Award Medals" "Scholastic Medals" "Scholastic Award Medals" "Academic Medals" "Academic Award Medals" "Medals, School"Your students will love these colorful Mylar Student of the Month Medals from TrophyCentral. Each Student of the Month medal includes a neck ribbon!tm9711General, Academic
    custom-pageeawardmedals12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    medals105503-60.75130033.75Classic Medallicsaward-medalsAcademic1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "School Medals"These inexpensive 1 1/4 inch Student of the Month Medals offer a high quality, but low price for those on a tight budget.e996212-20-2020Academic
    custom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-40.3713003.37Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these quality Mylar Student Of The Month Decal Inserts at TrophyCentral. Each decal can be used to create a unique plaque, medal or trophy.489711Academic
    custom-pageschool-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"Find Student of the Month pins discounted at TrophyCentral. Each Student of the Month lapel pin features a quality clutch back.br39512-25-2010General, Academiccustom-pageachievement-certificates-awards1"Download Only"free-academic4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Student of the Week template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Student-of-the-Week-Certificatestudent-of-the-week-freeAcademic, Studentcustom-pageschool-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"Find these Student of the Week pins discounted at TrophyCentral. Each lapel pin features a beautiful finish and clutch-back.br540Academiccustom-pageschool-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:28%,100:32%,500:42%"School Pins" "School Lapel Pins"Find Student Recognition Award pins at TrophyCentral. Each AP Series Student Recognition Award pin includes a clutch back.ap77Academiccustom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these high-quality Student Recognition Award Inserts at TrophyCentral. Each Student Recognition Award Insert can be used to create a unique plaque, medal or trophy.517806General, Academic
    custom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-40.3713003.37Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these quality Mylar Student Recognition Award Decal Inserts at TrophyCentral. Each decal can be used to create a unique plaque, medal or trophy.489667Academic
    custom-pageacademic-resource-hub11Discover amazing student recognition award ideas! From perfect attendance to student of the month, find creative trophies and fun recognition that motivates students and celebrates their unique achievements.custom-pageacademic-lamp-general52-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    medals105503-60.5115014Classic Medallicsaward-medalsAcademic1:22%,25:24%,50:30%,100:36%,500:42%"School Medals" "School Award Medals" "Scholastic Medals" "Scholastic Award Medals" "Academic Medals" "Academic Award Medals" "Medals, School"Your students will love these colorful Mylar Student Recognition Medals from TrophyCentral. Each Student Recognition medal includes a neck ribbon!tm9667General, Academic
    custom-pageschool-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"Find this Student Recognition Pin at TrophyCentral. Student Recognition and other pins ship in just 1-2 business days!br319Academiccustom-pagescholarship-resource-hub11Comprehensive scholarship application timeline for students from junior year through senior year. Includes month-by-month checklists, organization strategies and more!custom-pageengravablemugmedallion-inserts-motivational--recognition--salesmedallion-inserts-general-medallion-insertsmedallion-inserts-government-agencies-and-logosmedallion-inserts-occupational-subjectsmedallion-inserts-military-medallion-insertsmedallion-inserts-organizationsmedallion-inserts-academic-medallion-insertsmedallion-inserts-arts-and-music-medallionsmedallion-inserts-fraternal-organizational-insertssports-inserts111custom-pagesummer-camp-awards1"Download Only"free-camp4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Summer Camp Award Template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.summer-camp-awardsummer-campCampingcustom-pagegeneral-corporate-awards1"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"458221510.45619.05Vision AwardsTrophies1:22%,26:36%Summit Corporate Awards from TrophyCentral.custom-pageengraved-frames1"3-4 business days" "Medina, MN" "UPS"personalized gifts553404-70.51832.9JDSGiftsEngraved Frames1:22%Our bright orange Sunshine and Flowers Frame makes the perfect backdrop for that favorite photo. Decorated with flowers, swirls, butterflies, and colorful geometric patterns.gc740Engraved Frames1"14 business days" "Erlanger, KY" "UPS""PT1=Trophies" "PC10=410187-1010.451 2 3 4 5 6 7 8 9432.45JcharlesGeneral Awards1:22%,25:24%Superba Award from TrophyCentral. Also see our great selection of engraved and personalized gifts!custom-pageservicepins11plasticpinboxvelapinbox"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.371150030.37Classic Medallicslapel-award-pinsBusiness1:22%,100:45%Shop for Swarovski Crystal Service Pins from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.custom-page111custom-pagesports-inserts1105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Swimming Awards"Buy these quality Swim All Styles (Female) Inserts (Litho) at TrophyCentral. Each Swim All Styles (Female) Insert can be used to create a unique plaque, medal or trophy.507060Swimming / Diving, Sportscustom-pagesports-inserts1105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Swimming Awards"Buy these quality Swim All Styles Male Inserts (Litho) at TrophyCentral. Each Swim All Styles Male Insert can be used to create a unique plaque, medal or trophy.507069Swimming / Diving, Sportscustom-pageblog-trophycentral11custom-pagetrophies-swimming-diving1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%This popular Swimming Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!qtswimyrSwimming / Diving, Sportscustom-pageaward-medalsqtswimncqtswimacrwge479wbt780qtswimscmaswtrmoxtmaswtrmoxtfeswtrqtswimdmqtswimyrqtswimplqtswimttqtswimttwqtswim3cqtswimtrtr7010tr7011tr9922wssx79qtswimperpmqtswimscbcup-swim-scbcup-swim-pswimming-part-iswimming-single-iswimming-champ-iswimming-plaque-iswimming-e-part-iswimming-e-single-icup-swimming-scb-icup-swimming-inbdg-swimmingchamp-cup-swim-tce9038e9283ir16swimmingmedalsqcm-31me106gz9036z9038tm9990gswimming-mgswimming-mcswimming-mc-prswimming-jigfswimming-jibfswimming-jisfswimming-ribbonscl38cl37cl47cl54goldstarpinsswimming-pb504281503081507060489645507069507412504191504191503891493231swimming-eiqsinplaqswimming1trophies1"Swimming Awards" "Sports Trophies"Customization Options for Every Event and Age Group

    Every swimming trophy includes free engraving to personalize your swimming awards with names, dates, and achievements. Pick from various swimmer poses depicting both male and female athletes, perfect for youth leagues through championship events.

    Our fast turnaround ensures your custom swimming trophies and swimming medals arrive ready for presentation, with bulk discounts available to fit any budget price point. We offer both swimming trophies and swimming medals in gold, silver, and bronze at every price point, ensuring you'll find quality awards that fit your budget.

    Why Choose Trophy Central for Your Swimming Awards?

    Trophy Central brings over 20 years of expertise in creating memorable awards for swimming competitions nationwide. Our trusted reputation is built on quality craftsmanship, competitive pricing and budget-friendly options, and exceptional customer service.

    Teams and organizations return to us year after year for our reliable resin trophies, swimming medals, and budget-friendly awards, as well as our significant bulk purchase discounts.

    Make a Splash with Your Order Today

    Ready to recognize your swimmers' hard work and dedication? including stunning resin trophies and elegant awards for every budget and price range, to find the perfect awards for your next meet. Upload your engraving details during checkout and enjoy fast shipping to ensure your trophies arrive on time.

    Shop now and celebrate every victory with Trophy Central's premium swimming awards.

    Be sure to see our expert guides:

    Frequently Asked Questions

    What swimming trophy styles do you offer?

    We offer traditional column trophies, modern acrylic awards, detailed resin swimmer figurines, and elegant cup trophies. Each piece comes in multiple sizes to accommodate different competition levels and budgets. Our diverse selection of swimming trophies makes it easy to find the perfect awards for any swim meet or competition.

    Is engraving included with every swimming trophy?

    Yes, free engraving is included with all our swimming trophies and swimming medals, keeping your overall price budget-friendly. Simply provide your text during checkout, and we'll professionally engrave names, dates, and achievements at no additional cost.

    Do you offer bulk discounts for swim meets?

    Absolutely! We provide significant bulk discounts for larger needs, making it affordable to recognize every swimmer with quality swimming medals and awards that match any budget. Contact us for custom quotes on team orders and championship events.

    How quickly can you ship swimming awards?

    Most swimming trophies ship within 1-2 business days after engraving approval. Rush processing is available for urgent events to ensure your awards arrive on time for your swim meet.

    ]]>
    custom-pagetrophies-swimming-diving1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with swimmer figure discounted at TrophyCentral. Includes free text engraving!cup-swim-pSwimming / Diving, Sportscustom-pagefree-sports-templates1"Download Only"free-sports49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Swimming template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Swimming-Certificateswimming-freeSwimming / Diving, Sportscustom-pagefree-sports-templates1"Download Only"free-sports49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"See this Swimming Certificate designed exclusively for TrophyCentral! Swimming Certificates can be downloaded for free! Each Swimming Award Certificate measures 11 x 8 1/2 inches.swimmingfrSwimming / Diving, Sportscustom-pagecoaching-teaching-guides11Creative swimming award ideas with engraving examples for your team banquet. From Ace Machine to Dig Master, discover 15+ unique ways to recognize every player with actual trophy wording templates.custom-pagesporcerswimmingfr1swimmingfrcertificates290631-31 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,25:27%,100:40%,500:50%"Swimming Awards"Give your swim team the recognition they deserve with swimming certificates from Trophy Central. Shop our discounted swim certificates today!1039Swimming / Diving, Sportscustom-pagesports-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Swimming Awards"Buy these quality Swimming GENERAL (507412) Inserts (Litho) at TrophyCentral. Each Swimming GENERAL (507412) Insert can be used to create a unique plaque, medal or trophy.507412Swimming / Diving, Sports
    custom-pagetrophies-swimming-diving1medals498552-30.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Colorful Swimming Insert Medals Discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Swimming / Diving, Sportscustom-pagetrophies-swimming-diving1medals498552-40.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Swimming Insert Medals With A Personalized Front Rim Discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Swimming / Diving, Sportscustom-pagecherry-insert-plaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these swimming insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Swimming / Diving, Sportscustom-pagetrophies-swimming-divingplastic-pinbox-t5lapel pins498551-20.525040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find these Swimming Gold Enamel Lapel Pins discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.swimming-pbSwimming / Diving, Sportscustom-pagesports-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Swimming Awards"Buy these high-quality Swimming Inserts (493231) at TrophyCentral. Each 2 inch insert can be used to create a unique plaque, medal or trophy.493231Swimming / Diving, Sports
    11Find swimming medals your swimmers will love discounted at TrophyCentral. Each swimming medal includes a free neck ribbon.Shop for Stock and Custom Swim Medals with Ease at TrophyCentral Swimming medals come in gold, silver and bronze finishes to recognize different levels of achievement. Some are also available in color, a popular favorite with younger kids and recreational swimmers. Most medals ship in just 1-2 days without engraving or 1-5 days with engraving. Please see product descriptions for details. If you have any questions, please contact our customer service experts. They have been help customers since 1999 and would be thrilled to help you, too! ]]>trophies-swimming-divingcustom-pagetrophies-swimming-diving1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our swimming insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - SwimmingSwimming / Diving, Sportscustom-pagetrophies-swimming-diving1j9036 sporcer eventribbons sports"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%,25:23%,50:29%,100:34%Our popular Swimming participation trophies feature a real slant-front marble base and free engraving.qtswimncSwimming / Diving, Sportscustom-pagesports-pinscl38cl37cl47cl54goldstarpinsswimming-pb11Shop for swimming pins at TrophyCentral. Pins for swimming and diving ship in 1-2 business days.swimming pins, swimming award pins, swimming awards, swimming lapel pinsSwimming Award Pins TrophyCentral has a great selection of stock swimming lapel pins. Our swimming letter pins are available with a color or gold finish. Choose from several styles, including: male swimmer, female swimmer, CAPT, and more.

    Shop with Confidence at TrophyCentral!

    If you are looking to buy swimming lapel pins online, look no further! TrophyCentral has a great selection that will fit any budget. Our top-rated representatives are happy to assist you with all of your swimming pin / diving pin needs. Our experts in New York and Michigan have been providing suggestions and guidance since 1999!]]>
    swimmingmedals1 trophies-swimming-diving
    custom-pagetrophies-swimming-diving50"Standard Service: 8 Business Days from Receipt of Artwork, Rush Service (Extra Charge): 3 Business Days from Receipt of Artwork" "Oxnard, CA" "UPS (FedEx available on request)"medals930335-1010.630033.6Simba Calaward-medalsSports, Hobby, Org, Livestock1:22%,300:40%,500:51%,1000:54%"Swimming Medals" "Swimming Awards"These 2 1/2 inch custom Swimming Race Medals come with an outer-ring which allows you to add your school or league name, date and location.qcm-31Swimming / Diving, Sportscustom-pageaward-ribbons-printed1"1-2 business days" "Topeka, Indiana" "UPS (Post Office Priority Mail may also be available)"ribbons465711-21 26120030.36Tower RibbonRibbons11:22%,50:46%Find swimming ribbons discounted at Trophy Central. Choose from 1st - 6th place, participant and more!Swimming / Diving, Sportscustom-pagetrophies-swimming-diving1trophies498551-311821.06TrophyCentraltrophies1Swimming / Diving, Sportscustom-pagetrophies-swimming-diving1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular swimming figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!qtswimplSwimming / Diving, 1st / 2nd / 3rd / Etc., Sportscustom-pagetrophies-swimming-diving1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy swimming insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Swimming / Diving, Sportscustom-pagetrophies-golf1"10 business days" "Aliquippa, PA" "UPS"trophies1500110-1410.45824.45Glass AmericaCrystal AwardsSports, Hobby, Org, Livestock1:22%,10:25%Sylvan Golf Tower. Ideal for leagues, schools, and tournaments. Fast shipping.Golf, Sportscustom-pagetrophies-swimming-diving12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    medals105503-60.75130033.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,100:28%,500:34%,1000:45%"Swimming Awards" "Swimming Medals"These inexpensive 1 1/4 inch Synchronized Swimming Medals offer a high quality, but low price for those on a tight budget.e9283Swimming / Diving, Sports
    custom-pageaward-medalsqttballncqttballscbabohe2tr7048qttballdmqttballyrqttballplqttballttqttballttwbaseballbank1qttballacrmqttballscbcup-tball-scbcup-tball-pt-ball-part-it-ball-single-it-ball-champ-it-ball-plaque-it-ball-e-part-it-ball-e-single-icup-t-ball-scb-icup-t-ball-inbdg-t-balltm9972gt-ball-mct-ball-mc-prqushbamet-ball-jigft-ball-jibft-ball-jisf1trophies1"Sports Trophies" "Trophies" "T-Ball Awards" "T-Ball Trophies"Find a great selection of t-ball trophies at TrophyCentral. Each t-ball trophy and award includes free engraving. T-ball medals include a ribbon.

    Celebrate Every T-Ball Achievement

    Our collection of T-Ball trophies is designed to recognize young players as they learn teamwork, sportsmanship, and the fundamentals of the game. Whether you are organizing a local league, coaching a team, or planning an end-of-season ceremony, we have awards that capture the excitement of the sport.

    Choose from classic column styles, fun and colorful resin designs, or personalized T-Ball plaques that make a lasting keepsake. Many of our trophies include free engraving, so you can add each player's name, team, or season details.

    Looking for something budget-friendly? We offer affordable options for leagues and bulk orders, as well as unique designs that make every player feel like an MVP. From the smallest slugger to the team's rising star, our T-Ball awards are perfect for celebrating effort, improvement, and the joy of playing the game.

    ]]>
    trophies 1st-place-medals
    custom-pagetrophies-t-ball1498554-Feb0.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find these colorful T-Ball 2" Epoxy-covered insert decals discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Baseball / T-Ball, T-Ball, Sportscustom-pagetrophies-t-ball1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511218.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,6:24%,12:26%,24:29%,48:31%"Baseball Awards"Find these popular T-Ball Design Little Buddy Series Trophies Discounted at TrophyCentral. Free Personalization! TrophyCentral is a Top-Rated Merchant.tr7048Baseball / T-Ball, Sportscustom-pagetrophies-t-ball1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with t-ball figure discounted at TrophyCentral. Includes free text engraving!cup-tball-pBaseball / T-Ball, Sportscustom-pagefree-sports-templates1"Download Only"free-sports4985501Trophy CentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our T-Ball template is free and designed exclusively for Trophy Central. T-Ball certificate templates measure 11" x 8 1/2" and can be easily downloaded and printed.t-ball-certificatet-ball-frT-Ball,. Sportscustom-pagetrophies-t-ball11"3-4 business days + shipping time" "Marquette, MI" "UPS (FedEx available on request)"trophies498552-310.451224.5JDS-STrophiesSports, Hobby, Org, Livestock1:22%,12:32%Kids love our engraved t-ball bank trophy! T-ball bank trophies are made of resin and the baseball figure is hand-painted.baseballbank106-15-2011Baseball / T-Ball, Sportscustom-pagetrophies-t-ball11"1-3 business days + shipping time" "Marquette, MI" "UPS (Post Office Priority Mail may be available on request)"trophies498552-310.453631.05JDS-STrophiesSports, Hobby, Org, Livestock1:22%,10:23%Find T-Ball Bobble Head Trophies Discounted at TrophyCentral. Fast 1-2 Day Shipping and Free Personalization!babohe208-10-2013Baseball / T-Ball, Sportscustom-pagecoaching-teaching-guides11Master T-ball coaching with age-appropriate drills, practice plans, and parent management tips for 4-6 year olds. Includes free certificates and award ideas to motivate young players.custom-pagetrophies-t-ball1medals498553-Feb0.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these colorful T-Ball insert medals discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.T-Ball, Sportscustom-pagetrophies-t-ball1medals498553-Feb0.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these T-Ball insert medals with a personalized front rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.T-Ball, Sportscustom-pagecherry-insert-plaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these t-ball insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Baseball / T-Ball, Sports11Find T-Ball Medals Discounted at TrophyCentral. Each T-Ball Medal Includes a Free Ribbon.Shop for T-Ball Award Medals with Ease Our t-ball medals are a perfect way to recognize boys and girls for their youth t-ball league participation. We have gold, silver and bronze medal frames for teams that have multiple place winners.]]>tballmedalscustom-pagetrophies-t-ball1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our t-ball insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - T-BallT-Ball, Sportscustom-pagetrophies-t-ball1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy t-ball insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Baseball / T-Ball, T-Ball, Sportscustom-pagetrophies-t-ball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%,25:23%,50:29%,100:34%Our T-Ball Player Participation Trophies feature a real slant-front white marble base and free personalization. Significant quantity discounts available.qttballncReturn to thesection for more fabulous choices.trophies-t-ballBaseball / T-Ball, Sportscustom-pagetrophies-t-ball1trophies498551-311821.06TrophyCentraltrophies1Baseball / T-Ball, Sportscustom-pagetrophies-t-ball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular T-ball figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!qttballplReturn to ourcategory for more individual and team awards.trophies-t-ballBaseball / T-Ball, 1st / 2nd / 3rd / Etc., Sportscustom-pagetrophies-t-ball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find these popular T-Ball year trim trophies discounted at TrophyCentral. Available in multiple sizes and includes free personalization.qttballyrBaseball / T-Ball, Sportscustom-pageletter-shaped-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find these popular T-shaped custom mascot badges at TrophyCentral. Great for fundraising! TrophyCentral is a top-rated Yahoo merchant.letterbadges-tcustom-pagetrophies-table-tennis-ping-pong1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%This popular Table Tennis (Ping Pong) Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!qtttennisyrTable Tennis / Ping Pong, Sportscustom-pagetable-tennis-medals1medals498554-Feb0.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find these colorful Table Tennis 2" Epoxy-covered insert decals discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Ping Pong / Table Tenniscustom-pagepickleball-trophiesqtttennisncqtttennisscqtttennisdmqtttennisyrqtttennisplqtttennisttqtttennisttwqtttennis3cmqtttennisscbcup-ttennis-pcup-ttennis-scbtable-tennis-part-itable-tennis-single-itable-tennis-champ-itable-tennis-plaque-itable-tennis-e-part-itable-tennis-e-single-ibdg-ping-pong1trophies1Table Tennis / Ping Pong Trophies from TrophyCentral. Each table tennis trophy includes free engraving. Fast 1-2 day shipping.Table Tennis Recognition Trophies TrophyCentral has an industry-leading selection of ping pong trophies. Hit a winning slam with our Championship Trophies. All of our sports and recreation trophies include up to three lines of FREE ENGRAVING (larger awards may include additional lines). ]]>custom-pagetrophies-table-tennis-ping-pong1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with table tennis / ping pong figure discounted at TrophyCentral. Includes free text engraving!cup-ttennis-pTable Tennis / Ping Pong, Sportscustom-pagetrophies-table-tennis-ping-pong1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.05Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:15%Find These Popular Table Tennis / Ping Pong Deluxe Platform Trophies Discounted at TrophyCentral. Real Marble; Free Engraving!qtttennisdmTable Tennis / Ping Pong, Sportscustom-pagetrophies-table-tennis-ping-pong1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:28%Our popular Table Tennis / Ping Pong participation trophies feature a real slant-front marble base and free engraving.qtttennisncTable Tennis / Ping Pong, Sportscustom-pagetrophies-table-tennis-ping-pong1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these table tennis / ping pong budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtttennisscbTable Tennis / Ping Pong, Sportscustom-pagefree-sports-templates1"Download Only"free-sports4985501Trophy CentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Table Tennis template is free and designed exclusively for Trophy Central. Table Tennis certificate templates measure 11" x 8 1/2" and can be easily downloaded and printed.table tennis-certificatetable-tennis-frTable Tennis / Ping Pong, Sportscustom-pagetable-tennis-medals1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Table Tennis Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Table Tennis / Ping Pong, Sportscustom-pagetable-tennis-medals1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Table Tennis Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Table Tennis / Ping Pong, Sportscustom-pagetable-tennis-medals1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Table Tennis Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Table Tennis / Ping Pong, Sportscustom-pagetrophies-table-tennis-ping-pong1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy table tennis column insert trophy features a choice of column color, a marble base and free trophy engraving.Ping Pong / Table Tenniscustom-pagenew-tc-color-medals1medals498553-Feb0.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these colorful Table Tennis insert medals discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Table Tennis / Ping Pong, Sportscustom-pagetable-tennis-medals1medals498553-Feb0.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Table Tennis insert medals with a personalized front rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Table Tennis / Ping Pong, Sportscustom-pagecherry-insert-plaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these table tennis insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Ping Pong / Table Tenniscustom-pageaward-medalstable-tennis-mctable-tennis-jigftable-tennis-jibftable-tennis-jisftable-tennis-mc-pr11Find Table Tennis medals discounted at TrophyCentral Each Table Tennis and Ping Pong medal includes a free ribbons.custom-pagetrophies-table-tennis-ping-pong1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our table-tennis insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - Table-TennisTable Tennis / Ping Pong, Sportscustom-pagetrophies-table-tennis-ping-pong1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy table tennis insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Ping Pong / Table Tenniscustom-pagetrophies-table-tennis-ping-pong1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Table-Tennis single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - Table-TennisTable Tennis / Ping Pong, Sportscustom-pagetrophies-table-tennis-ping-pong1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular table tennis figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!qtttennisplTable Tennis / Ping Pong, 1st / 2nd / 3rd / Etc., Sports11custom-pagehonorrollpinsplastic-pinbox-t5lapel pins498551-20.525040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find these Honor Society Gold Enamel Lapel Pins discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.honor-soc-u-pbHonor Society, Academiccustom-pagehonorrollpinsplastic-pinbox-t5lapel pins498551-20.550040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find these Honor Roll Gold Enamel Lapel Pins discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.honor-roll-u-pbHonor Roll, Academic11Find TC-Series Gold Enamel Lapel Pins Discounted at TrophyCentral. Each Pin Measures 7/8". Fast 1-2 Day Shipping!1custom-pageblog-trophycentral11Teacher Appreciation Week is May 5-9, 2026. Discover 12 meaningful award categories for educators, budget planning tips for schools, and an ordering countdown to make sure recognition arrives on time.custom-pagefreeawardcertificatescraponblba51-341151-782551-818670mqt-apple-dmmqt-apple-perpappreciation-award-plaqueapclaw1personalized-gifts1Find teacher appreciation trophies and gifts discounted at TrophyCentral. Add personalization for a special touch. Shop with Ease at TrophyCentral! If you're looking for the perfect gift for a special teacher, look no further. As a one-stop-shop for all things related to recognition, we offer a wide selection of thoughtful and unique custom gifts for your child's teacher or educator. Whether you're looking for something practical like a name block for his or her desk or something more sentimental like a personalized plaque, TrophyCentral has you covered. We are an online store, but we have real people ready to assist you. Call our experts in Michigan, NY and online. They have been helping customers since 1999 and they would be will be thrilled to help you, too!]]>teacher-pins simenplaq custom-pageblog-trophycentral11custom-pagelapel-award-pinsbr313br297br303br271br531br550br24111Find teacher pins discounted at TrophyCentral. Each teacher pin features a clutch-pin back. Fast 1-2 day shipping.Shop with confidence at TrophyCentral We feature a huge selection of quality lapel pins in many school subjects, all at discounted prices. Need help? Our experts in Michigan and New York would be happy to assist you!]]>custom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these high-quality Teacher Recognition Award Inserts at TrophyCentral. Each Teacher Recognition Award Insert can be used to create a unique plaque, medal or trophy.517825Academic
    custom-pageteacher-appreciation1"3-6 business days with engraving, Without engraving: 1-3 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"plaques105503-610.4511219.65Classic MedallicsPlaquesInsert1:22%,3:24%,5:27%"School Awards" "School Products"Genuine Walnut Teacher Recognition Award Plaque with 2 Inch Insert and Free Engraving.51-7825Academiccustom-pageacademic-resource-hub11Discover effective teacher resources for motivating students! From classroom rewards to recognition systems, find creative tools that inspire learning and celebrate student achievements.custom-pagegifts-desk-general11personalized gifts105503-610.45165.25Classic MedallicsGiftsEngraved Gifts1:22%Shop for Teacher's Apple Clock Awards from TrophyCentral.Engraved Clocks, Teacher's Award, Academiccustom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these high-quality Teacher's Award Inserts at TrophyCentral. Each Teacher's Award Insert can be used to create a unique plaque, medal or trophy.517805Academic
    custom-pageteacher-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"br24103-05-2011Academic, Teacher's Awardcustom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these high-quality Teachers The Core Of Education Inserts at TrophyCentral. Each Teachers The Core Of Education Insert can be used to create a unique plaque, medal or trophy.518388Academic, Academic
    custom-pageachievement-certificates-awards1"Download Only"free-academic49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Teaching Excellence Award template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Teaching-Excellence-Award-Certificateteaching-excellence-awardTeacher, Appreciation, Academiccustom-pagescholarship-resource-hub11Student character documentation system: weekly check-ins, monthly reviews, portfolio building. Develops self-awareness while preparing scholarship applications.custom-pagefreeawardcertificates1"Download Only"free-sports4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Team Award template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Team-Award-Certificateteam-award-freeTeam, Business, Academiccustom-pagesports-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these high-quality Team Mother Inserts at TrophyCentral. Each Team Mother Insert can be used to create a unique plaque, medal or trophy.51765412-20-2020General
    custom-pageblog-trophycentral11Season-end award strategies for youth sports teams. Universal and sport-specific categories for soccer, basketball, baseball, softball, volleyball, football.custom-pageschool-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:30%,100:35%,500:48%"School Pins" "School Lapel Pins"Find These Fabulous Teamwork Lapel Pins Discounted At Top-Rated TrophyCentral.hp2409-01-2019General, Academic, Businesscustom-pagecorporatepinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsBusiness1:30%,50:32%,100:35%,500:39%Find this Teamwork Leads To Success Pin at TrophyCentral. Lapel pins feature a high quality finish and clutch back, Fast 1-2 day shipping.br535Business, General, Academiccustom-pageeawardmedals12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    medals105503-60.75130033.75Classic Medallicsaward-medalsGeneral1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "School Medals" "General Award Medals"These inexpensive 1 1/4 inch Teamwork Medals offer a high quality, but low price for those on a tight budget.e9196General, Business, Academic
    custom-pagegeneral-corporate-awards1plaques498552-41JDSPlaques1Find this Teamwork Plaque discounted at TrophyCentral. Our teamwork plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Teamworkcustom-pagecorporatepinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsBusiness1:30%,50:32%,100:35%,500:39%Find these Teamwork Wins the Race Pins discounted at TrophyCentral. Each lapel pin features a gold finish and clutch-back. Fast shipping!br520Businesscustom-pagemedallion-inserts-general-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these quality Television Inserts (Litho) at TrophyCentral. Each Television Insert can be used to create a unique plaque, medal or trophy.507407Occupations
    custom-pagepickleball-trophiesqttennisncmoxtmatetrwge471wbt671qttennisscqttennisdmqttennisyrqttennisplqttennisttqttennisttwqttennis3cqttennistrqttennisperptr7006tr700949-7649mqttennisscbcup-tennis-scbcup-tennis-pchamp-cup-tennis-tctennis-part-itennis-single-itennis-champ-itennis-plaque-itennis-e-part-itennis-e-single-icup-tennis-scb-icup-tennis-inbdg-tennistennis-u-pbtennis-mctennis-mgtennis-mc-pre9024tm9991gtennis-jigftennis-jibftennis-jisftennismedals1trophies1"Tennis Awards" "Sports Trophies"

    Find Custom Tennis Recognition Trophies and Awards with Ease at Trophy Central

    Trophy Central has an industry-leading selection of tennis trophies and plaques. Be sure to see our popular Motion Xtreme Series and column trophies. All of our trophies include up to three lines of FREE ENGRAVING (larger awards include additional lines). Medals include a free ribbon.

    Shop with Confidence at Trophy Central

    If you are looking to buy online, look no further! Our top-rated representatives are happy to assist you with all of your needs. Our experts in New York and Michigan have been providing suggestions and guidance since 1999, serving over 370 Fortune 500 companies and more than 9,600 educational institutions.
    Do you need help selecting a trophy or choosing engraving? Be sure to see our trophy resources:

    Frequently Asked Questions

    What engraving options are available for tennis awards?

    All tennis trophies include free engraving services where you can add player names, tournament titles, dates, team names, and personalized messages. Our expert engraving team ensures crisp, professional lettering that enhances your plaques or insert medals' appearance and creates a meaningful keepsake.

    How quickly can tennis trophies be shipped?

    Most tennis medals and trophies ship within 1-2 business days after engraving is completed, with expedited options available for urgent tournaments or events. Orders over $99 qualify for free shipping, and we work with reliable carriers like UPS to ensure your trophies and plaques arrive safely and on time.

    Do you offer bulk discounts on tennis awards?

    Yes. We pride ourselves on providing low prices and bulk discounts on large tournaments or team orders, helping you save more while maintaining award quality. Call or email our team for custom quotes on bulk purchases, and we'll ensure you get the best value for your tennis recognition needs.

    Can I see examples of engraving layouts before ordering?

    Our page features engraving guides and samples of our tennis medals to help you visualize different designs and layout options for your tennis trophies. Our customer service team can also provide personalized assistance and suggestions to ensure you make an informed choice and get an engraving that looks perfect and captures the achievement appropriately.
    ]]>
    silver-cup-trophies 1st-place-medals
    custom-pagesports-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Tennis Medals"Buy these quality Tennis (GENERAL) Inserts (Litho) at TrophyCentral. Each 2 inch Insert can be used to create a unique plaque, medal or trophy.497649Tennis, Sports
    custom-pagetrophies-tennis1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.7169.14Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,10:25%,25:27%"Tennis Trophies" "Tennis Trophy"This fun Tennis (Male) 'Burst Thru' trophy has an exciting and captivating design that your athletes and kids will love. Tennis (Male) trophies include free engraving.wbt671See morein a large variety of styles and sizes.trophies-tennisTennis, Sportscustom-pagetennismedals120498552-40.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find these colorful Tennis 2" Epoxy-covered insert decals discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Tennis, Sportscustom-pagetrophies-tennis11"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"medals498852-30.3716021.6Quick Trophyaward-medalsSports, Hobby, Org, Livestock1:14%,10:25%,100:36%"Tennis Awards" "Award Medals - All Subjects" "Sports Medals" "Tennis Medals"Find these 2 inch quick-ship antique gold medals with a tennis design discounted online at TrophyCentral. Medals include ribbon and ship fast - just 1-2 days!tennismedals1Tennis, Sportscustom-pagetrophies-tennis1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.451 2 3 4 5 6 7 8 911224.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,6:24%,12:26%,24:29%,48:31%"Tennis Awards"Star Series male tennis trophies have been meticulously sculptured and hand painted in an antique gold finish with a star shape base.tr7009Tennis, Sportscustom-pagetrophies-tennis1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with tennis figure discounted at TrophyCentral. Includes free text engraving!cup-tennis-pTennis, Sportscustom-pagetrophies-tennis1498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Find this budget tennis award trophy discounted at Trophy Central. Features a real marble base and plastic male or female tennis figure. Engraving is free. Fast 1-2 day shipping.1trophies-tennisTennis, Sportscustom-pagefree-sports-templates1"Download Only"free-sports49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Tennis template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Tennis-Certificatetennis-freeTennis, Sportscustom-pagecoaching-teaching-guides11Creative tennis award ideas with engraving examples for your team banquet. From Ace Machine to Dig Master, discover 15+ unique ways to recognize every player with actual trophy wording templates.custom-pagetrophies-tennis12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    "PT1=Medals" "PC12=105503-60.75130033.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,100:28%,500:34%,1000:45%"Tennis Awards" "Tennis Medals"These inexpensive 1 1/4 inch Tennis Medals offer a high quality, but low price for those on a tight budget.1tennismedals102-15-2015Tennis, Sports
    custom-pagetrophies-tennis1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Tennis Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Tennis, Sportscustom-pagetrophies-tennis1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Tennis Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Tennis, Sportscustom-pagetrophies-tennis1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Tennis Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Tennis, Sports11Tennis awards for tournaments and clubs. Custom tennis awards for championships, matches, and league recognition. Free engraving available.

    Complete Tennis Awards for Every Tournament & Achievement

    From local club matches to junior development tournaments and professional-style championships, our comprehensive tennis awards collection celebrates the athleticism, strategy, and mental toughness that define the sport of tennis. Whether you're recognizing singles champions, doubles teams, most improved players, or sportsmanship winners, we provide the perfect awards to honor players' dedication and skill on the court.

    Every tennis award includes free personalization with player names, tournament details, club names, match scores, or championship dates. Our experienced team works with tournament directors, tennis professionals, club managers, and league organizers to provide bulk pricing, rush delivery options, and custom design services. With quality construction designed to commemorate competitive excellence, our awards create lasting memories of tennis success.

    Popular Tennis Award Categories:

    • Tournament Championships: Premium trophies for singles and doubles champions
    • League Recognition: Season champions and division winner awards
    • Junior Development: Youth tournament and skill development recognition
    • Club Championships: Annual club tournament and ladder competition awards
    • Special Achievements: Most improved player and sportsmanship awards
    • Team Tennis: Team championship and captain recognition trophies
    • Participation Awards: Medals and ribbons for all tournament participants

    Need help selecting the perfect tennis awards for your tournament or club event? Our awards specialists understand the competitive nature and traditions of tennis and can assist with product recommendations, bulk pricing, and custom engraving options.Contact us today or explore our other popular sports: Golf Awards, Basketball Awards, and Soccer Awards.

    Ready to honor your tennis champions? Shop our tennis awards collection today and create meaningful recognition that players will treasure for years to come. Every ace, every match point, every victory deserves celebration.

    Do you need help selecting a trophy or choosing engraving? Be sure to see our trophy resources: ]]>
    custom-pagesports-resource-hub11Complete guide to tennis awards, tournament recognition, and trophy selection. Learn about professional and amateur tennis awards, USTA programs, and how to celebrate tennis achievements at every level.custom-pagesports-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Tennis Medals"Buy these quality Tennis Court Inserts (Litho) at TrophyCentral. Each Tennis Court Insert can be used to create a unique plaque, medal or trophy.507392Tennis, Sports
    custom-pagetrophies-tennis1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy tennis column insert trophy features a choice of column color, a marble base and free trophy engraving.Tennis, Sportscustom-pagesports-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Tennis Medals"Buy these quality Tennis Female Inserts (Litho) at TrophyCentral. Each Tennis Female Insert can be used to create a unique plaque, medal or trophy.502079Tennis, Sports
    custom-pageholographic-insert-plaques1"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498852-310.45811.6Quick TrophyPlaquesInsert1:14%,3:14%"Tennis Awards"See this stunning Tennis plaque and other Holographic Plaques at TrophyCentral.qsinplaqtennisTennis, Sportscustom-pagetrophies-tennis1medals498552-30.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Colorful Tennis Insert Medals Discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Tennis, Sportscustom-pagetrophies-tennis1medals498552-40.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Tennis Insert Medals With A Personalized Front Rim Discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Tennis, Sportscustom-pagecherry-insert-plaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these tennis insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Tennis, Sportscustom-pagetrophies-tennisplastic-pinbox-t5lapel pins498551-20.525040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find these Gold Tennis Enamel Lapel Pins discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.tennis-u-pbTennis, Sportscustom-pagesports-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Tennis Medals"Buy these quality Tennis Inserts (Litho) at TrophyCentral. Each Tennis Insert can be used to create a unique plaque, medal or trophy.505631Tennis, Sports
    custom-pagesports-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Tennis Medals"Buy these quality Tennis Male Inserts (Litho) at TrophyCentral. Each Tennis Male Insert can be used to create a unique plaque, medal or trophy.506171Tennis, Sports
    tennis-awards1sports-medals1Shop Tennis Medals for players and teams. Customize with engraving. Affordable, fast shipping, and perfect for tennis tournaments and school events.

    Our collection of tennis medals is designed to celebrate every serve, rally and victory. Whether you are hosting a school tournament, rewarding a recreational league or recognizing outstanding performance at a championship, we have the perfect tennis medal to fit the occasion.

    Choose from classic gold, silver and bronze tennis medals, or add a personal touch with custom engraving and colorful ribbons. These medals make lasting keepsakes for players of all ages and levels. With affordable prices and fast shipping, you can count on us to help make your award ceremony a success.

    From junior competitions to high school, college or club events, tennis medals are a timeless way to recognize dedication, sportsmanship and achievement on the court.

    ]]>
    trophies-tennis
    custom-pagesports-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-40.3713003.37Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Tennis Medals"Buy these quality Mylar Tennis Decal Inserts at TrophyCentral. Each tennis decal can be used to create a unique plaque, medal or trophy.489656Tennis, Sports
    custom-pagetrophies-tennis1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our tennis insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - TennisTennis, Sportscustom-pagetrophies-tennis1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy tennis insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Tennis, Sportscustom-pagetrophies-tennis1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%,25:23%,50:29%,100:34%"Tennis Trophies" "Tennis Trophy" "Trophies, Tennis" "Tennis Awards"Our Tennis Participation Trophies feature a real slant-front white marble base and free personalization. Significant quantity discounts available.qttennisncSee more greathere.trophies-tennisTennis, Sportscustom-pagekeychains21105502-40.39125035.39Classic MedallicsGiftsKeychains1:22%,10:25%,25:32%,50:39%,100:47%"Tennis Awards"Find these popular Pewter Tennis Key Chains at TrophyCentral; discounted prices!pk58-cmKeychainscustom-pagetrophies-tennis1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Tennis single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - TennisTennis, Sportscustom-pagetrophies-tennis1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these tennis budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqttennisscbTennis, Sportscustom-pagetrophies-tennis1trophies498551-311821.06TrophyCentraltrophies1Tennis, Sportscustom-pagetrophies-tennis1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%"Tennis Trophies" "Tennis Trophy" "Trophies, Tennis" "Tennis Awards"Find this popular tennis figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!qttennisplSee other greatfor your leagues and tournaments!trophies-tennisTennis, 1st / 2nd / 3rd / Etc., Sportscustom-pagetrophies-tennis1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%"Tennis Trophies" "Tennis Trophy" "Trophies, Tennis"This popular Tennis Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!qttennisyrTennis, Sportscustom-pageofficesigns11"2-3 business days" "Roanoke, Virginia" "UPS (FedEx available on request)"240162-310.455015.45RoanokeOffice Signs1Find tent signs and table number signs discounted at TrophyCentral. Choose sign and lettering color. Each medal includes a neck ribbon. Fast 1-2 day shipping.objid-from-string-test11custom-pageyswtest2111noindexed-items111noindexed-items11Testimonials for TrophyCentral - See what our customers have to say about us. TrophyCentral is a top-rated Yahoo merchant with incredible customer service!custom-pagegeneral-corporate-awards1"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"458221510.45416.45Vision AwardsTrophies1:22%,26:25%"New Products"Find the Tetra Award at TrophyCentral. The Tetra and all corporate awards are discounted and included engraving.custom-pagename-badges-tagswoyoulipr100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Texas Shaped Badges Discounted At TrophyCentral.namebadges-texascustom-pagetrophies-swimming-divingplasticpinboxvelapinbox10star-pins"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"105502-30.31021300060.3Classic Medallicslapel-award-pins1:22%,100:38%,250:42%,500:52%,1000:59%Find These Gold Star Pins Discounted At TrophyCentral! Each Gold Star Pin Includes A Clutch-Back. Large Quantity Discounts.star-pinscustom-pageappreciation-templates1"Download Only"free-appreciation4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Thank You Award template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Thank-You-Award-Certificatethank-you-award-freeThank You, Volunteer, Appreciationcustom-pageawardcertificates1thankyou1thankyoucertificates290631-31 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,25:25%,100:36%,500:51%Find this thank you certificate discounted at TrophyCentral. Thank you certificates are beautifully printed and measure 11 x 8 1/2 inches.963Academic, Thank Youcustom-page9631"Download Only"free-appreciation49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"See this Thank You Certificate designed exclusively for TrophyCentral! Thank You Certificates can be downloaded for free!thankyouThank You, Volunteer, Appreciationcustom-pagevolunteerpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsBusiness1:30%,50:32%,100:35%,500:39%Find these Thank You lapel pins discounted at TrophyCentral. Each Thank You pin features a beautiful finish and clutch back.br380Thank You, Volunteer, Generalcustom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsGeneral1:22%Buy these high-quality Thank You Inserts at TrophyCentral. Each Thank You Insert can be used to create a unique plaque, medal or trophy.518157Volunteer, Thank You
    custom-pagewalnut-insert-plaques1"3-6 business days with engraving, Without engraving: 1-3 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"plaques105503-610.4511219.65Classic MedallicsPlaquesInsert1:22%,3:24%,5:27%Genuine Walnut Thank You Plaque with 2 Inch Insert and Free Engraving.51-8157Thank Youcustom-pagetrophies-volunteer1plaques498552-41JDSPlaques1Find this Thank-You Plaque discounted at TrophyCentral. Our thank-you plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Thank Youcustom-pagetrophies-volunteer11trophies498552-50.452417.49Classic MedallicsTrophiesGeneral1:22%,5:23%,10:25%,20:26%Shop for Thank You Trophies from TrophyCentral. A Perfect Thank You Trophy for Volunteers.Volunteercustom-pageblog-trophycentral11Transform Thanksgiving into meaningful employee recognition. 10 proven strategies from service awards to peer nominations. Budget tips and presentation guide.custom-pagecrystalcups11"7-10 business days w/engraving" "Kentucky" "UPS (FedEx available on request)"410187-1010.45432.45JcharlesTrophies1:22%,25:24%Find This Aspire Award Discounted At TrophyCentral. Price Of The Aspire And Other Trophies Includes Engraving!custom-pageblog-trophycentral11The Class of 2026 earned their graduation the hard way. Discover why this milestone deserves a lasting keepsake and how the right commemorative pin carries their story forward.custom-pagesports-resource-hub11Ultimate guide to fantasy football awards covering championship trophies, consolation prizes, punishment awards, and creative recognition ideas for league commissioners and players.custom-pagetrophy-award-product-resource-guides11Comprehensive guide to award plaques covering materials (wood, acrylic, crystal), engraving options, design choices, and recognition strategies for teachers, coaches, and event planners.custom-pagetrophy-award-product-resource-guides11Master perpetual trophy and plaque selection with our comprehensive guide covering design options, materials, sizing, maintenance, and long-term recognition strategies.custom-pagetrophy-award-guides11Learn how to plan memorable award ceremonies with our comprehensive guide. Get expert tips on venue selection, timing, presentation best practices, and creating meaningful recognition events that inspire and motivate.custom-pagetrophy-award-product-resource-guides11Master ribbon selection with our comprehensive guide covering ribbon types, materials, sizing, colors, and attachment methods for sports, academic, and corporate events.custom-pagesports-resource-hub11Comprehensive guide to football awards for young athletes covering trophies, medals, ribbons, and recognition ideas from Pee Wee leagues through high school football programs.custom-pagetrophy-award-product-resource-guides11Discover the complete guide to award medal types, from Olympic-style medals to academic recognition and sports awards. Learn about materials, designs, customization options, and how to choose the perfect medal for any achievement.custom-pageproduct-engraving-resource-hub111Master ribbon color selection with our comprehensive guide covering traditional place colors, sports ribbons, academic awards, and awareness ribbon meanings for every recognition need.custom-pagequickshiptrophies-goat1perpetual-plate-for-goat-trophytrophies458227-1012.5230.5VisionsTrophies1"General Recognition Awards"Celebrate the Greatest player or performer of All Time with this perpetual cast resin GOAT award with bronze tone and matte black finishes. Engraving included.custom-pageglass-crystal-awards1"10-15 business days w/engraving" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"general105505-1010.451 2 3 4 5 6 7 8 91420.45Classic MedallicsCrystal Awards1:22%,25:24%Shop for The Matterhorn Trophies from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.Leadershipcustom-pagecoaching-teaching-guides11Recognition strategies that actually motivate performance. Learn when to use trophies vs. verbal acknowledgment across workplace, education, and volunteer contexts. Budget-friendly options included. custom-pageemployee-resource-hub11A comprehensive case study on happiness, its psychological and physiological basis, and how to make people smile.custom-pagetrophy-award-product-resource-guides11Discover the world of lapel pins! From sports trading pins to corporate recognition, learn about pin types, designs, and how these tiny treasures make big impacts.custom-pageacademic-resource-hub11Complete guide for PTA and PTO parents covering creative fundraising ideas, volunteer recognition, custom lapel pins, ribbons for events, and building school community spirit.custom-pageglass-crystal-awards1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"general410187-1013423JcharlesCrystal Awards1:22%,25:23%Find the Vanguard award discounted at TrophyCentral. The Vanguard combines eye-catching angles to portray movement and good design.11These beautiful subject plaques combine a laser-engraved theme with your custom text. Each plaque features your choice of size and engraving plate. Free engraving.custom-pagecrystalgifts1optionallogo101"5-10 business days w/engraving" "Mt. Vernon, NY" "UPS (FedEx available on request)"general105505-1010.451856.45Classic MedallicsCrystal Awards1:30%,5:36%Shop for Thick Jaded Glass Clock from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.12-20-2040custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality Third Infantry Division Inserts at TrophyCentral. Each Third Infantry Division Insert can be used to create a unique plaque, medal or trophy.515112Military, Hero, Army
    custom-pagemedallion-inserts-general-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    "PT1=Medals" "G=Unisex" "SC1=105502-4130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these high-quality Third Place Inserts at TrophyCentral. Each Third Place Insert can be used to create a unique plaque, medal or trophy.5134613rd Place
    custom-page1st-place-medals12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    medals105503-60.751 2 3 4 5 6 7 8 9130042.75Classic Medallicsaward-medalsGeneral1:22%,25:24%,50:30%,100:36%,500:42%Shop for Third Place Torch Medals at TrophyCentral. Fast 1-2 Day Shipping!tm9917bSports, Academic, General, Torch, Achievement, 1st / 2nd / 3rd / Etc.
    custom-pagebaseballdisplay11"7-10 business days w/Logo, 4-6 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 2311857Perfect CaseDisplay Cases11:14%,5:17%Three Baseball Glass Display Case. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.basedisplay-310-16-2017Baseball / T-Ball, Sports11Shop for two-tier, three column trophies at TrophyCentral. Each trophy is discounted and includes engraving.1custom-pagequickshiptrophies-cup1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.418Quick TrophyTrophies1:14%,3:19%,10:24%Find These Fabulous Champions Line Cup Trophies Discounted At TrophyCentral. Fast 1-2 Day Shipping!qtcup3cGeneralcustom-pagetrophies1trophies498551-212Trophies1:14%,3:19%,10:24%Find this fabulous two-tier, 3-column champion trophy discounted at TrophyCentral. Fast 1-2 day shipping! Features free engraving. Fast 1-2 day shipping.custom-pagehockeypuckdisplays1"7-10 business days w/Logo, 4-6 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 2311841Perfect CaseDisplay Cases11:14%,5:17%Three Hockey Puck Glass Display Cases from TrophyCentral.hockeydisplay-3Hockey, Sportscustom-pageribbons1rtp6621rtp6615rtp6616rtp6610rtp6617rtp6620rtp6622rtp6612rtp6623rtp6609rtp6619rtsp694rtsp40921ribbons11"School Products" "Quick-Ship Items" "Homecoming Sashes" "Sashes" "Homecoming Sash" "School Sashes" "Pageant Sashes" "Custom Sashes" "Beauty Pageant Sashes" "Graduation Sashes" "Pageant Sash" "Prom Sashes" "Prom Sash"Find beautiful tiaras for proms, homecoming, and weddings. Elegant design, classic and elaborate styles. Bulk discounts. Fast 1-2 days shipping. Order today!Tiaras for Homecoming, Proms, Pageants, and Wedding days Trophy Central offers various prom and homecoming tiaras to suit any style. From classic designs that sparkle with faux diamonds to more elaborate options, our collection has something for everyone. We also offer princess and queen tiaras, perfect for girls of all ages, all at discounted prices.

    Find a Tiara Online with Ease

    Trophy Central has a great selection of inexpensive but fancy plastic crowns that will fit any budget. Our top-rated representatives are happy to assist you with your questions and needs. Our experts in New York, Michigan, and online have been providing suggestions and guidance since 1999. To begin shopping, click on an image above, or for personal service, call us toll-free at 1-888-809-8800.

    Frequently Asked Questions

    Do queen tiaras come in different sizes?

    Yes, our queen tiaras feature adjustable designs and come in various size options to ensure a comfortable and secure fit for different head sizes.

    Will tiaras and crowns match different dress colors?

    Our elegant designs are versatile and complement virtually any outfit you wear. They feature timeless style elements that enhance rather than compete with your attire. Their timeless elegance ensures they complement a wide range of palettes, while crystal accents provide a subtle shine.

    Are these tiaras suitable gifts for special occasions?

    Absolutely, these princess crowns make exceptional present choices for daughters, granddaughters, or anyone celebrating milestones, moments like birthdays and graduations, as well as family celebrations.

    Do you offer discounts, and how fast do items ship?

    Yes, we offer bulk discounts on larger orders, and most in-stock items ship within 1–2 business days.

    ]]>
    banners-spirit ribbons1-crowns
    custom-pagemascot-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Tiger Mascot Badges Discounted At TrophyCentral.mascotbadges-tigercustom-pagemascotpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:30%,100:33%,500:47%"Mascot Awards" "Mascot Pins"Find these Tiger Lapel Pins and other colorful mascot pins at TrophyCentral. Fast 1-2 day shipping!em06Mascotcustom-pagemascot-plaques1plaques498552-41JDSPlaques1Find this tiger plaque discounted at TrophyCentral. Our tiger mascot plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Mascotcustom-pagemascotinserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-40.3713003.37Classic MedallicsInsertsMascots1Buy these quality Tigers Mascot Medal Inserts at TrophyCentral. Each Tigers Insert can be used to create a unique plaque, medal or trophy.489923Mascot
    custom-pagecalendar-whiteboards14512310-171 3 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Time Out Magnetic Whiteboard, 18"H x 24"W discounted at TrophyCentral.1Not Enclosed, Healthcarecustom-pagecalendar-whiteboards14512310-171 3 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Time Out Magnetic Whiteboard, 2'H x 3'W discounted at TrophyCentral.1Not Enclosed, Healthcarecustom-pagecalendar-whiteboards14512310-171 3 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Time Out Whiteboard, 18"H x 24"W discounted at TrophyCentral.1Not Enclosed, Healthcarecustom-pagecalendar-whiteboards14512310-171 3 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Time Out Whiteboard, 2'H x 3'W discounted at TrophyCentral.1Not Enclosed, Healthcarecustom-pagetrophy-resource-guides11Discover expert tips for arranging trophies and awards in a case. Learn how to create balance, highlight achievements, and design a stunning display that stands out.custom-page12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105503-615013.5award-medals1"School Medals" "School Award Medals" "Scholastic Medals" "Scholastic Award Medals" "Academic Medals" "Academic Award Medals" "Medals, School"Your students will love these colorful, Mylar School Medals from TrophyCentral. Medals are available in a large number of subjects and include neck ribbon.tm-medals-all
    custom-pagetrophies-funny-horses-rear1trophies498552-30.45Trophy CentralTrophies1Find this budget toilet bowl award trophy discounted at Trophy Central. Features a real marble base and plastic toilet bowl figure. Engraving is free. Fast 1-2 day shipping.Toilet Bowlcustom-pagetrophies-funny-horses-rear1trophies498552-310.45Trophy CentralTrophies1Our toilet bowl participation trophies feature a real slant-front white marble base and free personalization. Significant quantity discounts available.Toilet Bowlcustom-pagetrophies-funny-horses-rear1trophies498552-31Trophy CentralTrophies1Find these toilet bowl budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Toilet Bowlcustom-pagetrophies-funny-horses-rear1trophies498552-310.45Trophy CentralTrophies1Find this popular toilet bowl figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!Toilet Bowlcustom-pagename-badges-tagswoyoulipr100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Tooth Shaped Badges Discounted At TrophyCentral.namebadges-toothcustom-pagetrophy-and-award-buying-lists11Discover the top 10 baseball trophies, medals, and awards for Little League and youth teams. Free engraving, fast shipping, and quality recognition for every player.custom-pagesports-resource-hub11Discover the best unique trophies and medals for hunting clubs, trap shooting leagues, skeet competitions, and gun club marksmanship events. Free engraving on trophies, free ribbons on medals.custom-pagetrophy-and-award-buying-lists11Discover the top 10 soccer trophies, medals, and awards for youth leagues and tournaments. Free engraving, fast shipping, and quality recognition for every player.custom-pagetrophy-and-award-buying-lists11Explore 12 outstanding volunteer awards from Trophy Central, perfect for recognizing the dedication of community and student volunteers.trophies-volunteercustom-pagetrophy-and-award-buying-lists11Explore the top 14 awards for high-performing students available at TrophyCentral. Each award is designed to recognize and motivate students for their academic achievements and efforts.trophies-academiccustom-pagetrophy-and-award-buying-lists11Explore the top 7 hilarious awards for Fantasy Sports losers. Perfect for adding humor to your fantasy league with these funny trophies and plaques from TrophyCentral.fantasy-trophies-awardscustom-pagetrophy-and-award-buying-lists11Discover the best science fair awards available at Trophy Central, perfect for school science competitions. Browse top trophies, plaques, and ribbons to motivate and recognize student achievements.scienceawardscustom-pagetop-awards-by-category11A comprehensive guide to top academic awards for high school students, including national scholarships, subject-specific recognition, and more.custom-pagetop-awards-by-category11Learn about the top basketball awards in the US, from high school to the professional level. Discover the most prestigious honors, their history, and key players who have won them.1custom-pagetop-awards-by-category11Explore the top high school football teams for the 2024 season, featuring standout players and previous national champions. 1custom-pagefreeawardcertificates1"Download Only"certificates49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Top Performer template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Top-Performer-Certificatetop-performer-freePerforming Arts, Academiccustom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these high-quality Top Producer Award Inserts at TrophyCentral. Each Top Producer Award Insert can be used to create a unique plaque, medal or trophy.518667Occupations
    custom-pagecorporatepinsplasticpinboxvelapinbox5"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsBusiness1:30%,50:32%,100:35%,500:39%"Music Lapel Pins"Find these Top Producer Pins discounted at TrophyCentral. Each lapel pin features a gold finish and clutch-back. Fast 1-2 day shipping!br555Businesscustom-pagetop-awards-by-category11A comprehensive guide to top swimming awards for high school students, including national and international recognitions and scholarships.custom-pagetop-awards-by-category11Explore the top track and field awards for high school students. Learn about prestigious honors that recognize athletic excellence in track events, field events, and more. custom-pagemedallion-inserts-general-medallion-inserts20498552-40.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find these colorful Torch 2" Epoxy-covered insert decals discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Torch, 1st / 2nd / 3rd / Etc.custom-pagemedals-custom-ring50"Standard Service: 8 Business Days from Receipt of Artwork, Rush Service (Extra Charge): 3 Business Days from Receipt of Artwork" "Oxnard, CA" "UPS (FedEx available on request)"medals930335-1010.630033.6Simba Calaward-medalsSports, Hobby, Org, Livestock1:22%,300:40%,500:51%,1000:54%These 2 1/2 inch custom Torch Medals come with an outer-ring which allows you to add your school or league name, date and location.qcm-48Generalcustom-page1st-place-medals1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Torch Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Torchcustom-pagetorch-trophies1trophies498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Torch Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Torchcustom-page1st-place-medals1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Torch Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Torchcustom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceCertificates / CoversEmbosser Seals1:22%,3:28%,5:31%Find these Torch Certificate Seals Discounted at TrophyCentral. Seals are Easy to Apply with a Pressure-Sensitive Backing. Fast shipping!803dtGeneralcustom-page1st-place-medals1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"medals498852-30.38150030Quick TrophyDog TagsSports, Hobby, Org, Livestock1:14%,10:15%Find these Torch Dog Tags Discounted at TrophyCentral. The price of each torch dog tag includes Custom Engraving and Chain!qtdogtorchGeneralcustom-pagetorch-trophies1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy Torch column insert trophy features a choice of column color, a marble base and free trophy engraving.Torch, 1st / 2nd / 3rd / Etc.custom-pagemedallion-inserts-general-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these high-quality Torch Hand Scroll Inserts at TrophyCentral. Each Torch Hand Scroll Insert can be used to create a unique plaque, medal or trophy.51764812-20-2020General
    custom-pagenew-tc-color-medals11st-place-medalsmedals498552-30.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Colorful Torch Insert Medals Discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Torchcustom-pagetorch-trophies1trophies498552-40.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Torch Insert Medals With A Personalized Front Rim Discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Torchcustom-pagecherry-insert-plaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these torch insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.1st / 2nd / 3rd / Etc., Torchcustom-pagetorch-trophies1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these torch insert plaques with a large engraving plate discounted at TrophyCentral. Price includes free text engraving.1st / 2nd / 3rd / Etc., Torchcustom-page1st-place-medals1105502-41130025Classic MedallicsInsertsGeneral1:22%Buy these quality Torch Medal Inserts (Litho) at TrophyCentral. Each Torch Medal Insert can be used to create a unique plaque, medal or trophy.507028Generalcustom-pageplace-medalstorch-mctorch-mc-prtorch-mgtorch-medal-goldtorch-medal-silvertorch-medal-bronzeir27me100gvictorymedalsqcm-48tm9916stm9915gtm9917bqtdogtorchj9665torch-jigftorch-jibftorch-jisfe98xxe9075z98xx1achievement-medals1

    General Achievement Torch Medals and First Place Medals

    Sometimes it is difficult to find the right medal for your event. The place and torch medals in this section are perfect for any occasion. Olympic-style medals are widely recognized and are available in multiple styles - traditional gold, silver and bronze finishes or in full color. Torch and achievement medals are also available in 1st through 6th place designs. Remember, each torch medal includes a free neck ribbon! Whether the medals are for a family reunion or school field day event winners, these inexpensive, but high-quality, reward medallions are sure to be well received. Add some fun to your next event or practice by including some fun facts found on the TrophyCentral Olympics Infographic!

    You can share this graphic on your website as long as you include attribution to http://www.trophycentral.com/1st-place-medals.html with the graphic. Thanks!

    Fun Olympics Facts


    ]]>
    1st / 2nd / 3rd Place, Torchstar-medals torch-trophies
    custom-pagetorch-trophies1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our torch insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - Torch AchievementTorchcustom-pagetorch-trophies1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy Torch insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Torch, 1st / 2nd / 3rd / Etc.custom-pagetorch-trophies1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Torch single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - TorchTorchcustom-pageachievement-trophies-awardstorch-e-part-itorch-e-single-itorch-single-itorch-part-itorch-champ-itorch-plaque-itorch-plaque-iftr9910cup-torch-in1achievement-trophies1Find torch trophies and awards discounted at TrophyCentral. Each torch trophy includes 3 lines of personalization. Fast 1-2 day shipping.

    Custom Torch Trophies & Awards

    Click on a product image above for more details such as size and color options. We offer large quantity discounts and fast 1-2 day shipping.

    Shop with Ease at TrophyCentral

    To start shopping, use our search bar above, or for personal service, call us toll free at 1-888-809-8800. Our reps in Michigan, NY and online would be thrilled to assist you!
    ]]>
    trophies insert-trophies-awards trophies-victory
    custom-pagetorch-trophies1trophies498551-311821.06TrophyCentraltrophies1custom-pagehigh-end-awards1"14 business days" "Erlanger, KY" "UPS"general410187-1010.451 2 3 4 5 6 7 8 9428.45JcharlesGeneral Awards1:22%,25:24%Find the Torchier Award discounted at TrophyCentral. These magical pieces feature lyrical swirls, rhythmic patterns of suspended air bubbles, and free flowing forms that make for fascinating conversation pieces.07-25-2020custom-pagemascotinserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-40.3713003.37Classic MedallicsInsertsMascots1Buy these quality Tornados Mascot Medal Inserts at TrophyCentral. Each Tornados Insert can be used to create a unique plaque, medal or trophy.489920Mascot
    custom-pagesports-inserts1105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Touchdown Football Litho Medal Insert. Ideal for leagues, schools, and tournaments. Fast shipping.507440Sportscustom-pagetrophies-track-field1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1cup-track-pcustom-pagefree-sports-templates1"Download Only"free-sports49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Free-female-track-and-field-certificatefemale-track-and-field-freecustom-pagefree-sports-templates1"Download Only"free-academic49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Free-male-track-and-field-certificatemale-track-and-field-freecustom-pagesporcer1trackfrcertificates290631-21 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,25:27%,100:40%,500:50%"Track Awards"1041custom-pagetrophies-track-field1trackmedals1 1041 eventribbons 9x12cherryp sports"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%,25:23%,50:29%,100:34%qttrackncSee more greatin a large variety of sizes and styles for individuals and teams.trophies-track-fieldcustom-pagetrophies-track-field1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.7169.14Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,5:26%,50:30%"Track Trophy" "Track Trophies"This fun Boys Track trophy has an exciting and captivating design that your athletes and kids will love. Track (Boys) trophies include free engraving.wbt773custom-pagetrophies-track-field12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Track (GENERAL) Inserts (Litho) at TrophyCentral. Each Track (GENERAL) Insert can be used to create a unique plaque, medal or trophy.506641
    custom-pagetrophies-track-field1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.7149.14Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,5:26%,50:30%"Track Trophy" "Track Trophies"This fun Track (Girls) 'Burst Thru' trophy has an exciting and captivating design that your athletes and kids will love. Track (Girls) trophies include free engraving.wbt7748-23-2023custom-pagetrophies-track-field50"Standard Service: 8 Business Days from Receipt of Artwork, Rush Service (Extra Charge): 3 Business Days from Receipt of Artwork" "Oxnard, CA" "UPS (FedEx available on request)"medals930335-1010.630033.6Simba Calaward-medalsSports, Hobby, Org, Livestock1:22%,300:40%,500:51%,1000:54%"Track Medals" "Track Awards"These 2 1/2 inch custom Track (Winged Shoe) Medals come with an outer-ring which allows you to add your school or league name, date and location.qcm-38custom-pagetrophies-track-field20498552-40.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find these colorful Track 2" Epoxy-covered insert decals discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.custom-pagetrophies-track-field1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.451 2 3 4 5 6 7 8 911224.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,6:24%,12:26%,24:29%,48:31%"Track Awards"Star Series male track trophies have been meticulously sculptured and hand painted in an antique gold finish with a star shape base.tr7013custom-pagetrophies-track-field1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.451 2 3 4 5 6 7 8 911224.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,6:24%,12:26%,24:29%,48:31%"Track Awards"Star Series female track trophies have been meticulously sculptured and hand painted in an antique gold finish with a star shape base.tr7012custom-pagecoaching-teaching-guides11Creative track and field award ideas with engraving examples for meets and season banquets. From Sprint Sensation to Iron Athlete, discover 15+ unique ways to recognize track athletes with actual trophy wording templates.custom-pagefree-sports-templates1"Download Only"free-sports49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"See this Track Certificate designed exclusively for TrophyCentral! Track Certificates can be downloaded for free! Each Track Award Certificate measures 11 x 8 1/2 inches.trackfrcustom-pagetrophies-track-field1105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Track GENERAL Female Inserts (Litho) at TrophyCentral. Each Track GENERAL Female Insert can be used to create a unique plaque, medal or trophy.504601custom-pageholographic-insert-plaques1"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498852-310.45811.6Quick TrophyPlaquesInsert1:14%,3:14%"Track Awards"See this stunning Track plaque and other Holographic Plaques at TrophyCentral.qsinplaqtrackcustom-pagetrophies-track-field1medals498552-30.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Colorful Track Insert Medals Discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.custom-pagetrophies-track-field1medals498552-40.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Track Insert Medals With A Personalized Front Rim Discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.custom-pagecherry-insert-plaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these track insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.custom-pagetrackpinsplastic-pinbox-t5lapel pins498551-20.525040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find these Track Gold Enamel Lapel Pins discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.track-u-pbcustom-pagetrophies-track-field12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these unique Track Inserts, with an "all event" design, discounted at TrophyCentral.506501
    custom-pagetrophies-track-field1105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Track Inserts (Litho) at TrophyCentral. Each Track Insert can be used to create a unique plaque, medal or trophy.492991custom-pagetrophies-track-field12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    medals105503-60.75130033.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock Bottles1:22%,100:28%,500:34%,1000:45%"Track Medals"These inexpensive 1 1/4 inch Track Medals offer a high quality, but low price for those on a tight budget.e903906-14-2019
    custom-pagetrophies-track-field12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these high-quality Track Inserts at TrophyCentral. Each Track Insert can be used to create a unique plaque, medal or trophy.517660
    11"Track Medals"See these Track Inserts at TrophyCentral; Each insert measures 2". TrophyCentral is a Top-Rated Yahoo Merchant.trackmedals211Shop for Custom Track & Field Medals with Ease at Trophy Central

    We have a huge selection, low prices, and great customer service. Feel free to call or email us. Our experts would be happy to help you choose the ideal award!

    Many track medals come in gold, silver, and bronze finishes to recognize different levels of achievement. Remember, all medals include a neck ribbon, and all orders are shipped within 1-2 business days.

    Frequently Asked Questions

    What events do your track and field medals cover?

    Our medals cover all major track and field events, including sprints, distance running, hurdles, relay races, high jump, long jump, shot put, discus, javelin, pole vault, and cross country competitions.

    Can I customize medals with our team or event information?

    Absolutely! We offer customization options that allow you to personalize ribbon colors and types to create personalized awards that reflect your organization's identity.

    Are bulk discounts available for large orders?

    Yes, our customers enjoy attractive bulk pricing discounts that make it more affordable to purchase medals for entire teams, large competitions, or multi-event meets.

    What sizes are available for medals?

    Medals come in multiple sizes, ranging from 1 1/4" to 2 3/16 inches, depending on the engraving. See each product page for exact dimensions.

    ]]>
    trackpins
    custom-pagetrophies-track-fieldcl12cl42cl41ec23ec65cl50track-pbcross-country-pbcross-country-u-pbtrack-u-pb11Shop for track pins from TrophyCentral. Find a great selection of track medals and pins.track pins, track lapel pins, track awards, track awards pinsAward Pins: Track When you are looking for an inexpensive way to recognize your track stars and up and comers, the pins in the section above are just what you need. Each track pin has a clutch back for easy and safe attachment to clothing. Pins typically ship in a fast 1-2 business days.]]>trackmedals2 trophies-track-fieldcustom-pagetrophies-track-field1"1-2 business days" "Topeka, Indiana" "UPS (Post Office Priority Mail may also be available)"ribbons465711-21 26120030.36Tower RibbonRibbons11:22%,50:46%Find track ribbons discounted at Trophy Central. Choose from 1st - 6th place, participant and more!custom-pageaward-medalsqttrackncmoxtfetrtr1motionwge473moxtfetrtrwbt774wbt773tr9920qttracktrtr7012tr7013qttrackperpcup-track-pchamp-cup-track-tcmarathon-champ-itrack-champ-itrack-e-part-itrack-plaque-imarathon-plaque-itrack-part-imarathon-e-part-imarathon-part-icup-track-scb-icup-marathon-scb-icup-track-inbdg-tracktrackpinstrack-ribbonsqttrackdmqttrackttqttrackttwqttrackyrqttrackplqttrack3cqttrackscmqttrackscbcup-track-scbtrack-single-imarathon-e-single-itrack-e-single-imarathon-single-iir36e9083e7037ir15ir38ir37ir40ir39ir21ir20e9059e9042e9102e2651e9108e9105e9237e9240e9076e6491e9044e9111e9039e6973e9868e5541z9039z9046trackmedals1tm9992gj9555j9683j9672m156m157m157bm157gm157sm156bm156gm156sqcm-38tm9993gtrack-jigftrack-jisftrack-jibftrack-mctrack-mc-prtrack-mgrunning-e-part-irunning-plaque-irunning-part-irunning-single-irunning-e-single-irunning-champ-imarathon-mcmarathon-mc-prmarathon-jigfmarathon-jisfmarathon-jibfmarathon-single-irunning-jigfrunning-jisfrunning-jibfrunning-mcrunning-mc-prtrack-ei4929915176605046015056915023715060715067315062015066415057515065015069731trophies1"Track Awards" "Cross Country Awards" "Sports Trophies"Find Track Trophies Discounted at TrophyCentral. Each Track Trophy Includes Free Personalization. Medals include a ribbon.

    Custom Track Trophies

    TrophyCentral has an industry-leading selection of track and field trophies in a variety of designs - runners, finish line, stop watch and many more! Be sure to see our popular Classic Line Trophies with a Track Runner Figure, Boy's and Girl's Motion Xtreme Series Track Trophies, and our Track Participation Trophies. All track trophies include free personalization. What are you waiting for - it's time to cross the finish line!

    Shop with Confidence at TrophyCentral!

    If you are looking to buy track trophies online, look no further! TrophyCentral has an industry-leading selection that will fit any budget, all at discounted prices. Our top-rated representatives are happy to assist you with all of your track & running trophy and award needs. Our experts in New York and Michigan have been providing suggestions and guidance since 1999!
    ]]>
    trophies
    custom-pagetrophies-track-field1trophies498551-311821.06TrophyCentraltrophies1custom-pagetrophies-track-field1trackmedals1 1041 eventribbons 9x12cherryp sports"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular track figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!qttrackplcustom-pagetrophies-track-field1trackmedals1 1041 eventribbons 9x12cherryp"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%This popular Track Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!qttrackyr12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
    498555-8.52Use this handy UPS shipment tracker to follow your TrophyCentral package and to determine when it will arrive. Track up to 5 packages at once.
    custom-pagetrophies-track-field12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    medals105503-60.5115014Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,50:28%,100:34%,500:41%"Track Awards" "Award Medals - All Subjects" "Sports Medals" "Track Medals" "Track Ribbons"Find our Track 2" Olympic-Style J-Series Medals at a super price point at TrophyCentral. Large quantity discounts available!Track MedalsTrack Medalsj9555
    custom-pagecounty-fair-awardsqttractorncqttractorscqttractorplqttractoryrqttractorttqttractorttwqttractor3cqttractordmmqttractorscbcup-tractor-scbcup-tractor-p1trophies-livestock-farm-animals1Find Tractor Trophies discounted at TrophyCentral. Each Tractor Trophy includes free engraving. Fast 1-2 day shipping.tractor trophies, tractor trophy, tractor awards, tractor trophies and awards

    Shop For Tractor & Farm Awards With Confidence at TrophyCentral

    We offer a huge selection, discounted pricing and great customer service. Do you need help with some ideas or with ordering? Yes, we sell online, but we have real people who would love to help you! Feel free to call our customer service experts in Michigan, New York and online. TrophyCentral - delivering smiles since 1999!


    ]]>
    custom-pagequickshiptrophies-tractor1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with tractor figure discounted at TrophyCentral. Includes free text engraving!cup-tractor-pcustom-pagequickshiptrophies-tractor1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Fabulous Tractor Figure Place Trophy with 1st, 2nd or 3rd Place Trim, Marble Base and Free personalization. Ships in a fast 1-2 days!qttractorplcustom-pagequickshiptrophies-tractor1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%This popular Tractor Figure Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!qttractoryrcustom-pagequickshiptrophies-tractor1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these tractor budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqttractorscbcustom-pagequickshiptrophies-tractor1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.05Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%Find This Popular Tractor Deluxe Platform Series Trophy Discounted at TrophyCentral. Real Marble Base. Free Personalization!custom-pagebaseballdisplay11"7-10 business days w/Logo, 4-6 without" "Apopka, FL 32712" "UPS (FedEx available on request)"327765-101 3 22 2311413Perfect CaseDisplay Cases1:14%,5:18%Find this trading card glass display discounted at TrophyCentral. This display is great for baseball cards or any type of playing card!Baseball / T-Ball, Sportscustom-pagegeneral-corporate-awards1"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"458221510.45628.05Vision AwardsTrophies1:22%,26:34%Find the Trajectory Global Awards at TrophyCentral. Each Global Award Includes a Gift Box and Free Engraving.custom-pagetrophies-trap-skeet-shooting1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451623.65Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%Find These Popular Trap-Skeet Shooting Deluxe Platform Trophies Discounted at TrophyCentral. Real Marble; Free Engraving!qtshootdmcustom-pagetrophies-trap-skeet-shooting1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with trap skeet shooting figure discounted at TrophyCentral. Includes free text engraving!cup-shoot-pcustom-pagetrophies-trap-skeet-shooting1trophies498551-310.453633.4trophies1Find this budget trap / skeet shooting award trophy discounted at TrophyCentral. Features a real marble base and plastic skeet shooter figure. Engraving is free. Fast 1-2 day shipping.custom-pagetrophies-trap-skeet-shooting1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these trap skeet shooting budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtshootscbcustom-pagetrophies-archeryqtshootncqtshootscqtshootdmqtshootyrqtshootplqtshootttqtshootttwqtshoot3cqttrapperpmqtshootscbcup-shoot-scbcup-shoot-pbdg-trap1trophies1Custom Trap and Skeet Shooting Recognition Trophies TrophyCentral has a great online selection of discounted Skeet Shooting and Trap Shooting trophies. Be sure to see our participation trophies, featuring a great low price. Our single column trophy with a skeet shooter figure is also a customer favorite. All of our trophies include up to three lines of free personalization (larger awards include additional lines).]]>hunting-shooting-medals silver-cup-trophiescustom-pagesilver-cup-trophies11"7-10 business days w/engraving" "Chicago, Illinois" "UPS (FedEx available on request)"trophies606307-101 3 230.456.8RS OwensCrystal Awards1:22%"Golf Awards" "Team Award" "Team Awards"Find this Treviso Sartor European Silver Cup Award Discounted At TrophyCentral.trsaawcu1custom-pagedisplaycases211"7-10 business days" "Connelly Springs, North Carolina" "UPS (FedEx available on request)"display case286127-1010.452.75SpartaCraftDisplay CasesSpecialty Cases11:14%Find this Tri-Column Flag Display Stand discounted at TrophyCentral. Folds flat for easy storage.Flag Casescustom-pagetrophies-track-field1105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Triathlon Inserts (Litho) at TrophyCentral. Each Triathlon Insert can be used to create a unique plaque, medal or trophy.506973custom-pageglass-crystal-awards11"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"general458221510.45312.45Vision AwardsGiftsEngraved Gifts1:22%,26:26%Find this Trident Bent Glass Award with Amethyst Accents Discounted at TrophyCentral. Price Includes Engraving and Gift Box.custom-pagegroomsmengifts1"4 to 7 business days w/initials or name, 10 to 14 w/logo , 3 to 5 for stock items, (rush service available – please call)" "Teaneck, NJ" "UPS (FedEx available on request)"personalized gifts498554-710.453618.45JDS IndustriesGiftsWallets1"Father's Day Gifts" "Unique Gifts" "Personalized Gifts"Find this trifold wallet discounted at TrophyCentral. Each wallet is personalized with your message. Choice of colors.Leather Wallets, Groomsmencustom-pagecrystalcups1"14 business days" "Erlanger, KY" "UPS"410187-1010.451 2 3 4 5 6 7 8 9428.45JcharlesGeneral Awards1:22%,25:24%See this beautiful Trio Vase at TrophyCentral. Vase Includes engraving. TrophyCentral is a Top-Rated Yahoo Merchant.03-29-2015custom-pagefootballdisplay11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231113Perfect CaseDisplay Cases11:14%,5:16%Triple Mini Helmet Glass Display Cases from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.Football, Sportscustom-pagemascotpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:30%,100:33%,500:47%"Mascot Awards" "Mascot Pins"Find these Trojan Lapel Pins and other colorful mascot pins at TrophyCentral. Fast 1-2 day shipping!em1611-21-2009Mascotcustom-pagemascot-plaques1plaques498552-41JDSPlaques1Find this trojan plaque discounted at TrophyCentral. Our trojan mascot plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Mascotcustom-pagemascottrophies1"4-6 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies498553-610.451016.25Classic MedallicsTrophiesAcademic1:22%,5:24%,10:28%,50:32%"Mascot Awards"Buy this Trojan mascot trophy and other mascot awards at TrophyCentral.mt201504-15-2018Mascotcustom-pagemascotinserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-40.3713003.37Classic MedallicsInsertsMascots1Buy these quality Trojans Mascot Medal Inserts at TrophyCentral. Each Trojans Insert can be used to create a unique plaque, medal or trophy.489930Mascot
    custom-pagemusicartpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsMusic, Drama, Art, Dance1:22%,50:30%,100:33%,500:45%"Music Lapel Pins" "Band Lapel Pins" "Music Pins"Find These Trombone Pins Discounted at TrophyCentral. Each Trombone Pin Features a Clutch-Pin Back and Fast 1-2 Day Shipping!mp10Music / Band / Choruscustom-pagetrophies-golf1"10 business days" "Aliquippa, PA" "UPS"trophies1500110-1410.451236.45Glass AmericaCrystal AwardsSports, Hobby, Org, Livestock1:22%,10:25%Troon Golf Awards. Ideal for leagues, schools, and tournaments. Fast shipping.Golf, Sportscustom-pagefree-sports-templatesachievement-trophies-awardscup-trophies-large-and-smallglass-crystal-awardsresin-trophiestrophies-academictrophies-musictrophies-cooking-culinarytr-resin-trophiesrock-n-jox-allclassic-line-all1index1Trophies in 80+ styles. Shop sports trophies, trophy cups, crystal awards, resin sculptures and more. Free custom engraving. Fast 1-2 day turnaround. trophies
  • A guide to different trophy & award types
  • Fun engraving ideas
  • Tips for presenting a trophy or award
  • Trophy personalization ideas and samples
  • 📣 Are you an event manager, distributor or retailer? Be sure to see our: Wholesale & Affiliate Programs.

    Frequently Asked Questions About Trophies

    What types of trophies and awards can I buy at TrophyCentral?

    Browse TrophyCentral's extensive collection of quality achievement trophies, academic trophies, and corporate recognition awards. Choose from column trophies, resin designs, crystal and acrylic awards, and more - all featuring free personalized engraving and fast 1-2 day shipping.

    Can I customize my trophy with engraving?

    Yes! Most trophies at TrophyCentral include free engraving. You can personalize your award with individual names, dates, event titles, and even logos, depending on the product.

    How long does it take to receive a trophy order?

    Most trophy orders ship within 1-2 business days of when the order is placed. Shipping times may vary based on your location and order size. Expedited shipping options are also available during checkout.

    Is there a minimum order requirement?

    No minimum order is required. Whether you need a single trophy for your child or dozens for a team or organization, TrophyCentral is happy to help. Bulk discounts are available for larger orders.

    What if I need help choosing the right award?

    TrophyCentral has a knowledgeable customer service team ready to answer any questions you might have. You can call, email, or use the live chat feature on the website for personalized recommendations and help with customization options.

    ]]>
    11Search for trophies by style at TrophyCentral. Choose from column trophies, resin trophies and many more! Free shipping on orders over $100!Traditional Column Trophies Each of the sections above includes our selection of column trophies that have a consistent look and feel, making them ideal for little league, AYSO or any event where you want to award multiple levels of achievement. All awards have the high-quality bases, either white marble or wood, and all feature the same column styles and colors. Columns are available in many colors; please see individual product pages for details. League and other large orders can take advantage of significant quantity discounts as well as free shipping on online orders over $100.

    Shop With Confidence!

    Whether you need a column trophy for a tournament, contest, or end of season ceremony, TrophyCentral has a style to meet your needs. Remember, we offer free engraving and free shipping on trophy orders over $100! To find the perfect style to meet your needs, click on an image, use our keyword search above, or for personal service, call us toll-free at 1-888-809-8800. ]]>
    11custom-pagetrophy-award-guidesfree-certificate-resourceperpetual-award-guidesribbon-type-guidediploma-cover-guideaward-plaque-guidemedal-buying-guideguide-to-custom-medalslapel-pin-guidetrophy-and-award-buying-liststrophy-resource-guidescustom-pennant-buying-guidechoosing-the-perfect-recognition11Complete trophy and award selection guide covering materials, styles, sizing, and budget considerations. Expert advice for choosing perfect recognition products for every occasion and achievement level.custom-pageindexacademic-resource-hubsports-resource-hubemployee-resource-hubproduct-engraving-resource-hub1top-awards-by-categoryengraving-faqstrophy-buying-guideguide-to-planning-award-ceremoniestrophy-award-product-resource-guidesproduct-engraving-resource-hub1blog-trophycentralcoaching-teaching-guidesambassador-programtrophies-awards-wholesalescholarship-resource-hubask-trophy-expertstandout-awards1index1custom-pagetrophy-resource-guides11Discover the best lighting options for trophy cases, from LED spotlights to ambient and accent lighting. Learn how to highlight awards and protect them at the same time.custom-pagetrophy-award-product-resource-guidesmusic-awards-guidemotivational-medals-guiderising-star-awardspickleball-award-listmotivational-reading-awardswedding-contest-giveaway-ideasscience-competition-awardsstudent-awards7-fantasy-losersfunny-volunteerinexpensive-trophiesfree-motivational-awardsmusic-pin-guideemployee-sales-leadershiptop-volunteer-products10-unique-tennis-awards10-unique-golf-awards10-unique-pickleball-awardstop-10-soccer-awardstop-10-baseball-awards-html11A collection of products lists to help you find the perfect award for your needs.custom-pagetrophy-award-product-resource-guidescreative-trophy-display-ideaschoose-right-trophy-casetips-for-arranging-a-trophy-casetrophy-case-lighting-guide111custom-pagelapel-award-pinsdisplaycases1walmouncasdisplaycases2enclosed-bulletin-boardsnoname111index1"School Products"sleek wall-mounted options to impressive freestanding designs, our cases suit every setting, from schools and sports clubs to offices and personal collections. If you need more information before deciding, see our expert resource section: Our cases are proudly made in the USA by trusted manufacturers like Waddell, known for their quality craftsmanship and attention to detail. Each case is built to last, providing durability while maintaining an elegant presentation. You can choose from a variety of sizes, finishes, and styles - from classic wooden frames to modern glass and metal designs - ensuring that your display perfectly complements the space and style you desire. Beyond aesthetics, our display cases are functional. Adjustable shelving, lockable doors, and protective glass panels make it easy to organize, secure, and showcase your awards. They also help keep your items dust-free and protected from everyday wear, preserving them for years to come. Whether you are commemorating a championship, honoring academic excellence, or celebrating personal milestones, Trophy Central has the right display solution for you. Our expert team is ready to assist you in selecting the perfect case, offering guidance on size, style, and configuration to fit your collection perfectly. Show off your accomplishments with pride and confidence - our trophy cases ensure your awards are not only protected but presented in a way that truly honors your hard work and achievements. Celebrate every victory by giving it the display it deserves. ]]>custom-pagetrophy-award-guidesblog-car-show-awardsblog-types-of-trophiesblog-blue-ribbon-brillianceblog-trophy-room-ideasgolf-trophy-ideasthanksgiving-employee-recognition-guidefirst-semester-teacher-recognition-guidechampionship-season-football-awards-guidecamp-awards-articlederby-awards-articlefamily-awards-articleworkplace-motivation-recognition-strategiesyouth-motivation-recognition-strategieswinter-sports-awards-recognition-ideasteam-sports-season-end-awards-guideacademic-competition-awards-guidewinter-cooking-awards-articlecycling-club-recognition-awardsdance-recital-recognition-awardswrestling-season-recognition-awardsswim-team-recognition-awardsphotography-club-recognition-awardswedding-awards-creative-ideasteacher-appreciation-week-recognitionearth-day-environmental-awards-schoolsprom-spring-formal-recognitionevent-planner-recognition-differentiationwinter-season-spirit-awardsspring-festival-fair-recognitionchess-tournament-recognitionscience-fair-recognitionclass-of-2026-graduation-keepsakecounty-fair-4h-awards-guidereligious-school-recognition-guidespring-baseball-softball-trophy-ideasspring-youth-soccer-awards-guideteacher-appreciation-weekvolunteer-appreciation-month-awardsspring-track-field-awards-guide11Discover expert insights on trophies, awards, recognition programs, and celebration ideas. Trophy Central's blog features tips for choosing the perfect awards and honoring achievements.noindexed-items11Trophy Central Customer Reviews: Visit TrophyCentral to see this and similar Trophies and Awards1noindexed-items11Trophy Central Customer Reviews - All Discounted Trophies, Awards and Promotional Products.1custom-pagecup-trophies-large-and-small1trophies105503-610.61417.4SpartaCraft1:22%"Military Awards"See allCupcustom-pageproduct-engraving-resource-hub111custom-pagechampion-perpetual-trophies11tagsbadges"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"498552-30.35100021TrophyCentral1:14%,100:46%"Engraving"flplwcustom-pageblog-trophycentral12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
    498555-8.52Discover unique and inspiring trophy room ideas with Trophy Central. Explore expert tips on designing the perfect space to display your awards, trophies, and memorabilia.
    custom-pagecup-trophies-large-and-small11trophies105503-610.5511616.55Classic Medallics1:22%Cupcustom-pageproduct-engraving-resource-hub111custom-pageengraving-faqsshop-by-categorytrophiesplaquestagsbadgesaward-medalslapel-award-pinsaward-ribbons-rosettescertificatespersonalized-giftstrophycasestrophy-award-guides12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
    498555-8.52 ]]>do-not-delete-used-in-webstore-template

    Engraved Trophies and Awards

    If you are looking to buy custom trophies, look no further! TrophyCentral carries engraved trophies and recognition products at discounted prices and with fast shipping! Whether you need a single medal or custom trophy to recognize a student achievement, or many awards for corporate teamwork, we can help.

    Custom Trophies to Meet Your Needs

    We specialize in trophies and medals for schools and sports teams, businesses, charities and religious organizations. Remember, online award orders over $100 ship for FREE and all of our trophies and plaques include FREE engraving! Order your high quality custom awards now. To find the perfect engraved plaque or custom award for your needs call our experts in New York and Michigan at 1-888-809-8800. Yes, there are real people there ready and excited to help you. Thank you for visiting!

    ]]>
    custom-page11TrophyCentral - Page Not Found. We are sorry - the page your a looking for has changed or no longer exists. We apologize for any inconvenience!111Articles on employee recognition, presenting trophies and awards and more.recognition trophies, recognition trophy, recognition awards, recognition trophies and awardscustom-page11Free Trophy Coupons for Discount Awards from TrophyCentral.1custom-pagetrophy-award-guidesscholarship-awardteacher-recommendation-letter-guidecollege-essay-tipscollege-essay-mistakes-to-avoidbuilding-character-portfolioscholarship-essay-examples-templateshow-to-request-strong-recommendationswriting-recommendation-letters-frameworkwhat-scholarship-committees-want-to-seebuilding-sportsmanship-award-into-programteam-discussion-guides-characterend-of-season-recognition-ideasscholarship-application-timeline-and-checklistscholarship-interview-tips-and-practice-questionsnomination-letter-templateswhat-makes-strong-coach-recommendationdocumenting-sportsmanship-throughout-the-seasonathlete-nomination-worksheetstudent-nomination-worksheetidentifying-scholarship-worthy-characterbuilding-culture-of-recognitionteaching-students-document-character-growthrecognizing-character-in-athletesscholarship-season-timeline11Complete scholarship application resources for students, nomination guides for teachers and coaches. Essays, templates, and tools to support character-based awards.custom-pagescholarship-resource-hubscholarship-thank-youscholarship-23-24scholarship-form11The TrophyCentral Sportsmanship and Compassion Scholarship Award is for eligible high school seniors attending college. Click for more information regarding the scholarship.11Get your picture in the TrophyCentral Spotlight and be Star!custom-pagemusicartpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsMusic, Drama, Art, Dance1:22%,50:30%,100:33%,500:45%"Music Lapel Pins" "Band Lapel Pins" "Music Pins"Find These Trumpet Lapel Pins Discounted at TrophyCentral. Each Trumpet Pin Features a Clutch-Pin Back and Fast 1-2 Day Shipping!mp506-15-2019Music / Band / Choruscustom-pagetrophies-golf1"10 business days" "Aliquippa, PA" "UPS"trophies1500110-1410.451236.45Glass AmericaCrystal Awards1:22%,10:25%Turnbury Golf Award. Ideal for leagues, schools, and tournaments. Fast shipping.Golf, Sportscustom-pagebaseballdisplay11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.5116.5Perfect CaseDisplay Cases11:14%,5:15%Twelve Baseball Glass Display Case. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.basedisplay-1210-16-2017Baseball / T-Ball, Sportscustom-pagesports-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Cheerleader Medals" "Cheerleading Medals"502291Cheerleading, Sports
    custom-pagebaseballdisplay11"7-10 business days w/Logo, 4-6 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231117Perfect CaseDisplay Cases11:14%,5:17%basedisplay-2bc10-16-2017Baseball / T-Ball, Sportscustom-pagetrophies-track-field12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Two Runners Female Inserts (Litho) at TrophyCentral. Each Two Runners Female Insert can be used to create a unique plaque, medal or trophy.505691
    custom-pagetrophies-track-field1105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Two Runners Male Inserts (Litho) at TrophyCentral. Each Two Runners Male Insert can be used to create a unique plaque, medal or trophy.506071custom-pagetrophies-baseball1trophies498552-310.75219Trophy CentralTrophiesSports, Hobby, Org, Livestock1Quick-Ship Two-Tier Trophy with Baseball Glove Figure. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Baseball / T-Ball, Golden Glovecustom-pagetrophies-basketball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Quick-Ship Two-Tier Trophy - Basketball Shooter. Ideal for leagues, schools, and tournaments. Fast shipping.qtbaskttBe sure to see our other populartrophies-basketballBasketball, Sportscustom-pagetrophies-marksman-shooting-rifle1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:28%Find this awesome Marksman two tier championship trophy discounted at TrophyCentral. Add up to 3 lines of Free Personalization!qtmarksmanttwcustom-pagetrophies-golf1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Quick-Ship Two-Tier Trophy with Golf Figure. Ideal for leagues, schools, and tournaments. Fast shipping.qtgolfttGolf, Sportscustom-pagetrophies-golf1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%"Hole-in-One Awards"Find these fabulous two-tier Hole-In-One Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtholett1-10-2022Golf, Sports, Hole-In-Onecustom-pagetrophies-soccer1trophies498552-310.75219Trophy CentralTrophiesSports, Hobby, Org, Livestock1"Soccer Trophies" "Cheap Soccer Trophies" "Buy Soccer Trophies" "Purchase Soccer Trophies" "Discount Soccer Trophies"Quick-Ship Two-Tier Soccer Trophy with Figure - Style 2. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagetrophies1trophies498551-212Trophies1:14%,3:19%,10:27%Find this fabulous two-tier trophy discounted at TrophyCentral. Available in three sizes. Features free personalization and fast 1-2 day shipping!custom-pagetrophies-wrestling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%"Wrestling Trophies" "Trophies, Wrestling" "Wrestling Trophy"Find this fabulous two-tier Wrestling Trophy discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtwrestttWrestling, Sportscustom-pagequickshiptrophies-chevy1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:26%Find these fabulous two-tier Chevy (57) Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtchevyttcustom-pagetrophies-dance1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.418Quick TrophyTrophiesMusic, Drama, Art, Dance1:14%,3:19%,10:24%"Dance Trophy" "Trophies, Dance" "Dancing Trophies" "Trophies, Dancing"Find these two-tier, 3-column Couples Dancing Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtdance3cDancecustom-pagetrophies-golf1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Quick-Ship Two-Tier 3-Column Trophy - Golf. Ideal for leagues, schools, and tournaments. Fast shipping.qtgolf3cGolf, Sportscustom-pagetrophies-victory11"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.45415.45Quick TrophyTrophiesGeneral1:14%,3:19%,10:27%Find these fabulous two-tier Victory Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!vitrtwotiGeneral1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)""PT1=Trophies" "PC12=105504-6111 2 3 4 5 6 7 8 927Classic MedallicsTrophies1:22%Find this Two-Tier Action Photo Trophy at TrophyCentral. Price includes free engraving!custom-pagetrophies-archery1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous two-tier Archery Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtarchttArchery, Sportscustom-pagetrophies-badminton1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous two-tier Badminton Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtbadmttBadminton, Sportscustom-pagetrophies-dance1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75219Quick TrophyTrophiesMusic, Drama, Art, Dance1:14%,3:19%,10:27%"Ballet Trophies" "Ballet Trophy"Find these fabulous two-tier Ballet Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtballettDancecustom-pagequickshiptrophies-bass1"1-4 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:27%Find these fabulous two-tier Bass Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtbassttFishing, Sportscustom-pagetrophies-beauty-queen1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous Beauty Queen Two-Tier Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qtbeautttBeauty Queencustom-pagetrophies-bicycle-cycling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous Bicyclist Winners Line Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qtbikettBicycling / Cycling, Sportscustom-pagetrophies-billiards1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous two-tier Billiards Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtbillittBilliardscustom-pagetrophies-boxing1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous two-tier Boxing Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtboxttBoxingcustom-pagetrophies-broomball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)""PT1=Trophies" "PC12=498552-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous Broomball Figure Two Tier Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qtbroomtt12-20-2040Broomballcustom-pagequickshiptrophies-bull1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:26%Find these fabulous two-tier Bull Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtbullttcustom-pagequickshiptrophies-camero1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:26%Find these fabulous two-tier Camaro Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtcamarottcustom-pagetrophies-cards-poker1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous two-tier Cards Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtcardsttcustom-pagetrophies-bmx1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.215Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%See this championship trophy with a BMX figure at TrophyCentral. Be sure to see all of our BMX figure awards.qtbmxttwBMXcustom-pagetrophies-paintball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.215Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%See this championship trophy with a Paintball figure at TrophyCentral. Be sure to see all of our Paintball figure awards.qtpaintttwPaintballcustom-pagequickshiptrophies-chevy1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:28%See this championship trophy with a Chevy (57) figure at TrophyCentral. Be sure to see all of our Chevy (57) figure awards.qtchevyttwcustom-pagetrophies-badminton1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.215Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%See this championship trophy with a Badminton figure at TrophyCentral. Be sure to see all of our Badminton figure awards.qtbadmttwBadminton, Sportscustom-pagetrophies-boxing1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.215Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%See this championship trophy with a Boxing figure at TrophyCentral. Be sure to see all of our Boxing figure awards.qtboxttwBoxingcustom-pagequickshiptrophies-pickup1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:28%See this championship trophy with a Car Show, Vintage Pick-up figure at TrophyCentral. Be sure to see all of our Car Show, Vintage Pick-up figure awards.qtvintagepickupttwcustom-pagetrophies-dance1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.215Quick TrophyTrophiesMusic, Drama, Art, Dance1:14%,3:19%,10:28%"Dance Trophy" "Trophies, Dance" "Dancing Trophies" "Trophies, Dancing"See this dance championship trophy with a couples dancing figure at TrophyCentral. Includes free engraving. Fast 1-2 day shipping.qtdancettwDancecustom-pagequickshiptrophies-cow1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:28%See this championship trophy with a Cow figure at TrophyCentral. Be sure to see all of our Cow figure awards.qtcowttwcustom-pagetrophies-cricket1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.215Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%See this championship trophy with a Cricket figure at TrophyCentral. Be sure to see all of our Cricket figure awards.qtcrickttwCricketcustom-pagetrophies-cross-country-skiing1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-411.215Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%"Skiing Trophies" "Skiing Trophy" "Skier Trophies" "Ski Trophies"See this championship trophy with a Cross Country Skiing figure at TrophyCentral. Be sure to see all of our Cross Country Skiing figure awards.qtskiccttwSkiing (Cross Country), Sportscustom-pagetrophies-darts1"1-4 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-411.215Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%See this championship trophy with a Darts figure at TrophyCentral. Be sure to see all of our Darts figure awards.qtdartsttwDartscustom-pagetrophies-figure-skating1"1-4 (typically 1-2) business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-411.215Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%See this championship trophy with a Skating figure at TrophyCentral. Be sure to see all of our Skating figure awards.qtskatettwFigure Skating, Sportscustom-pagetrophies-go-kart1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-411.215Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:28%See this championship trophy with a Go Kart figure at TrophyCentral. Be sure to see all of our Go Kart figure awards.qtcartttwGo Kartcustom-pagetrophies-lacrosse1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.215Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%See this championship trophy with a Lacrosse figure at TrophyCentral. Be sure to see all of our Lacrosse figure awards.qtlacrossettwLacrosse, Sportscustom-pagetrophies-motocross1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-411.215Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%See this championship trophy with a Motocross figure at TrophyCentral. Be sure to see all of our Motocross figure awards.qtmotorttwMotocross, Sportscustom-pagetrophies-racquetball1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-411.215Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%See this championship trophy with a Racquetball figure at TrophyCentral. Be sure to see all of our Racquetball figure awards.qtraqtttwRacquetball, Sportscustom-pagetrophies-skateboarding1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:28%See this championship trophy with a Skateboarding figure at TrophyCentral. Be sure to see all of our Skateboarding figure awards.qtskateboardttwSkateboardingcustom-pagequickshiptrophies-steer1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:28%See this championship trophy with a Steer figure at TrophyCentral. Be sure to see all of our Steer figure awards.qtsteerttwcustom-pagequickshiptrophies-street1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:28%See this championship trophy with a Street Rod figure at TrophyCentral. Be sure to see all of our Street Rod figure awards.qtstreetrodttwcustom-pagetrophies-cheerleading-spirit1cl50 cl107 1035"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%"Cheer Awards" "Cheerleading Awards" "Cheerleader Awards" "Cheerleader Trophies" "Cheerleading Trophies" "Cheerleader Trophy" "Cheerleading Trophy" "Trophies, Cheerleader" "Trophies, Cheerleading"Find these fabulous two-tier Cheerleading Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtcheerttCheerleading, Sportscustom-pagequickshiptrophies-chicken1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:26%Find these fabulous Chicken Figure Winners Line Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qtchickentt11Find these popular two-tier column trophies at TrophyCentral. Each two-tier trophy is available in 3 sizes to recognize different achievement levels.1custom-pagetrophies-cornhole1trophies498552-310.75219TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find these fabulous two-tier cornhole three-column trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!Quick-Ship Two-Tier Trophies with Cornhole FigureCornholecustom-pagequickshiptrophies-cow1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:26%Find these fabulous Cow Figure Winners Line Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qtcowttcustom-pagetrophies-cricket1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous two-tier Cricket Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtcrickttCricketcustom-pagetrophies-cross-country-skiing1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%"Skiing Trophies" "Skiing Trophy" "Skier Trophies" "Ski Trophies"Find these fabulous two-tier Cross Country Skiing Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtskiccttSkiing (Cross Country), Sportscustom-pagereligioustrophies1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75434.75Quick TrophyTrophiesReligious1:14%,3:19%,10:27%"Religious Awards"Find these fabulous two-tier Cross Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtcrossttReligiouscustom-pagequickshiptrophies-cup1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75219Quick TrophyTrophies1:14%,3:19%,10:27%Find these fabulous two-tier Cup Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtcupttGeneralcustom-pagetrophies-curling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous two-tier Curling Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtcurlttCurling, Sportscustom-pagetrophies-dance1trophies498552-31219TrophiesMusic, Drama, Art, Dance1Find these fabulous two-tier Dance Three-Column Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!mqt-dancer-ttDancecustom-pagetrophies-darts1"1-4 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous Darts Two Tier Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qtdartsttDartscustom-pagetrophies-disc-golf1"1-4 (typically 1-2) business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Quick-Ship Two-Tier Trophies with Disc Golf Figure. Ideal for leagues, schools, and tournaments. Fast shipping.qtdiscttDisc Golfcustom-pagetrophies-downhill-skiing1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%"Skiing Trophies" "Skiing Trophy" "Skier Trophies" "Ski Trophies"Find these fabulous two-tier Downhill Skiing Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtskidownttSkiing (Downhill), Sportscustom-pagetrophies-equestrian-horse1"1-4 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous two-tier Equestrian Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtequestttEquestrian, Sportscustom-pagetrophies-figure-skating1"1-4 (typically 1-2) business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous two-tier Figure Skating Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtskatettFigure Skating, Sportscustom-pagequickshiptrophies-fireman1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75434.75Quick TrophyTrophiesHero1:14%,3:19%,10:27%Find these fabulous Firefighter Two-Tier Trophies discounted online at TrophyCentral. Quick 1-2 day shipping! Free Personalization!qtfiremanttFirefighter, Herocustom-pagetrophies-football1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Quick-Ship Two-Tier Trophies with Football Figure. Ideal for leagues, schools, and tournaments. Fast shipping.qtfootttFootball, Sportscustom-pagetrophies-funny-horses-rear1trophies498553-Feb10.75Trophy CentralTrophies1Find these fabulous two-tier comic turkey three-column trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!Funny / Gagcustom-pagetrophies-go-kart1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:26%Find these fabulous two-tier Go Kart Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtcartttGo Kartcustom-pagetrophies-hockey-goalie1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous two-tier Goalie Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtgoalttHockey, Sportscustom-pagequickshiptrophies-goat1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:26%Find these fabulous two-tier Goat Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtgoatttcustom-pagequickshiptrophies-graduate1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.75219Quick TrophyTrophiesAcademic1:14%,3:19%,10:27%Find these fabulous two-tier Graduate Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtgradttGraduation, Academiccustom-pagetrophies-gymnastics1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%"Gymnastics Awards" "Gymnastics Trophies" "Gymnast Trophies" "Gymnastics Trophy" "Gymnast Trophy"Find these fabulous Gymnastics Figure Winners Line Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qtgymttGymnastics, Sportscustom-pagetrophies-ice-hockey1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%"Hockey Awards" "Hockey Trophies" "Ice Hockey Trophies" "Hockey Trophy" "Ice Hockey Trophy"Find these fabulous two-tier Hockey Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qthockttHockey, Sportscustom-pagetrophies-karate-martial-arts1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous two-tier Karate Three-Column Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtkaratettKarate / Martial Arts, Sportscustom-pagetrophies-lacrosse1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous two-tier Lacrosse Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtlacrossettSee more championshipin other sizes.trophies-lacrosseLacrosse, Sportscustom-pagetrophies-marksman-shooting-rifle1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous two-tier Marksman Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtmarksmanttcustom-pagequickshiptrophies-marlin1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous two-tier Marlin Fish Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtmarlinttFishing, Sportscustom-pagetrophies-motocross1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous two-tier Motocross Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtmotorttMotocross, Sportscustom-pagetrophies-music1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75219Quick TrophyTrophiesMusic, Drama, Art, Dance1:14%,3:19%,10:27%"Music Trophies"Find these fabulous two-tier Music Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtmusicttBe sure to see our full selection ofin a large variety of sizes and styles.trophies-musicMusic / Band / Choruscustom-pagetrophies-paintball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous two-tier Paintball Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtpaintttPaintballcustom-pagepickleball-trophies1trophies498552-310.75Trophy CentralTrophies1Find these fabulous two-tier pickleball three-column trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!Pickleball, Sportscustom-pagequickshiptrophies-pig1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:26%Find these fabulous two-tier Pig Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtpigttcustom-pagetrophies-pinewood-derby-scouts1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.75219Quick TrophyTrophiesAcademic1:14%,3:19%,10:27%Find these fabulous two-tier Pinewood Derby Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtpinettPinewood Derbycustom-pagequickshiptrophies-rabbit1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:26%Find these fabulous Rabbit Figure Winners Line Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qtrabbitttcustom-pagetrophies-racquetball1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous two-tier Racquetball Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtraqtttRacquetball, Sportscustom-pagetrophies-roller-hockey1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous two-tier Roller Hockey Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtrollerttRoller Hockey, Sportscustom-pagetrophies-sailing-boat1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous two-tier Sailboat Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtsailboatttBoating / Sailing, Sportscustom-pagequickshiptrophies-sheep1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:26%Find these fabulous two-tier Sheep Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtsheepttcustom-pagetrophies-skateboarding1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous Skateboarding Figure Winners Line Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qtskateboardttSkateboardingcustom-pagetrophies-trap-skeet-shooting1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous two-tier Skeet Shooting Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtshootttcustom-pagetrophies-snowboarding1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:27%Find these fabulous two-tier Snowboarding Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtsnowboardttSnowboarding, Sportscustom-pagetrophies-snowmobile1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:26%Find these fabulous Snowmobile Figure Winners Line Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qtsnowttSnowmobilecustom-pagetrophies-softball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%"Softball Trophies" "Softball Trophy" "Trophies, Softball"Find these fabulous two-tier Softball Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtsoftttSoftball, Sportscustom-pagetrophies-softball1trophies498552-310.75TrophiesSports, Hobby, Org, Livestock1Find these fabulous two-tier Softball Glove Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!Softball, Golden Glovecustom-pagequickshiptrophies-spelling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75219Quick TrophyTrophiesAcademic1:14%,3:19%,10:27%Find this fabulous two-tier Spelling Bee Trophy discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtspellttSpellingcustom-pagetrophies-drama1trophies498552-31219TrophiesMusic, Drama, Art, Dance1Find these fabulous two-tier Star Performer Three-Column Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!mqt-star-p-ttDrama, Dance, Schoolcustom-pagequickshiptrophies-steer1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:26%Find these fabulous Steer Figure Winners Line Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qtsteerttcustom-pagequickshiptrophies-stock-car1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:26%Find these fabulous two-tier Stock Car Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtscarttcustom-pagequickshiptrophies-street1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:26%Find these fabulous two-tier Street Rod Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtstreetrodttcustom-pagetrophies-swimming-diving1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous Swimmer Two Tier Trophies Discounted at TrophyCentral. Fast 1-2 Day Shipping! Free Personalization!qtswimttSwimming / Diving, Sportscustom-pagetrophies-t-ball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous two-tier T-Ball Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qttballttBaseball / T-Ball, Sportscustom-pagetrophies-table-tennis-ping-pong1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous two-tier Table Tennis / Ping Pong Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtttennisttTable Tennis / Ping Pong, Sportscustom-pagetrophies-tennis1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%"Tennis Trophies" "Tennis Trophy" "Trophies, Tennis"Find these fabulous two-tier Tennis Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qttennisttTennis, Sportscustom-pagequickshiptrophies-chevy1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.4226Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:18%,10:23%Find these fabulous two-tier, 3-column champion Chevy (57) Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtchevy3ccustom-pagetrophies-academic1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.418Quick TrophyTrophiesAcademic1:14%,3:19%,10:24%Find these fabulous two-tier, 3-column champion Academic Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtacad3cAcademiccustom-pagetrophies-archery1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous two-tier, 3-column champion Archery Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtarch3cArchery, Sportscustom-pagetrophies-badminton1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous Badminton Three-Column Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtbadm3cBadminton, Sportscustom-pagetrophies-dance1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.418Quick TrophyTrophiesMusic, Drama, Art, Dance1:14%,3:19%,10:24%"Ballet Trophies" "Ballet Trophy"Find these fabulous two-tier, 3-column champion Ballet Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtballe3cDancecustom-pagequickshiptrophies-bass1"1-4 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-411.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find These Fabulous Bass Fishing Three Column Champions Line Trophies Discounted Online at TrophyCentral. Fast 1-2 Day Shipping!qtbass3cFishing, Sportscustom-pagetrophies-beauty-queen1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous two-tier, 3-column champion Beauty Queen Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtbeaut3cBeauty Queencustom-pagetrophies-bicycle-cycling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous two-tier, 3-column champion Bicycle Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtbike3cBicycling / Cycling, Sportscustom-pagetrophies-billiards1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous two-tier, 3-column champion Billiards Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtbilli3cBilliardscustom-pagetrophies-bmx1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous two-tier, 3-column champion BMX Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtbmx3cBMXcustom-pagetrophies-bocce-ball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.4226Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous two-tier, 3-column champion Bocce Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtbocce3cBoccecustom-pagetrophies-bowling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%"Bowling Trophies" "Trophies, Bowling" "Bowling Trophy" "Bowling Awards"Find these fabulous two-tier, 3-column champion Bowling Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtbowl3cSee other championshipin many different styles.trophies-bowlingBowlingcustom-pagetrophies-broomball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)""PT1=Trophies" "PC12=498552-311.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous two-tier, 3-column champion Broomball Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtbroom3c12-20-2040Broomballcustom-pagequickshiptrophies-bull1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.4226Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:18%,10:23%Find these fabulous two-tier, 3-column champion Bull Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtbull3ccustom-pagetrophies-cards-poker1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous two-tier, 3-column champion Cards Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtcards3ccustom-pagetrophies-cheerleading-spirit1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%"Cheerleader Trophies" "Cheerleading Trophies" "Cheerleader Trophy" "Cheerleading Trophy" "Trophies, Cheerleader" "Trophies, Cheerleading"Find these fabulous two-tier, 3-column champion Cheer Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtcheer3cSee more championshipin other great styles.trophies-cheerleading-spiritCheerleading, Sportscustom-pagequickshiptrophies-chicken1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.4226Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:18%,10:23%Find these fabulous two-tier, 3-column champion Chicken Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtchicken3ccustom-pagequickshiptrophies-cow1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.4226Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:18%,10:23%Find these fabulous two-tier, 3-column champion Cow Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtcow3ccustom-pagetrophies-cross-country-skiing1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-411.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%"Skiing Trophies" "Skiing Trophy" "Skier Trophies" "Ski Trophies"Find these fabulous two-tier, 3-column champion Cross Country Skiing Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtskicc3cSkiing (Cross Country), Sportscustom-pagetrophies-dance1trophies498552-3118TrophiesMusic, Drama, Art, Dance1Find these fabulous two-tier, 3-column champion Dance Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!mqt-dancer-3cDancecustom-pagetrophies-darts1"1-4 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-411.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous two-tier, 3-column champion Darts Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtdarts3cDartscustom-pagetrophies-disc-golf1"1-4 (typically 1-2) business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-411.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Quick-Ship Two-Tier 3-Column Trophies - Disc Golf. Ideal for leagues, schools, and tournaments. Fast shipping.qtdisc3cDisc Golfcustom-pagetrophies-downhill-skiing1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-411.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%"Skiing Trophies" "Skiing Trophy" "Skier Trophies" "Ski Trophies"Find these fabulous two-tier, 3-column champion Downhill Skiing Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtskidown3cSkiing (Downhill), Sportscustom-pagetrophies-equestrian-horse1"1-4 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-411.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous two-tier, 3-column champion Equestrian Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtequest3cEquestrian, Sportscustom-pagequickshiptrophies-tractor1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.4226Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:18%,10:23%Find these fabulous Farm Tractor Champions Line Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qttractor3ccustom-pagetrophies-figure-skating1"1-4 (typically 1-2) business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-411.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous two-tier, Champions Line 3-Column Figure Skating Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtskate3cFigure Skating, Sportscustom-pagequickshiptrophies-fireman1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.4226Quick TrophyTrophiesHero1:14%,3:19%,10:24%Find these fabulous Fireman Line 3-column Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qtfireman3cFirefighter, Herocustom-pagetrophies-football1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Quick-Ship Two-Tier 3-Column Trophies - Football. Ideal for leagues, schools, and tournaments. Fast shipping.qtfoot3cFootball, Sportscustom-pagetrophies-go-kart1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-411.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:18%,10:23%Find these fabulous two-tier, 3-column champion Go Kart Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtcart3cGo Kartcustom-pagetrophies-hockey-goalie1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-411.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous two-tier, 3-column champion Goalie Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtgoal3cHockey, Sportscustom-pagequickshiptrophies-goat1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.4226Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:18%,10:23%Find these fabulous Champions Line 3-Column Goat Trophies discounted at TrophyCentral. Free personalization and fast 1-2 day shipping!qtgoat3ccustom-pagequickshiptrophies-graduate1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-411.418Quick TrophyTrophiesAcademic1:14%,3:19%,10:24%Find these fabulous two-tier, 3-column champion Graduate Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtgrad3cGraduation, Academiccustom-pagetrophies-ice-hockey1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%"Hockey Trophies" "Ice Hockey Trophies" "Hockey Trophy" "Ice Hockey Trophy"Find these fabulous two-tier, 3-column champion Hockey Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qthock3cHockey, Sportscustom-pagetrophies-karate-martial-arts1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous two-tier, 3-column champion Karate Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtkarate3cSee morefor your champions!trophies-karate-martial-artsKarate / Martial Arts, Sportscustom-pagetrophies-lacrosse1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%"Lacrosse Awards"Find these fabulous two-tier, 3-column champion Lacrosse Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtlacrosse3cLacrosse, Sportscustom-pagetrophies-marksman-shooting-rifle1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.4226Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous Marksman Three-Column Trophies discounted at TrophyCentral. Fast 1-2 day shipping!qtmarksman3ccustom-pagequickshiptrophies-marlin1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.4226Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous Marlin Fish Champions Line 3-Column Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qtmarlin3cFishing, Sportscustom-pagetrophies-motocross1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-411.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous Champions Line 3-Column Motocross Trophies discounted at TrophyCentral. Free personalization and fast 1-2 day shipping!qtmotor3cMotocross, Sportscustom-pagetrophies-music1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.418Quick TrophyTrophiesMusic, Drama, Art, Dance1:14%,3:19%,10:24%"Music Trophies" "Music Trophy"Find these fabulous two-tier, 3-column champion Music Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtmusic3cMusic / Band / Choruscustom-pagetrophies-paintball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous two-tier, 3-column champion Paintball Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtpaint3cPaintballcustom-pagequickshiptrophies-pig1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.4226Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:18%,10:23%Find these fabulous two-tier, 3-column champion Pig Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtpig3ccustom-pagequickshiptrophies-rabbit1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.4226Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:18%,10:23%Find these fabulous Champions Line 3-Column Rabbit Trophies discounted at TrophyCentral. Free personalization and fast 1-2 day shipping!qtrabbit3ccustom-pagetrophies-racquetball1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-411.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous two-tier, 3-column champion Racquetball Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtraqt3cRacquetball, Sportscustom-pagereligioustrophies1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.4226Quick TrophyTrophiesReligious1:14%,3:19%,10:24%"Religious Awards"Find these fabulous two-tier, 3-column Religious Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtcross3cReligiouscustom-pagetrophies-roller-hockey1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-411.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous two-tier, 3-column champion Roller Hockey Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtroller3cRoller Hockey, Sportscustom-pagetrophies-sailing-boat1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.4226Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous Champions Line 3-Column Sailboat Trophies discounted at TrophyCentral. Free personalization and fast 1-2 day shipping!qtsailboat3cBoating / Sailing, Sportscustom-pagequickshiptrophies-sheep1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.4226Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:18%,10:23%Find these fabulous Sheep Figure Champions Line 3-Column Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qtsheep3ccustom-pagetrophies-skateboarding1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.4226Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous two-tier, 3-column champion Skateboarding Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtskateboard3cSkateboardingcustom-pagetrophies-snowboarding1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.4226Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:18%,10:23%Find these fabulous two-tier, 3-column champion Snowboarding Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtsnowboard3cSnowboarding, Sportscustom-pagetrophies-snowmobile1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-411.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:18%,10:23%Find these fabulous two-tier, 3-column champion Snowmobile Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtsnow3cBaseball / T-Ball, Sportscustom-pagetrophies-softball1trophies498552-311.4TrophiesSports, Hobby, Org, Livestock1Find these fabulous two-tier, 3-column champion Softball Glove Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!Softball, Golden Glovecustom-pagetrophies-softball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%"Softball Trophies" "Softball Trophy" "Trophies, Softball" "Softball Awards"Find these fabulous Softball Line 3-column Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qtsoft3cSee other championshipin a variety of sizes.trophies-softballSoftball, Sportscustom-pagequickshiptrophies-spelling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.418Quick TrophyTrophiesAcademic1:14%,3:19%,10:24%Find these fabulous two-tier, 3-column champion Spelling Bee Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtspell3cSpellingcustom-pagequickshiptrophies-steer1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.4226Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:18%,10:23%Find these fabulous Steer Champions Line 3-Column Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qtsteer3ccustom-pagequickshiptrophies-stock-car1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-411.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:18%,10:23%Find these fabulous two-tier, 3-column champion Stock Car Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtscar3cCar Showcustom-pagequickshiptrophies-street1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.4226Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:18%,10:23%Find these fabulous Street Rod Champions Line 3-Column Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qtstreetrod3ccustom-pagetrophies-swimming-diving1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous two-tier, 3-column champion Swimming Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtswim3cSwimming / Diving, Sportscustom-pagetrophies-table-tennis-ping-pong1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-411.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous two-tier, 3-column champion Table Tennis / Ping Pong Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtttennis3cTable Tennis / Ping Pong, Sportscustom-pagetrophies-tennis1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%"Tennis Trophies" "Tennis Trophy" "Trophies, Tennis"Find these fabulous two-tier, 3-column champion Tennis Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qttennis3cReturn to the section for more popular awards.trophies-tennisTennis, Sportscustom-pagetrophies-track-field1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous two-tier, 3-column champion Track Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qttrack3ccustom-pagetrophies-trap-skeet-shooting1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-411.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous two-tier, 3-column champion Trap-Skeet Shooting Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtshoot3ccustom-pagetrophies-victory11"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.4518Quick TrophyTrophiesGeneral1:14%,10:24%Find these fabulous two-tier, 3-column champion Victory Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!vitr1Generalcustom-pagequickshiptrophies-pickup1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.4226Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:18%,10:23%Find these fabulous Champions Line 3-Column Vintage Pick-Up Trophies discounted at TrophyCentral. Free personalization and fast 1-2 day shipping!qtvintagepickup3ccustom-pagetrophies-volleyball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find this fabulous two-tier, 3-column champion trophy with a volleyball figure discounted online at TrophyCentral. Fast 1-2 day shipping!qtvolly3cVolleyball, Sportscustom-pagetrophies-weightlifting-power1"1-4 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-411.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:18%,10:23%Find these fabulous two-tier, 3-column champion Weightlifting Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtlift3cWeightlifting, Sportscustom-pagequickshiptrophies-wheel1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.4226Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:18%,10:23%Find these fabulous two-tier, 3-column champion Winged Wheel Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtwingedwheel3c03-15-2022custom-pagetrophies-wrestling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%"Wrestling Trophies" "Trophies, Wrestling" "Wrestling Trophy"Find these fabulous two-tier, 3-column champion Wrestling Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtwrest3cWrestling, Sportscustom-pagetrophies-gymnastics1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-411.418Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%"Gymnastics Trophies" "Gymnast Trophies" "Gymnastics Trophy" "Gymnast Trophy"Find these fabulous two-tier, 3-column champion Gymnastic Figure Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtgym3cGymnastics, Sportscustom-pagetrophies-funny-horses-rear1trophies498552-310.75Trophy CentralTrophies1Find these fabulous two-tier toilet bowl three-column trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!Toilet Bowlcustom-pagetrophies-track-field1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous two-tier Track Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qttrackttcustom-pagequickshiptrophies-tractor1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:26%Find these fabulous two-tier Tractor Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qttractorttcustom-pagequickshiptrophies-pickup1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:26%Find these fabulous Vintage Pick-Up Figure Two Tier Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qtvintagepickupttcustom-pagetrophies-volleyball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find this fabulous two-tier Volleyball Trophy discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtvollyttVolleyball, Sportscustom-pagetrophies-weightlifting-power1"1-4 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:26%Find these fabulous two-tier Weightlifting Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtliftttWeightlifting, Sports12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
    498555-8.52
    custom-pageletter-shaped-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find these popular U-shaped custom mascot badges at TrophyCentral. Great for fundraising! TrophyCentral is a top-rated Yahoo merchant.letterbadges-ucustom-pagemedallion-inserts-military-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsHero1:22%Buy these U.S. Army Medical Corps Inserts discounted at TrophyCentral. Each U.S. Army Medical Corps Insert can be used to create a unique plaque, medal or trophy.517572Military, Hero, Army
    custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsHero1:22%Buy these U.S. Army Signal Corps Inserts discounted at TrophyCentral. Each U.S. Army Signal Corps Insert can be used to create a unique plaque, medal or trophy.51757012-20-2020Military, Hero, Army
    custom-pagemedallion-inserts-government-agencies-and-logos12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-40.37160096.37Classic MedallicsInsertsHero1:22%Buy these high-quality U.S. Border Patrol Inserts at TrophyCentral. Each U.S. Border Patrol Insert can be used to create a unique plaque, medal or trophy.518913Military, Hero
    custom-pagemedallion-inserts-government-agencies-and-logos12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsHero1:22%"Award Medals" "Award Medals - All Subjects" "Medals - All Others"Buy these high-quality U.S. Dept. Of Homeland Security Inserts discounted at TrophyCentral. Each U.S. Dept. Of Homeland Security Insert can be used to create a unique plaque, medal or trophy.518476Military, Hero
    custom-pagemedallion-inserts-government-agencies-and-logos12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsHero1:22%"Award Medals" "Award Medals - All Subjects" "Medals - All Others"Buy these U.S. Environmental Protection Inserts discounted at TrophyCentral. Each U.S. Environmental Protection Insert can be used to create a unique plaque, medal or trophy.517656Military, Hero
    custom-pagename-badges-tagswoyoulipr100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom U.S. Shaped Badges Discounted At TrophyCentral.namebadges-uscustom-pagetrophies-soccer1trophies105503-610.45110.85Classic MedallicsTrophiesSports, Hobby, Org, Livestock1"Soccer Awards"Ultimate Line Soccer Ball Trophy - Style 2. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sports11This page is currently under going changes. We apologize for any inconvenience.custom-pagegeneral-corporate-awards1"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"4582215111 2 3 4 5 6 7 8 9628.05Vision AwardsTrophies1:22%,26:35%"Corporate Awards"C-Note Awards with Blue Accents from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.01-05-2018custom-pagetrophy-and-award-buying-lists11Unique and fun contest and giveaway ideas for your wedding, including awards for best dancers, best dressed, and special gifts for your wedding party.1noindexed-items11Unique Copy Center is a TrophyCentral Partner.1custom-pageperplaq1"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"perpetual plaques4582215121 2 3 4 5 6 7 8 9220Vision AwardsTrophies1:22%,26:40%"Corporate Awards"Perpetual Slate Awards from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.See our completesection.perplaqcustom-pagegeneral-corporate-awards11"7-10 business days w/engraving" "Kentucky" "UPS (FedEx available on request)"general410187-1010.45626.85JcharlesGeneral Awards1:22%,25:25%"New Products"Steps to Success from TrophyCentral. Also see our great selection of engraved and personalized gifts!custom-pagestar-trophies11"7-10 business days w/engraving" "Chicago, Illinois" "UPS (FedEx available on request)"trophies606307-101 3 230.45515.45RS OwensTrophiesGeneral1:22%"Star Awards" "Drama Trophies" "Drama Trophy" "Star Award"Reach the stars in Triumph with this inspiring award trophy. Hand cast figure plated in one of two finishes (Satin Silver or Gold) holding a crystal star. Rests on a tall, ebony finished stonecast base.Drama, Star, Generalcustom-pagemedallion-inserts-military-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsHero1:22%Buy these quality United States Air Force (493371) Inserts (Litho) at TrophyCentral. Each United States Air Force (493371) Insert can be used to create a unique plaque, medal or trophy.493371Military, Hero, Air Force
    custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsHero1:22%Buy these quality United States Air Force (505021) Inserts (Litho) at TrophyCentral. Each United States Air Force (505021) Insert can be used to create a unique plaque, medal or trophy.505021Military, Hero, Air Force
    custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality United States Air Force Inserts (Etched, 518466) at TrophyCentral. Each United States Air Force Inserts (Etched, 518466) can be used to create a unique plaque, medal or trophy.518466Military, Hero, Air Force
    custom-pagekeychains21105502-40.39125035.39Classic MedallicsGiftsKeychains1:22%,10:25%,25:32%,50:39%,100:47%"Military Awards"Find these popular Pewter United States Air Force Key Chains at TrophyCentral; discounted prices!pk110-cmKeychainscustom-pagemedallion-inserts-military-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsHero1:22%Buy these quality United States Army Inserts (Litho) at TrophyCentral. Each United States Army Insert can be used to create a unique plaque, medal or trophy.504901Military, Hero, Army
    custom-pagekeychains21105502-40.39125035.39Classic MedallicsGiftsKeychains1:22%,10:25%,25:32%,50:39%,100:47%"Military Awards"Find these popular Pewter United States Army Key Chains at TrophyCentral; discounted prices!pk109-cmKeychainscustom-pagekeychains21105502-40.39125035.39Classic MedallicsGiftsKeychains1:22%,10:25%,25:32%,50:39%,100:47%"Military Awards"Find these popular Pewter United States Coast Guard Key Chains at TrophyCentral; discounted prices!pk107-cm04-30-2020Keychainscustom-pagemedallion-inserts-government-agencies-and-logos12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsHero1:22%"Award Medals" "Award Medals - All Subjects" "Medals - All Others" "Military Medals"Buy these high-quality United States Forest Service Inserts at TrophyCentral. Each United States Forest Service Insert can be used to create a unique plaque, medal or trophy.517034Military, Hero
    custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsHero1:22%Buy these quality United States Marine Corps (505011) Inserts (Litho) at TrophyCentral. Each United States Marine Corps (505011) Insert can be used to create a unique plaque, medal or trophy.505011Military, Hero, Marines
    custom-pagekeychains21105502-40.39125035.39Classic MedallicsGiftsKeychains1:22%,10:25%,25:32%,50:39%,100:47%"Military Awards"Find these popular Pewter United States Marines Corps Key Chains at TrophyCentral; discounted prices!pk111-cmKeychainscustom-pagemedallion-inserts-military-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsHero1:22%Buy these quality United States Navy (505001) Inserts (Litho) at TrophyCentral. Each United States Navy (505001) Insert can be used to create a unique plaque, medal or trophy.505001Military, Hero, Navy
    custom-pagekeychains21105502-40.39125035.39Classic MedallicsGiftsKeychains1:22%,10:25%,25:32%,50:39%,100:47%"Military Awards"Find these popular Pewter United States Navy Key Chains at TrophyCentral; discounted prices! Top-Rated Service!pk108-cmKeychainscustom-pagemedallion-inserts-organizations12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality United Way Inserts (Litho) at TrophyCentral. Each United Way Insert can be used to create a unique plaque, medal or trophy.492701
    custom-pageflaglapelpins1plasticpinboxvelapinbox10flaglapelpins"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsHero1:22%,50:32%,100:39%,500:46%"Flag Pin Section" "Flag Lapel Pins" "Lapel Pins - Flag" "Discount Flag Pins" "Cheap Flag Pins" "Flag Pins Cheap" "Buy Flag Pins" "Shop For Flag Pins" "U.S. Flag Pins" "American Flag Pins" "Flag Pins US" "Flag Pins American"Find this United We Stand American Flag Lapel Pin Discounted at TrophyCentral. American Flag Lapel Pins Ship in Just 1-2 Days!amflpinwiea12-10-2010Flagcustom-pagefootballdisplay11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.5116.5Perfect CaseDisplay Cases11:14%,5:18%Upright Glass Football Display Case. Ideal for leagues, schools, and tournaments. Fast shipping.10-16-2017Football, Sportscustom-pageflaglapelpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsHero1:30%,50:34%,100:46%,500:58%"Flag Pin Section" "Flag Lapel Pins" "Lapel Pins - Flag" "Discount Flag Pins" "Cheap Flag Pins" "Flag Pins Cheap" "Buy Flag Pins" "Shop For Flag Pins"usgecrflpinFlagcustom-pageflaglapelpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsHero1:22%,50:30%,100:40%,500:46%"Flag Pin Section" "Flag Lapel Pins" "Lapel Pins - Flag" "Discount Flag Pins" "Cheap Flag Pins" "Flag Pins Cheap" "Buy Flag Pins" "Shop For Flag Pins" "Military Awards" "U.S. Flag Pins" "American Flag Pins" "Flag Pins US" "Flag Pins American"Find these US Air Force Pins discounted at TrophyCentral. Each Air Force Lapel Pin features a gold finish and clutch-back. Fast 1-2 day shipping!usairfolapi11-25-2010Military, Hero, Air Forcecustom-pagetop-awards-by-category11A comprehensive look at US Amateur Golf for 2024-2025, including major contenders, their backgrounds, and past winners from the last 10 years.1custom-pagetop-awards-by-category11A comprehensive look at US Amateur Tennis for 2024-2025, including major contenders, their backgrounds, and past winners from the last 10 years.1custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsHero1:22%Buy these quality US Army (493341) Inserts (Litho) at TrophyCentral. Each 2" insert can be used to create a unique plaque, medal or trophy.493341Military, Hero, Army
    custom-pageflaglapelpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsHero1:22%,50:30%,100:40%,500:46%"Flag Pin Section" "Flag Lapel Pins" "Lapel Pins - Flag" "Discount Flag Pins" "Cheap Flag Pins" "Flag Pins Cheap" "Buy Flag Pins" "Shop For Flag Pins" "Military Awards" "U.S. Flag Pins" "American Flag Pins" "Flag Pins US" "Flag Pins American"Find these US Army Pins discounted at TrophyCentral. Each Army Lapel Pin features a gold finish and clutch-back. Fast 1-2 day shipping!usarmyflagpins11-25-2010Military, Hero, Armycustom-pagemedallion-inserts-military-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality Us Army Reserve Inserts at TrophyCentral. Each Us Army Reserve Insert can be used to create a unique plaque, medal or trophy.514070Military, Hero, Army
    custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsHero1:22%Buy these quality US Marine Corps (493381) Inserts (Litho) at TrophyCentral. Each 2" insert can be used to create a unique plaque, medal or trophy.493381Military, Hero, Marines
    custom-pageflaglapelpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsHero1:22%,50:30%,100:40%,500:46%"Flag Pin Section" "Flag Lapel Pins" "Lapel Pins - Flag" "Discount Flag Pins" "Cheap Flag Pins" "Flag Pins Cheap" "Buy Flag Pins" "Shop For Flag Pins" "Military Awards" "U.S. Flag Pins" "American Flag Pins" "Flag Pins US" "Flag Pins American"Find these US Marines Pins discounted at TrophyCentral. Each Marines Lapel Pin features a gold finish and clutch-back. Fast 1-2 day shipping!usmausflpin11-22-2012Military, Hero, Marines, Flagcustom-pagemedallion-inserts-military-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsHero1:22%Buy these quality US Navy (493361) Inserts (Litho) at TrophyCentral. Each 2" insert can be used to create a unique plaque, medal or trophy.493361Military, Hero, Navy
    custom-pageflaglapelpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsHero1:22%,50:30%,100:40%,500:46%"Flag Pin Section" "Flag Lapel Pins" "Lapel Pins - Flag" "Discount Flag Pins" "Cheap Flag Pins" "Flag Pins Cheap" "Buy Flag Pins" "Shop For Flag Pins" "Military Awards" "U.S. Flag Pins" "American Flag Pins" "Flag Pins US" "Flag Pins American"Find these US Navy Pins discounted at TrophyCentral. Each Navy Lapel Pin features a gold finish and clutch-back. Fast 1-2 day shipping!usnavyflagpinsMilitary, Hero, Navy, Flagcustom-pageflaglapelpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsHero1:22%,50:32%,100:39%,500:46%"Flag Pin Section" "Flag Lapel Pins" "Lapel Pins - Flag" "Discount Flag Pins" "Cheap Flag Pins" "Flag Pins Cheap" "Buy Flag Pins" "Shop For Flag Pins"ambrflpin08-15-2012Flagcustom-pageflaglapelpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsHero1:30%,50:34%,100:46%,500:58%"Flag Pin Section" "Flag Lapel Pins" "Lapel Pins - Flag" "Discount Flag Pins" "Cheap Flag Pins" "Flag Pins Cheap" "Buy Flag Pins" "Shop For Flag Pins"nonameFlagcustom-pageflaglapelpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsHero1:22%,50:30%,100:40%,500:46%"Flag Pin Section" "Flag Lapel Pins" "Lapel Pins - Flag" "Discount Flag Pins" "Cheap Flag Pins" "Flag Pins Cheap" "Buy Flag Pins" "Shop For Flag Pins" "U.S. Flag Pins" "American Flag Pins" "Flag Pins US" "Flag Pins American"Find These BR Series Statue of Liberty Pins Discounted At TrophyCentral. Fast 1-2 Day Shipping from our Factory in NY. Order In Bulk For Large Discounts!usflpiwistof04-20-2011Flagcustom-pagemedallion-inserts-military-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality USAF Recruiting Service Inserts at TrophyCentral. Each USAF Recruiting Service Insert can be used to create a unique plaque, medal or trophy.511941Military, Hero
    custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality USMC League Semper Fidelis Inserts at TrophyCentral. Each USMC League Semper Fidelis Insert can be used to create a unique plaque, medal or trophy.517581Military, Hero, Marines
    custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality USMC Recruiting Service Inserts at TrophyCentral. Each USMC Recruiting Service Insert can be used to create a unique plaque, medal or trophy.512771Military, Hero, Marines
    custom-pageletter-shaped-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find these popular V-shaped custom mascot badges at TrophyCentral. Great for fundraising! TrophyCentral is a top-rated Yahoo merchant.letterbadges-vcustom-pageeagle-trophies1"10 business days" "Aliquippa, PA" "UPS"trophies1500110-1410.45824.45Glass AmericaCrystal Awards1:22%,10:25%Valor Eagle from TrophyCentral. See our great selection of engraved and personalized gifts!12-20-2020custom-pagetrophies-baseball1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.711012Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,50:31%"Baseball Trophies" "Baseball Trophy" "Baseball Trophies and Medals"wvl451See our complete selection ofin a large number of styles.trophies-baseballBaseball / T-Ball, Sports1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)""PT1=Trophies" "PT1=465713-410.71012Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,50:31%"Football Trophies" "Football Trophy" "Football Awards"Value Line Football Achievement Trophy. Ideal for leagues, schools, and tournaments. Fast shipping.wvl45912-20-2040Football, Sports1cl107 1035"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.711012Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,50:31%"Cheer Awards" "Cheerleading Awards" "Cheerleader Awards" "Cheerleading Trophies" "Cheerleading Trophy" "Cheerleading Awards"These 4 /12 Inch Cheerleading Trophies Include Engraving And Perfect For Younger Children.wvl460See our fabulous spirit and trophies-cheerleading-spiritCheerleading, Sports1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.711012Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,50:31%"Basketball Trophies" "Basketball Trophy"wvl457Not what you are looking for? See other greatfor all of your needs.trophies-basketball08-20-2023Basketball, Sportscustom-pagesoccerbank1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)""PT1=Trophies" "PT1=465713-410.71012Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,50:31%"Soccer Trophies" "Soccet Trophy"value-line-soccer-ball-and-cleat-trophyReturn to the section for more great choices.trophies-soccer10-05-2022Soccer, Sports1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.711012Tower RibbonTrophiesGeneral1:22%,50:31%These 4 /12 Inch Victory Trophies Include Engraving And Perfect For Younger Children and Participation.wvl486General11Shop for Value Line Sports Trophies at TrophyCentral. Each Value Line trophy includes free engraving.1custom-pagecorporatepinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsBusiness1:30%,50:32%,100:35%,500:39%Find these Value the Customer Pins discounted at TrophyCentral. Each pin features a gold finish and clutch-back. Fast shipping!br519Business1"3 1/2 - 4 1/2 weeks" "Greenfield, Ohio" "Truck (please allow 2-7 days for shipping)""PT4=45123128-421 3 4 5 6 7 8 9 10 22 230.451Waddell11Find this Varsity 694 display and trophy case from Waddell discounted at TrophyCentral. Lowest Prices Guaranteed!varsity display case, trophy case, waddell, trophy cases, display casescomingsoonFloor-Standing1"3 1/2 - 4 1/2 weeks" "Greenfield, Ohio" "Truck (please allow 2-7 days for shipping)""PT4=45123128-421 3 4 5 6 7 8 9 10 22 230.451Waddell11"Glass Display Case" "Glass Display Cases" "Glass Trophy Cases" "Glass Trophy Case"Shop for a Varsity Display and Trophy Case at TrophyCentral; Lowest Prices on Trophy Cases Guaranteed!varsity display case, trophy case, waddell, trophy cases, display casespremdiscasfuFloor-Standing11"3 1/2 - 4 1/2 weeks" "Greenfield, Ohio" "Truck (please allow 2-7 days for shipping)""PT4=45123128-421 3 4 5 6 7 8 9 10 22 230.451WaddellDisplay CasesTrophy Cases11"Display Cases" "Popular Display Cases" "Most Popular Display Cases" "Glass Display Case" "Glass Display Cases" "Glass Trophy Cases" "Glass Trophy Case"Find this Varsity Corner Display and Trophy Case at TrophyCentral; Lowest Prices on Trophy Cases Guaranteed!vacodicaFloor-Standingcustom-pagegeneral-corporate-awards1"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"458221510.45228.45Vision AwardsTrophies1:22%,26:37%Find the Vector Business Award at TrophyCentral. The Vector Award Includes Text Engraving and Ships from Ohio.noindexed-items12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
    498555-8.521
    custom-pagebr3715"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"105502-310.4513625.65Classic Medallicsaward-medals1:22%,100:46%Buy Velour Boxes to Display Your Medals and Ribbons at TrophyCentral.velour boxes, velour boxes to display medals, medal display, medal display case, velour medal display caseacpin5"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)""PT1=105502-310.45488.13Classic Medallics1:22%"Lapel Pins"Velour Covered Hinged Pin Box: Visit TrophyCentral to see this and similar Trophies and Awardscustom-pageservicepins21"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"105502-310.451488.13Classic Medallicslapel-award-pinsGeneral1:14%Shop for Velour Lapel Pins Display Boxes at TrophyCentral.custom-pagebottles-al80"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14142013Glass AmericaPromotional ProductsSports / Water Bottles1Find these Green Venice Collection Aluminum Water Bottles Discounted At TrophyCentral! Price Include One-Color Logo Imprint!Sports / Water Bottlescustom-pagebottles-al80"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14142013Glass AmericaPromotional ProductsSports / Water Bottles1Find these Blue Venice Collection Aluminum Water Bottles Discounted At TrophyCentral! Price Include One-Color Logo Imprint!Sports / Water Bottlescustom-pagebottles-al80"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14142013Glass AmericaPromotional ProductsSports / Water Bottles1"Basketball Water Bottles" "Logo Sports Bottles" "Sports Bottles" "Promotional Sports Bottles" "Aluminum Sports Bottles" "Stainless Water Bottles" "Aluminum Water Bottles" "Bike Water Bottles" "Bicycle Water Bottles" "Baseball Water Bottles" "Football Water Bottles" "Promotional Water Bottles" "Soccer Water Bottles"Find these Lime Venice Collection Aluminum Water Bottles Discounted At TrophyCentral! Price Include One-Color Logo Imprint!Sports / Water Bottlescustom-pagebottles-al80"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14142013Glass AmericaPromotional ProductsSports / Water Bottles1Find these Orange Venice Collection Aluminum Water Bottles Discounted At TrophyCentral! Price Include One-Color Logo Imprint!Sports / Water Bottlescustom-pagebottles-al80"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14142013Glass AmericaPromotional ProductsSports / Water Bottles1Find these Red Venice Collection Aluminum Water Bottles Discounted At TrophyCentral! Price Include One-Color Logo Imprint!Sports / Water Bottlescustom-pagecusflatrib1115-711 2 3 4 5 6 7 8 9Tower Ribbons1:0%Add vertical printing to your ribbons for a special touch. TrophyCentral has a great selection of ribbon design and printing options!custom-pagecusrossinstr115-711 2 3 4 5 6 7 8 9Tower Ribbons1:0%Use this option to add vertical printing to your custom rosette ribbons for a special touch. TrophyCentral offers a variety of other printing options including font size and color.1custom-pagedisplaycases211"7-10 business days" "Connelly Springs, North Carolina" "UPS (FedEx available on request)"display case286127-1011.4455.4SpartaCraftDisplay CasesSpecialty Cases1:14%Buy this Veteran Flag Case and other Engraved Flag Cases at TrophyCentral.Flag Casescustom-pagestar-trophiesvitrnocovitrsicovitrwmavitrwtr1vitrwtrvitrtwotivitrtwotiwovitr1qtvicttrqtvictperpmqtvictscbcup-vict-scbcup-vict-pclasacbdg-victory1achievement-trophies-awards1Find victory trophies discounted at TrophyCentral. Each victory trophy includes free personalization.Shop with Ease at TrophyCentral TrophyCentral has a large selection of victory awards and trophies, discounted prices and great customer service. Our experts in New York and Michigan have been providing suggestions and guidance since 1999! ]]>11Find Victory Trophies at Discounted at TrophyCentral. Each Achievement and Victory Trophy Includes Free Engraving! Fast 1-2 Day Shipping

    Custom Victory Trophies and Awards

    TrophyCentral has an industry-leading selection of victory trophies. Be sure to see our popular single column trophies and our participation trophies with a victory figure.

    Achievement Trophies for All Occasions

    The trophies above are perfect to recognize almost any achievement. All achievement trophies include up to three lines of FREE ENGRAVING (larger awards include additional lines). We also offer FREE SHIPPING on award orders over $100 shipping to the continental U.S.

    Shop with Confidence at TrophyCentral!

    If you are looking to buy victory trophies online, look no further! TrophyCentral has Victory Awards to fit any budget, all at discounted prices. Our top-rated representatives are happy to assist you with all of your trophy and award needs. Our experts in New York and Michigan have been providing suggestions and guidance since 1999! To find the perfect victory trophy, use our keyword search above, or for personal service, call us toll-free at 1-888-809-8800.
    ]]>
    custom-pagetrophies-victory1trophies498552-311821.06TrophiesGeneral1Find this achievement cup trophy with victory figure discounted at TrophyCentral. Includes free text engraving!cup-vict-pGeneralcustom-pagetrophies-victory1498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Find this budget victory award trophy discounted at Trophy Central. Features a real marble base and plastic victory figure. Engraving is free. Fast 1-2 day shipping.1trophies-victoryVictory, Generalcustom-pagecrystalcups1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"general410187-1010.45428.45JcharlesCrystal Awards1:22%,25:24%"crystal awards" "Team Award" "Team Awards" "Team Trophy" "Team Trophies" "Team Trophies and Awards"Find this Victory Cup at TrophyCentral. Trophies include free engraving.06-30-2014Cup, Generalcustom-pageresin-trophies11"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453615.21Quick TrophyTrophiesGeneral1:14%,10:17%,25:23%,50:29%,100:34%Our Victory Participation Trophies feature a real slant-front white marble base and free personalization. Significant quantity discounts available.vitrnocoGeneralcustom-pagetrophies-victory11"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesGeneral1:14%,100:25%This popular Victory Figure Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!vitrwtrGeneralcustom-pageholographic-insert-plaques1"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498852-310.45811.6Quick TrophyPlaquesInsert1:14%,3:14%See this stunning Victory plaque and other Holographic Plaques at TrophyCentral.qsinplaqvictoryBlank, Generalcustom-pagemedallion-inserts-general-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these quality Victory Inserts (Litho) at TrophyCentral. Each Victory Insert can be used to create a unique plaque, medal or trophy.493521General
    custom-pagemedallion-inserts-general-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these quality Victory Male Inserts (Litho) at TrophyCentral. Each Victory Male Insert can be used to create a unique plaque, medal or trophy.503991General
    custom-pagetrophies-victory1trophies498552-312413.89TrophiesGeneral1Find these victory budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtvictscbGeneralcustom-pagetrophies-victory11"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesGeneral1:14%,100:25%Find this popular victory figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!vitrwtr1Generalcustom-pagemedallion-inserts-general-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these high-quality Victory Wreath Inserts at TrophyCentral. Each Victory Wreath Insert can be used to create a unique plaque, medal or trophy.51779712-20-2020General
    custom-pagefree-sports-templates1"Download Only"certificates4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Videography template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Videography-Certificatevideography-freeVideographycustom-pagemascot-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Hornet Mascot Badges Discounted At TrophyCentral.mascotbadges-vikingcustom-pagemascot-plaques1plaques498552-41JDSPlaques1Find this viking plaque discounted at TrophyCentral. Our viking mascot plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Mascotcustom-pagemascottrophies1"4-6 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511016.25Classic MedallicsTrophiesAcademic1:22%,5:24%,10:28%,50:32%"Mascot Awards"Buy this Viking mascot trophy and other mascot awards at TrophyCentral.mt201412-20-2020Mascotcustom-pagemascotinserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-40.3713003.37Classic MedallicsInsertsMascots1Buy these quality Vikings Mascot Medal Inserts at TrophyCentral. Each Vikings Insert can be used to create a unique plaque, medal or trophy.489942Mascot
    custom-pagequickshiptrophies-pickup1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:27%,100:32%Our popular Vintage Pick-up Truck participation trophies feature a real slant-front marble base and free engraving.qtvintagepickupnc12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
    498555-8.52Click here to see sample vinyl finishes, including Walnut and Light Oak, for Waddell Trophy Cases. TrophyCentral is a top-rated Yahoo merchant.
    custom-pagemusic-certificate-templates1"Download Only"certificates49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Violin template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Violin-Certificateviolin-freeMusic / Band / Choruscustom-pagemusicartpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsMusic, Drama, Art, Dance1:22%,50:30%,100:33%,500:45%"Music Lapel Pins" "Band Lapel Pins" "Music Pins"Find These Violin Lapel Pins Discounted at TrophyCentral. Features a Clutch-Pin Back and Fast 1-2 Day Shipping!mp13Music / Band / Chorus11Find High-Quality Visions Trophy Cases - All Discounted - At TrophyCentral!custom-pagesmartpak-combination-boards14512310-171 3 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent VisuALL PC Whiteboard Cabinet with Fabric Bulletin Board Exterior Doors, Beige discounted at TrophyCentral.141302Enclosedcustom-pagesmartpak-combination-boards14512310-171 3 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent VisuALL PC Whiteboard Cabinet with Fabric Bulletin Board Exterior Doors, Blue discounted at TrophyCentral.141302Enclosedcustom-pagesmartpak-combination-boards14512310-171 3 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent VisuALL PC Whiteboard Cabinet with Fabric Bulletin Board Exterior Doors, Gray discounted at TrophyCentral.141302Enclosedcustom-pagesports-resource-hub11Discover the ultimate vocal music trophy and medal guide! From choir competitions to solo performances, find creative award ideas that celebrate vocal excellence and musical artistry.custom-pagetrophies-volleyball1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with volleyball figure discounted at TrophyCentral. Includes free text engraving!cup-volly-pVolleyball, Sportscustom-pagetrophies-volleyball1498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Find this budget volleyball award trophy discounted at Trophy Central. Features a real marble base, a volleyball player figure and free engraving.1trophies-volleyballVolleyball, Sportscustom-pagefree-sports-templates1"Download Only"free-sports4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Volleyball template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Volleyball-Certificatevolleyball-freeVolleyball, Sportscustom-pagetrophies-volleyball1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Volleyball Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Volleyball, Sportscustom-pagetrophies-volleyball1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Volleyball Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Volleyball, Sportscustom-pagetrophies-volleyball1medals498553-Feb120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Volleyball Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Volleyball, Sportscustom-pagecoaching-teaching-guides11Creative volleyball award ideas with engraving examples for your team banquet. From Ace Machine to Dig Master, discover 15+ unique ways to recognize every player with actual trophy wording templates.custom-pagesporcervolleyballfr1volleyballfrcertificates290631-31 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,25:27%,100:40%,500:50%"Volleyball Awards"Give your volleyball team the recognition they deserve with volleyball certificates from Trophy Central. Shop our discounted volleyball certificates today!1042Volleyball, Sportscustom-pagefree-sports-templates1"Download Only"certificatesfree-sports49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"See this Volleyball Certificate designed exclusively for TrophyCentral! Each Volleyball Certificate measures 11 x 8 1/2 inches and can be downloaded for free!volleyballfrVolleyball, Sportscustom-pagenoname111"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.5116.5Perfect CaseDisplay Cases11:14%,5:16%Volleyball Display Cases (Glass, Octagon) from TrophyCentral.Volleyball, Sportscustom-pagenoname111"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.5116.5Perfect CaseDisplay Cases11:14%,5:15%Volleyball Display Cases (Glass, Wall-Mounted) from TrophyCentral.Volleyball, Sportscustom-pagetrophies-volleyball1medals498552-30.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Colorful Volleyball Insert Medals Discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Volleyball, Sportscustom-pagetrophies-volleyball1medals498552-40.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Volleyball Insert Medals With A Personalized Front Rim Discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Volleyball, Sportscustom-pageholographic-insert-plaques1"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498852-310.45811.6Quick TrophyPlaquesInsert1:14%,3:14%"Volleyball Awards"See this stunning Volleyball plaque and other Holographic Plaques at TrophyCentral.qsinplaqvolleyballVolleyball, Sportscustom-pagecherry-insert-plaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these volleyball insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Volleyball, Sportsvolleyballmedalsvolleyball-ei50321150441149322111"Volleyball Medals"See these Volleyball Inserts at TrophyCentral; Each insert measures 2".1custom-pagetrophies-volleyballplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsSports, Hobby, Org, Livestock1:22%,50:30%,100:33%,500:47%"Volleyball Awards" "Volleyball Pins" "Volleyball Lapel Pins"Volleyball Letter Pins: EC Series Volleyball Lapel Pins feature a high-quality enameled finish and ship in just 1-2 business days!ec0510-25-2007Volleyball, Sportscustom-pagecl10151-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    "PT1=105502-30.3150030.3Classic Medallicslapel-award-pinsSports, Hobby, Org, Livestock1:30%,50:36%,100:39%,500:42%,1000:48%"Volleyball Pins" "Volleyball Lapel Pins"Find this fabulous Volleyball letter pin at TrophyCentralcl14412-20-2040Volleyball, Sports
    custom-pagesports-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these high-quality Volleyball Inserts at TrophyCentral. Each 2 inch insert can be used to create a unique plaque, medal or trophy.493221Volleyball, Sports
    custom-pagetrophies-volleyball50medals9303310-May1Simba Calaward-medals1These 2 1/2 inch custom volleyball (QCM Series) medals come with an outer-ring which allows you to add your school or league name, date and location.Volleyball, Sportscustom-pagevolleyballpinsvolleyball-mcvolleyball-mc-prvolleyball-mge9027tm9995gvovolleyball-qcmvolleyball-jigfvolleyball-jibfvolleyball-jisf11Shop for volleyball medals at TrophyCentral. Volleyball medals include a neck ribbon and most ship in just 1-2 business days.Shop For Volleyball Award Medals with Ease at TrophyCentral Find a great selection of high-quality medals and awards, discounted prices and fast shipping. We also have a great customer service team that would be happy to help you!]]>trophies-volleyball volleyballpinscustom-pagetrophies-volleyball1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our volleyball insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - VolleyballVolleyball, Sportscustom-pagetrophies-volleyball1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy volleyball insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Volleyball, Sportscustom-pagesports-pinscl10ec0511Shop for Volleyball Lapel Pins from TrophyCentral.volleyball pins, volleyball award pins, volleyball lapel pins, volleyball awardsVolleyball Lapel Pins TrophyCentral has a great selection of stock volleyball lapel pins. Our volleyball letter pins are available with a color or chenille gold finish and are available in several styles ("Spike" and volleyball). Volleyball pins can be proudly worn directly on a volleyball jacket or on a varsity or JV letter.
    We also carry a great selection of generic pins, such as Varsity, JV, MVP, All Star, Champs, Coach and more! All volleyball pins feature a clutch-pin back for safe and easy attachment to clothing. Pins typically ship in just 1-2business days. .

    Shop with Confidence at TrophyCentral!

    If you are looking to buy volleyball lapel pins online, look no further! TrophyCentral has a great selection that will fit any budget. Our top-rated representatives are happy to assist you with all of your volleyball pin needs. Our experts in New York and Michigan have been providing suggestions and guidance since 1999! To find the perfect volleyball lapel pin, click on an image above, or for personal service, call us toll-free at 1-888-809-8800.]]>
    trophies-volleyball trophies
    custom-pagetrophies-volleyball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453631.77Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%,25:23%,50:29%,100:34%Our popular Volleyball participation trophies feature a real slant-front marble base and free engraving.qtvollyncVolleyball, Sportscustom-pagetrophies-volleyball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-30.38150030Quick Trophylapel-award-pinsSports, Hobby, Org, Livestock1:14%,10:15%Find this engraved volleyball dog tag discounted at TrophyCentral. Price includes engraving and 24" chain!!Shop for Sports Dog Tags at TrophyCentral. Each Sports Tag Can Be Engraved.qtdogvollVolleyball, Sportscustom-pageaward-medalsqtvollyncqtvollyscmavotrqtvollydmqtvollyyrqtvollyplqtvollyttqtvollyttwqtvolly3cqtvollytrtr7007tr7008qtvolleyperpmqtvollyscbcup-volly-scbcup-volly-pchamp-cup-volleyball-tcvolleyball-part-ivolleyball-single-ivolleyball-champ-ivolleyball-plaque-ivolleyball-e-part-ivolleyball-e-single-icup-vollyball-scb-icup-vollyball-inbdg-volleyballvolleyball-mcvolleyball-mc-prvolleyball-mge9027tm9995gvovolleyball-qcmvolleyball-jigfvolleyball-jibfvolleyball-jisfcl10ec05qsinplaqvolleyballqtdogvollvolleyball-ei5032115044114932211trophies1"Volleyball Awards" "Sports Trophies"Find the Perfect Volleyball Recognition Trophy for Your Team or Star Player TrophyCentral has a great selection of volleyball trophies to fit any budget. We feature low prices, bulk discounts and great customer service. Call our experts toll-free. They have been serving customers since 1999 and they would be happy to assist you, too! For your volleyball MVP, consider our column trophies or a special plaque. For your championship team, our two-tier trophies or perpetual volleyball trophies would be perfect. If you just want to recognize participation, consider a simple no column or single column participation trophy with a volleyball figure. ]]>custom-pagetrophies-volleyball1trophies498551-311821.06TrophyCentraltrophies1Volleyball, Sportscustom-pagetrophies-volleyball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)""PT1=Trophies" "PC12=498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular volleyball figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!1trophies-volleyballVolleyball, 1st / 2nd / 3rd / Etc., Sportscustom-pagetrophies-volleyball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%This popular Volleyball Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!qtvollyyrVolleyball, Sportscustom-pagecl1012-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    "PT1=Medals" "PC12=105503-60.7530027.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,50:28%,100:34%,500:41%"Award Medals - All Subjects" "Sports Medals" "Volleyball Awards" "Volleyball Medals"Find our Volleyball 2" Olympic-Style J-Series Medals at a super price point at TrophyCentral. Large quantity discounts available!j958811-10-2009Volleyball, Sports
    custom-pagetrophies-volunteer1"Download Only"free-appreciation49855011TrophyCentralCertificates / CoversAward Certificates1See this Volunteer Certificate designed exclusively for TrophyCentral! Volunteer certificates can be downloaded for free! Each volunteer award certificate measures 11 x 8 1/2 inches.volunteerfrVolunteer, Thank You, Appreciationcustom-pagetrophies-volunteer1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy volunteer column insert trophy features a choice of column color, a marble base and free trophy engraving.Volunteercustom-pagefire-department-pins12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality Volunteer Fire Department Inserts at TrophyCentral. Each Volunteer Fire Department Insert can be used to create a unique plaque, medal or trophy.514093Firefighter, Hero
    custom-pagevolunteer-medals12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality Volunteer Fire Fighter Inserts at TrophyCentral. Each Volunteer Fire Fighter Insert can be used to create a unique plaque, medal or trophy.495759Firefighter, Hero
    custom-pagequickshiptrophies-fireman20trophies498551-30.5100021TrophyCentralInsertsSports, Hobby, Org, Livestock1Find these colorful Volunteer Firefighter 2" Epoxy-covered inserts discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Firefightercustom-pagequickshiptrophies-fireman1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy volunteer firefighter column insert trophy features a choice of column color, a marble base and free trophy engraving.Firefightercustom-pagefirefighter-medals1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Volunteer Firefighter Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Firefightercustom-pagefirefighter-medals1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Volunteer Firefighter Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Firefightercustom-pagefirefighter-medals1medals498551-31.520033TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Volunteer Firefighter Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Firefightercustom-pagefirefighter-medals1medals498551-30.525035.5TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these colorful Volunteer Firefighter insert medals discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Firefightercustom-pagefirefighter-medals1medals498551-30.525035.5TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these Volunteer Firefighter insert medals with a personalized front rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Firefightercustom-pagequickshiptrophies-fireman1plaques498551-311.11623.5TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these Volunteer Firefighter insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Firefightercustom-pagequickshiptrophies-fireman1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our volunteer firefighter insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Firefightercustom-pagequickshiptrophies-fireman1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy volunteer firefighter insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Firefightercustom-pagequickshiptrophies-fireman1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Volunteer Firefighter single column insert trophy features a choice of column color, a marble base and free trophy engraving.Firefightercustom-pagecherry-insert-plaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these volunteer insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Volunteercustom-pageappreciation-templatesvolunteer-mcvolunteer-mc-prvolunteer-jigfvolunteer-jibfvolunteer-jisf1award-medals1Shop for volunteer medals at TrophyCentral. Volunteer medals include a neck ribbon and most ship in just 1-2 business days.

    Frequently Asked Questions (FAQ)

    🏅 What types of volunteer medals do you offer?

    We offer a variety of volunteer medals, including gold, silver, and bronze finishes. Many feature beautiful designs such as hands of service, hearts, or stars to symbolize appreciation and dedication.

    🎖 Who typically receives volunteer medals?

    Volunteer medals are awarded to individuals or groups who have demonstrated outstanding service in their communities, schools, nonprofit organizations, or charitable events.

    ✨ Can I customize volunteer medals with engraving?

    Yes! Many of our volunteer medals can be engraved with recipient names, event dates, or special messages to recognize outstanding contributions.

    📦 Do you offer bulk discounts for organizations?

    Absolutely! We provide special pricing for nonprofits, schools, and organizations ordering volunteer medals in bulk. Contact us for details on volume discounts.

    🏆 What is the best way to recognize volunteers?

    In addition to volunteer medals, consider presenting engraved plaques, certificates, or trophies to show appreciation for their hard work and dedication.

    🚚 How fast can I receive my volunteer medals?

    Most of our volunteer medals ship within 1-2 business days. Custom engraving may take slightly longer, so we recommend ordering early for award ceremonies.

    ]]>
    volunteerpins
    custom-pagetrophies-volunteer1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy volunteer insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.trophies-volunteerVolunteercustom-pageappreciation-templatesbr312volapinbr243br559br380br655volunteer-pbvolunteer-u-pb3d9-volunteer1corporatepins1Find a great selection of volunteer pins discounted at TrophyCentral. Each volunteer lapel pin features a clutch back or safety pin for easy attachment to clothing.Lapel Pins: Volunteer TrophyCentral has a great selection of stock volunteer lapel pins in a chenille gold finish and in several styles. We also carry "thank you" pins, which can be used for teachers, donors and more. Each volunteer pin features a clutch-pin back for safe and easy attachment to clothing.

    Shop with Confidence at TrophyCentral!

    If you are looking to buy volunteer lapel pins online, look no further! TrophyCentral has a great selection that will fit any budget. Our top-rated representatives are happy to assist you with all of your pin needs. Our experts in New York and Michigan have been providing suggestions and guidance since 1999! To find the perfect pin, click on an image above, or for personal service, call us toll-free at 1-888-809-8800.]]>
    volunteer-medals engraveablepin
    custom-pageemployee-resource-hub11Comprehensive volunteer recognition guide for nonprofits, churches, and community organizations. Discover creative award ideas, service milestone celebrations, and meaningful appreciation strategies.custom-pageemployee-resource-hub11Explore the importance of volunteer service awards, their types, and how they motivate volunteers to continue their selfless service.volunteer service awards, volunteer recognition, awards for volunteers, service awards, volunteer appreciationcustom-pageappreciation-templatesblankawardthankyoutrophyjaglscservice-award-plaquethank-you-award-plaquevolunteer-part-ivolunteer-single-ivolunteer-champ-ivolunteer-plaque-ivolunteer-e-part-ivolunteer-e-single-icup-volunteer-in1trophies1

    Volunteer Appreciation & Recognition Trophies

    TrophyCentral has an industry-leading selection of Volunteer trophies and awards. Be sure to see our popular Thank You Trophy, a perfect way to show appreciation for almost any occasion. Also see our Star Insert Trophies and add an Appreciation or Thank You insert. These same inserts can be added to many of our plaques. All of our trophies include up to three lines of FREE ENGRAVING (larger awards may include additional lines).

    Volunteer Medals and Pins

    If you are looking for a budget-friendly alternative to trophies, our award medals and lapel pins are the perfect solution. Volunteer medals come in gold, silver and bronze finishes and offer optional engraving to keep the price as low as possible. Be sure to also check out our 1 1/4" Budget Medals. All of our medals include a neck ribbon, and many offer a choice of ribbon color. Without engraving, your order will typically ship in just 1-2 business days, so no need to worry if you have waited for the last minute. Our pins include a clutch-pin back for easy and safe attachment to clothing.

    Be sure to see our Volunteer and Service Awards Guide.

    Frequently Asked Questions (FAQ)

    🏆 What types of volunteer trophies do you offer?

    We offer a wide selection of volunteer trophies, including elegant crystal awards, classic gold cup trophies, and unique resin figures featuring hands of service, stars, or appreciation symbols.

    🌟 Who are volunteer trophies designed for?

    Volunteer trophies are perfect for recognizing individuals or groups who have made a significant impact through community service, nonprofit work, or school volunteer programs.

    🖋️ Can I personalize my volunteer trophy with engraving?

    Yes! Many of our volunteer trophies include free engraving, allowing you to customize them with names, dates, and special messages to honor dedicated volunteers.

    📦 Do you offer discounts for bulk trophy orders?

    Absolutely! If you're ordering multiple volunteer trophies for a school, nonprofit, or corporate event, we offer bulk pricing. Contact us for more details.

    🏅 What is the difference between volunteer trophies and volunteer plaques?

    Volunteer trophies are free-standing awards often featuring figures or cups, while plaques are flat awards designed to be hung on walls. Both are excellent ways to recognize volunteer achievements.

    🚚 How long does it take to receive my volunteer trophies?

    Most of our volunteer trophies ship within 1-2 business days. Custom engraving may take slightly longer, so we recommend ordering in advance for your event.

    ]]>
    volunteerpins volunteer-medals
    custom-pagetrophies-volunteer1trophies498551-311821.06TrophyCentraltrophies1Volunteercustom-pageappreciation-templates1"Download Only"free-appreciation49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Volunteering Award template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Volunteering-Award-Certificatevolunteering-award-freeVolunteer, Thank You, Appreciationcustom-pagevolunteerpinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"Find these Volunteers Have Heart pins discounted at TrophyCentral. Each lapel pin features a beautiful finish and clutch back.br243General, Volunteer, Thank Youcustom-pagename-badges-tagswoyoulipr100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Vote (Election) Badges Discounted At TrophyCentral.namebadges-votecustom-pagehigh-end-awards1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"general410187-1010.45648.45JcharlesGeneral Awards1:22%,25:24%"crystal awards" "Business Award" "Corporate Award" See this fabulous Voyager Award at TrophyCentral. See our great selection of engraved and personalized awards!custom-pageletter-shaped-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find these popular W-shaped custom mascot badges at TrophyCentral. Great for fundraising! TrophyCentral is a top-rated Yahoo merchant.letterbadges-wcustom-pagewalmouncas14404-ck-bz14405-ck-bz14406-ck-bz14408-ck-bz14404-ck-sn14405-ck-sn14406-ck-sn14408-ck-sn14404-wb-bz14405-wb-bz14406-wb-bz14408-wb-bz14404-wb-sn14405-wb-sn14406-wb-sn14408-wb-sn11Find recessed display cases for schools and offices discounted at TrophyCentral. Each recessed display case is made in the US by Waddell.wall-mounted-champion wall-mounted-legacycustom-pagebaseballdisplay11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.5113.5Perfect CaseDisplay Cases11:14%,5:15%Museum-quality hat display case. UV-protected glass with mirrored backing. Preserve autographed caps, acid-free adhesives. Cherry wood molding. Buy now.wallmountcapBaseball / T-Ball, Sportscustom-pagebaseballdisplay11"7-10 business days w/Logo, 4-6 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.517.5Perfect CaseDisplay Cases11:14%,5:15%Wall Mounted Double Baseball Glass Display Case. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.wallmountdoublebaseballBaseball / T-Ball, Sportscustom-pagefootballdisplay11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.5113.5Perfect CaseDisplay Cases11:14%,5:20%Wall Mounted Double Mini Helmet Glass Display Cases. TrophyCentral is a Top-Rated Yahoo Merchant.Football, Sportscustom-pagehockeypuckdisplays1"7-10 business days w/Logo, 4-6 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.517.5Perfect CaseDisplay Cases11:14%,5:15%Wall Mounted Double Puck Glass Display Cases from TrophyCentral.Hockey, Sportscustom-pagebaseballdisplay11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.5131.5Perfect CaseDisplay Cases11:14%,5:15%Wall Mounted Glass Baseball Bat Display Case. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.wallmountbatBaseball / T-Ball, Sportscustom-pagebaseballdisplay11"7-10 business days w/Logo, 4-6 without" "Apopka, FL 32712" "UPS (FedEx available on request)"trophies327765-101 3 22 231.517.5Perfect CaseDisplay Cases11:14%,5:16%Wall Mounted Glass Baseball Display Case. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Baseball / T-Ball, Sportscustom-pagefootballdisplay11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.5116.5Perfect CaseDisplay Cases11:14%,5:17%Wall Mounted Glass Football Display Case. Ideal for leagues, schools, and tournaments. Fast shipping.Football, Sportscustom-pagefootballdisplay11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.5139.5Perfect CaseDisplay Cases11:14%,5:15%Wall Mounted Glass Football Helmet Display Case. Ideal for leagues, schools, and tournaments. Fast shipping.Football, Sportscustom-pagegolfballdisplay1"7-10 business days w/Logo, 4-6 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.516.5Perfect CaseDisplay Cases11:14%,5:16%Wall Mounted Glass Golf Ball Display Case. Ideal for leagues, schools, and tournaments. Fast shipping.Golf, Sportscustom-pagefootballdisplay11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.519.5Perfect CaseDisplay Cases11:14%,5:15%Wall Mounted Glass Mini Football Helmet Display Case. Ideal for leagues, schools, and tournaments. Fast shipping.Football, Sportscustom-pagefootballdisplay11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.5116.5Perfect CaseDisplay Cases11:14%,5:17%Wall Mounted Glass Upright Football Display Case. Ideal for leagues, schools, and tournaments. Fast shipping.Football, Sportscustom-pagebaseballdisplay11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.5117.5Perfect CaseDisplay Cases11:14%,5:17%Find this fabulous wall-mounting baseball glove display case discounted at TrophyCentral!wallmountgloveBaseball / T-Ball, Sportscustom-pageracingdisplays11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.5113.5Perfect CaseDisplay Cases11:14%,5:20%"Sports Display Case" "Sports Displays" "Sports Display" "Sports Display Cases" "Sport Display Cases" "Acrylic Sports Display" "Acrylics Displays" "Acrylic Display Cases" "Sports Ball Holder" "Sports Ball Holders"Wall Mounted Race Car Glass Display Cases from TrophyCentral.custom-pageracingdisplays1"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.5139.5Perfect CaseDisplay Cases11:14%,5:15%Wall Mounted Racing Helmet Glass Display Cases from TrophyCentral.custom-pagehockeypuckdisplays1"7-10 business days w/Logo, 4-6 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.516.5Perfect CaseDisplay Cases11:14%,5:16%Wall Mounted Single Puck Glass Display Cases from TrophyCentral.Hockey, Sportscustom-pagebaseballdisplay11"7-10 business days w/Logo, 4-6 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.517.5Perfect CaseDisplay Cases11:14%,5:16%Find this fabulous wall-mounting softball display case discounted at TrophyCentral!wallmountsoftballSoftball, Sportscustom-pagebaseballdisplay11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"327765-101 3 22 231.519.5Perfect CaseDisplay Cases11:14%,5:20%Wall Mounted Triple Baseball Glass Display Case. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.wallmounttriplebaseballBaseball / T-Ball, Sportscustom-pagefootballdisplay11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.5116.5Perfect CaseDisplay Cases11:14%,5:15%Wall Mounted Triple Mini Helmet Glass Display Cases. TrophyCentral is a Top-Rated Yahoo Merchant.Football, Sportscustom-pagehockeypuckdisplays1"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 231.519.5Perfect CaseDisplay Cases11:14%,5:20%Wall Mounted Triple Puck Glass Display Cases from TrophyCentral.Hockey, Sportscustom-pagecolor-wall-plaques1"1-2 business days" "Marquette, MI" "UPS"plaques498852-310.51017.50Quick TrophyPlaquesColor Plaques1:14%,3:17%"New Products"Find These Beautiful 8 x 10 Inch Vertical Matte Black Finish Plaques Discounted And With Free Engraving At TrophyCentral. Optional Full Color Logo.8x10blackfinishBlank, Generalcustom-pagecolor-wall-plaques1"1-2 business days" "Marquette, MI" "UPS"plaques498852-310.51034.50Quick TrophyPlaquesColor Plaques1:14%,3:17%"New Products"Find These Beautiful 9 x 12 Inch Vertical Matte Black Finish Plaques Discounted And With Free Engraving At TrophyCentral.9x12blackfinishBlank, Generalcustom-pagecolor-wall-plaques1"1-2 business days" "Marquette, MI" "UPS"plaques498852-310.51013.50Quick TrophyPlaquesColor Plaques1:14%,3:17%"New Products"Find These Beautiful 9 x 7 Inch Horizontal Matte Black Finish Plaques Discounted And With Free Engraving At TrophyCentral.9x7blackfinishBlank, Generalcustom-pageofficesigns11"1-2 business days" "Roanoke, Virginia" "UPS (FedEx available on request)"240169-1210.455015.45RoanokeOffice Signs1custom-pagedisplaycases1wall-mounted-recessedwall-mounted-championwall-mounted-legacywalmoundis1trophycases1"Retail Displays" "Retail Display Cases" "Retail Display" "Retail Cases" "Retail Store Display" "Retail Store Displays" "Retail Display Case"Browse wall-mounted and recessed trophy cases in every size and style. Get free engraving, fast shipping, and expert display advice. Display it brilliantly.

    Our Premium Display Case Collection

    Discover endless options in wall-mounted display cases. Each case features precision-crafted details, perfect for showcasing trophies, medals, and prized collectibles. These display cases are available in multiple styles and in small and large sizes. Transform any wall into your personal hall of fame.

    Shop For Wall-Mounted Display Cases and Recessed Displays With Confidence

    Trophy Central has an industry-leading selection of trophies that will fit any budget, all at discounted prices with free personalization. Our experts in New York, Michigan, and online have been providing guidance since 1999. We have served over 100,000 customers, including 370+ Fortune 500 companies and over 9,600 elementary and secondary schools, colleges, and universities.

    Why Shop Trophy Central

    We offer low prices on all wall-mounted display case sizes, making our pieces affordable for all. Most items ship in a fast 1-2 days, with same-day shipping available depending on your location. We make it as easy as possible to buy trophies and display cases online at discounted prices, ensuring a smooth shopping experience from start to finish.

    Ready to Showcase Your Achievements?

    Browse our extensive collection of wall-mounted and recessed display cases today. Shop now and save more with our bulk discounts.

    Frequently Asked Questions

    What type of lighting works best inside the display cases?

    LED strip lights or puck lights are ideal for display cases, especially large models. These lights produce minimal heat, use little energy, and last for years. Warm white enhances gold trophies, while cool white makes silver and crystal sparkle. Avoid halogen or incandescent bulbs that generate heat and can damage items or cause fading.

    How do I prevent dust from getting inside my display cases?

    Choose display cases with tight-fitting doors and weather stripping seals. Add felt strips along door edges if needed. Position your display cases on walls that are away from air vents and high-traffic areas. Some collectors use positive air pressure systems or small cabinet filters. Even sealed display cases benefit from occasional gentle cleaning.

    How do I arrange trophies of different sizes in display cases?

    Place the largest collectibles at the bottom or back, creating visual stability. Use risers or platforms to vary heights. Group similar items together or arrange chronologically. Leave breathing room between pieces as overcrowding diminishes impact. Consider diagonal arrangements for dynamic displays. Rotate seasonal items to keep displays fresh.

    What backing materials look best in trophy display cases?

    Mirror backing doubles the visual impact and makes display cases appear deeper. Options like trophy cases designed with fabric-covered cork allow for pinning ribbons or photos, and walnut wood grain adds warmth.

    Black felt creates a dramatic contrast for white or light-colored awards. Some people prefer neutral colors that won't compete with displayed items. Consider a removable backing for different styles.

    ]]>
    custom-pageask-trophy-expert11Wall-mounted trophy cases save space and display at eye level. Floor cases hold more awards and create impact. Compare advantages to choose the right display.custom-pagequickshiptrophies-fireman11plaques105503-610.451813.25Classic MedallicsPlaquesBlank Plaques1:22%Shop for Walnut Appreciation Plaques from TrophyCentral.Blank, Generalcustom-pagecertificateplaques1"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"plaques105502-313.311251.3Classic MedallicsPlaquesCertificate Plaques1:14%,10:18%,50:23%,100:27%"Certificate Plaques" "Certificate Plaque" "Plaques That Hold Certificates" "Certificate Holders" "Plaques For Certificates" "Graduation Plaques" "Diploma Holders" "Padded Diploma Covers" "School Diploma Covers" "Diploma Covers" "Custom Diploma Covers"Find This Walnut Certificate Plaque Discounted at TrophyCentral. Ships In Just 1-3 Business Days. Quantity Discounts Available.pn4642wl05-22-2009Certificates / Sealscustom-pagecertificateplaques1"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"plaques105502-31111226.2Classic MedallicsPlaquesCertificate Plaques1:14%,10:17%,50:21%,100:25%"Diploma Holders" "Padded Diploma Covers" "School Diploma Covers" "Diploma Covers" "Custom Diploma Covers" "Certificate Plaques" "Certificate Plaque" "Plaques That Hold Certificates" "Certificate Holders" "Plaques For Certificates" "Graduation Plaques"See This Popular Walnut Certificate Plaque with Silver Frame Discounted at TrophyCentral. Holds 8 1/2" x 11" Certificate. Fast 1-2 Day Shipping!pn4931wls03-26-2009Certificates / Sealscustom-pagecertificateplaques1"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"plaques105502-31111225Classic MedallicsPlaquesCertificate Plaques1:14%,10:17%,50:21%,100:25%"Diploma Holders" "Padded Diploma Covers" "School Diploma Covers" "Diploma Covers" "Custom Diploma Covers" "Certificate Plaques" "Certificate Plaque" "Plaques That Hold Certificates" "Certificate Holders" "Plaques For Certificates" "Graduation Plaques"See This Popular Walnut Finish Certificate Plaque with Gold Frame Discounted at TrophyCentral. Holds 8 1/2" x 11" Certificate. Fast 1-2 Day Shipping!Certificates / Sealscustom-pagegavelplaques11"4-6 business days" "Mount Vernon, NY" "UPS"plaques105503-610.4511627.65Classic MedallicsPlaques, GiftsGavels1:22%Popular Walnut Gavel from TrophyCentral. What is a Gavel? Gavels are used as Awards for those Serving on Committees.wafiga05-16-2011Gavelcustom-pagegavelplaques11"7-10 business days w/engraving" "Chicago, Illinois" "UPS (FedEx available on request)"plaques606307-101 3 230.452018.45RS OwensPlaquesGavels1:22%"Leadership Recognition"Removable Walnut Gavel Plaques from TrophyCentral.12-20-2020Gavel49-301149-340149-358149-764949-766450-165451-150151-341151-409351-776451-782551-782651-815551-815751-818551-818651-818851-819651-828851-fund70-702811Find Walnut Insert Plaques Discounted at TrophyCentral. Each Walnut Insert Plaque Features Free Engraving.custom-pagequickshiptrophies-fireman1"3-6 business days with engraving, Without engraving: 1-3 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"plaques105503-610.4511219.65Classic MedallicsPlaquesInsert1:22%,3:24%,5:27%"Fire Awards" "Fire Trophies" "Fire Department Awards" "Fire Department Trophies"Genuine Walnut Fire Department (FD) Plaque with 2 Inch Insert and Free Engraving.51-4093Firefighter, Herocustom-pagetrophies-golf1"3-6 business days with engraving, Without engraving: 1-3 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"plaques105503-610.4511222.05Classic MedallicsPlaquesInsert1:22%,3:23%,5:24%"Sports Awards"Walnut Plaque - Golf. Ideal for leagues, schools, and tournaments. Fast shipping.49-3011Golf, Sportscustom-pagetrophies-tennis1"3-6 business days with engraving, Without engraving: 1-3 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"plaques105503-610.4511222.05Classic MedallicsPlaquesInsert1:22%,3:23%,5:24%"Sports Awards"Genuine Walnut Tennis Plaque with 2 Inch Insert and Free Engraving.49-7649Tennis, Sportscustom-pagesports-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Water Polo Inserts (Litho) at TrophyCentral. Each Water Polo Insert can be used to create a unique plaque, medal or trophy.50341Swimming / Diving, Sports
    custom-pageglass-crystal-awards1"10-15 business days w/engraving" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"general105505-1010.451 2 3 4 5 6 7 8 91420.45Classic MedallicsCrystal Awards1:22%,25:23%Shop for Wave Crystal Awards with Black Trim from TrophyCentral. Free Engraving on Crystal Awards.Leadershipcustom-pageflaglapelpins110"1-3 business days" "Marquette, Michigan" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins498552-30.3150030Trophy Centrallapel-award-pinsHero1:30%,25:34%,100:37%,500:41%"Flag Pin Section" "Flag Lapel Pins" "Lapel Pins - Flag" "Discount Flag Pins" "Cheap Flag Pins" "Flag Pins Cheap" "Buy Flag Pins" "Shop For Flag Pins" "U.S. Flag Pins" "American Flag Pins" "Flag Pins US" "Flag Pins American" "Hero Pins"Find these Waving Flag Pins at TrophyCentral. Features a clutch back and ships in just 1-2 business days.flagpins101-15-2011

    TrophyCentral carries a large selection of flag pins, stock lapel pins and custom pins. If you do not see what you want, please use the search feature on top of the left-navigation bar or call us at 1-888-809-8800.]]>
    custom-pageflaglapelpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsHero1:22%,50:30%,100:38%,500:58%"Flag Pin Section" "Flag Lapel Pins" "Lapel Pins - Flag" "Discount Flag Pins" "Cheap Flag Pins" "Flag Pins Cheap" "Buy Flag Pins" "Shop For Flag Pins" "U.S. Flag Pins" "American Flag Pins" "Flag Pins US" "Flag Pins American"frlapinReturn to thecategory for other great pins in many styles.flaglapelpinsFlags, General11"PC60=4503610-1410.451226.85GhentOffice Signs1Mobile Direction Arrow Sign: WeatherAll Signs from TrophyCentral.Directional Signscustom-pagemedallion-inserts-general-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these high-quality Wedding Anniversary Inserts at TrophyCentral. Each Wedding Anniversary Insert can be used to create a unique plaque, medal or trophy.518199Wedding
    custom-pagegroomsmengiftspeuncaprchglentoglprtefasitrba11Find wedding favors discounted at TrophyCentral. Each wedding favor can be personalized for a special touch. Browse our wedding party favors now!

    Shop Personalized Wedding Favors With Confidence at TrophyCentral

    We offer a huge selection, discounted pricing and great customer service. Do you need help with some ideas or with ordering? Yes, we sell online, but we have real people who would love to help you! Feel free to call our customer service experts in Michigan, New York and online. TrophyCentral - delivering smiles since 1999!


    ]]>
    custom-pageaward-medalsqtliftncqtliftscqtliftdmqtliftyrqtliftplqtliftttqtliftttwqtlift3cqtweighttrmqtliftscbcup-lift-pcup-lift-scbcup-weightlifting-pweightlifting-part-iweightlifting-single-icup-weightlifting-scb-iweightlifting-e-part-iweightlifting-e-single-iweightlifting-plaque-iweightlifting-champ-ibdg-weightweightlifting-jigfweightlifting-jisfweightlifting-jibfweightlifting-mc-prweightlifting-mc1trophies1Find a fabulous selection of weightlifting trophies at TrophyCentral. Each weightlifting trophy Includes free engraving. Medals feature a free medal.Custom Weightlifting Trophies TrophyCentral has an industry-leading selection of weightlifting figure trophies, all discounted.
    All of our sports and recreation trophies include up to three lines of FREE ENGRAVING (larger awards may include additional lines). ]]>
    custom-pageweightlifting-medals1medals498551-20.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find these colorful Weightlifting 2" Epoxy-covered insert stickers discounted at TrophyCentral. Fast shipping, free over $99.custom-pagetrophies-weightlifting-power1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with weightlifting figure discounted at TrophyCentral. Includes free text engraving!cup-lift-pWeightlifting, Sportscustom-pagetrophies-weightlifting-power1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311820JDS-STrophiesSports, Hobby, Org, Livestock1:14%,10:19%Acrylic Weightlifting Triangle Awards with Free Engraving from TrophyCentral. Fast 1-2 Day Shipping!qtweighttrWeightlifting, Sportscustom-pagetrophies-weightlifting-power1trophies498551-310.453633.4trophies1Find this budget weightlifting award trophy discounted at TrophyCentral. Features a real marble base and plastic weightlifter figure. Engraving is free. Fast 1-2 day shipping.Weightlifting, Sportscustom-pagetrophies-weightlifting-power1trophies498551-210.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy weightlifting excellence column insert trophy features a choice of column color, a marble base and free trophy engraving.Weightlifting, Sportscustom-pagetrophies-weightlifting-power1medals498551-20.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Weightlifting Excellence Insert Medals With A Personalized Front Rim Discounted at TrophyCentral. Fast shipping, free over $99.Weightlifting, Sportscustom-pagetrophies-weightlifting-power1medals498551-2120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Weightlifting Excellence Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Shipping is free over $99.Weightlifting, Sportscustom-pagetrophies-weightlifting-power1medals498551-2120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Weightlifting Excellence Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Shipping is free over $99.Weightlifting, Sportscustom-pagetrophies-weightlifting-power1medals498551-2120033TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Weightlifting Excellence Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Shipping is free over $99.Weightlifting, Sportscustom-pagetrophies-weightlifting-power1medals498551-20.525035.5TrophyCentralaward-medalsSports, Hobby, Org, Livestock1Find these colorful Weightlifting insert medals discounted at TrophyCentral. Fast shipping, free over $99.Weightlifting, Sportscustom-pagetrophies-weightlifting-power1trophies498551-21.1plaques1Find these weightlifting insert plaques discounted at TrophyCentral. Price includes free engraving. Shipping is free over $99.Weightlifting, Sportsweightlifting-jigfweightlifting-jisfweightlifting-jibfweightlifting-mc-prweightlifting-mc11Find weightlifting medals discounted at TrophyCentral. Each weightlifting medal features a free ribbon.trophies-weightlifting-powercustom-pagetrophies-weightlifting-power1trophies498551-210.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our weightlifting insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - WeightliftingWeightlifting, Sportscustom-pagetrophies-weightlifting-power1"1-4 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:24%Our popular Weightlifting participation trophies feature a real slant-front marble base and free engraving.qtliftncWeightlifting, Sportscustom-pagetrophies-weightlifting-power1"1-4 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:16%Fabulous Weightlifting Place Trophy with 1st, 2nd or 3rd Place Trim, Marble Base and Free Engraving. Ships in a fast 1-2 days!qtliftplWeightlifting, 1st / 2nd / 3rd / Etc.custom-pagetrophies-weightlifting-power1trophies498551-210.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Weightlifting single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - WeightliftingWeightlifting, Sportscustom-pagetrophies-weightlifting-power1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these weightlifting budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtliftscbWeightlifting, Sportscustom-pagetrophies-weightlifting-power1trophies498551-211821.06TrophyCentraltrophies1Weightlifting, Sportscustom-pagetrophies-weightlifting-power1"1-4 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:16%This popular Weightlifting Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!qtliftyrWeightlifting, Sportscustom-pageappreciation-templates1"Download Only"certificates4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Well Done! template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Well-Done!-Certificatewell-done-freeVolunteer, Thank You, Appreciation, Student, Academiccustom-pagetrophies-golf1"10 business days" "Aliquippa, PA" "UPS"trophies1500110-1412428Glass AmericaCrystal AwardsSports, Hobby, Org, Livestock1:22%,10:28%"Hole-in-One Awards"Westminster Crystal Golf Awards (3 Sizes). Ideal for leagues, schools, and tournaments. Fast shipping.Golf, Sportscustom-pagecustom-pennants-guide11Custom pennants are triangular felt/fabric banners perfect for team spirit, school pride, and fundraising. Learn uses, display options, and benefits.custom-pagecustom-pennants-guide11Explore text, logo, color, and graphic options for custom pennants. Learn design best practices and what's included in standard customization.custom-pagesports-resource-hub11Elite runners share training music strategies. Curated playlists for tempo runs, long runs, and intervals plus science on when music helps vs. hurts performance.custom-pagescholarship-resource-hub11An inside look at what scholarship committees actually value in coach recommendations. Learn what committees look for, common red flags and more!custom-pagescholarship-resource-hub11Inside look at what scholarship committees actually evaluate in teacher recommendation letters. Learn what committees value most and common red flags to avoid.custom-pageask-trophy-expert11Include the recipient's name, achievement, organization, and date. Learn the essential elements and see examples for sports, corporate, and academic trophies.custom-pageexpert-baseball-trophies11Real engraving examples for youth baseball trophies. Learn what to include, formatting guidelines, and common mistakes to avoid when personalizing awards.custom-pageexpert-soccer-trophies11Real engraving examples for youth soccer trophies. Learn what to include, formatting guidelines, and common mistakes to avoid when personalizing awards.custom-pagecustom-pennants-guide11Choose from 4x9" mini pennants, 9x24" standard, or 12x30" large pennants. Get sizing recommendations for team gifts, wall displays, and gym decoration.custom-pageask-trophy-expert11Championship trophies are typically 15-24 inches tall, while participation awards are 6-10 inches. Learn how to choose the right trophy size for your event.custom-pagegift-certificate-templates1"Download Only"certificates4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Gift Certificate template (design 3) is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.gift-certificate-design-3gift-certificate-a3Gift Certificate, Holidaycustom-pageexpert-baseball-trophies11Find the perfect trophy for 9-10 year old baseball players. Expert recommendations on trophy sizes, styles, and budget options for 10U youth teams.custom-pageexpert-baseball-trophies11Understand the difference between participation and MVP trophies for youth baseball. Get sizing guidelines, budget tips, and age-appropriate recognition strategies.custom-pageask-trophy-expert11Resin trophies are budget-friendly and detailed, while crystal offers premium elegance. Learn which material is right for your awards and recognition needs.custom-pageask-trophy-expert11Rosette ribbons feature pleated circular tops for formal competitions. Flat ribbons (including pinked-edge) are economical for participation awards.custom-pageexpert-soccer-trophies11Understand the difference between participation and MVP trophies for youth soccer. Get sizing guidelines, budget tips, and age-appropriate recognition strategies.custom-pageexpert-baseball-trophies11Understand the differences between T-ball and baseball trophies. Learn age-appropriate sizing, styles, and features for players ages 4-12.custom-pagegeneral-corporate-awards1498552-311622.85TrophiesCorporate1Find this popular leadership figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!mqt-leadership-p-plCoach, Leadership, Sportscustom-pagebr3715"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"105502-310.5119217.78Classic Medallicsaward-medals1:22%,10:37%Display your medals with this white cotton-filled box. These Medal Display Boxes Ship Fast.custom-pagecertificateplaques1"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"plaques105502-310.451510.45Classic MedallicsPlaquesCertificate Plaques1:14%,100:25%"Certificate Plaques" "Certificate Plaque" "Plaques That Hold Certificates" "Certificate Holders" "Plaques For Certificates" "Graduation Plaques"See This Popular White Certificate Plaque with Gold Frame Discounted at TrophyCentral. Holds 8 1/2" x 11" Certificate. Fast 1-2 Day Shipping!pn4931whgCertificates / Sealscustom-pagecertificateplaques1"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"plaques105502-310.451813.25Classic MedallicsPlaquesCertificate Plaques1:14%,10:18%,50:23%,100:27%"Diploma Holders" "Padded Diploma Covers" "School Diploma Covers" "Diploma Covers" "Custom Diploma Covers" "Certificate Plaques" "Certificate Plaque" "Plaques That Hold Certificates" "Certificate Holders" "Plaques For Certificates" "Graduation Plaques"Find this White Certificate Plaque discounted at TrophyCentral. Each certificate plaque is gift-boxed.pn4642whCertificates / Sealscustom-pageflower-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"Find white rose pins discounted at TrophyCentral. Each white rose lapel pin features a clutch-pin back. Fast 1-2 day shipping on all flower pins.br387Generalcustom-pagecospwabo50"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745315125016.5PepcoPromotional ProductsSports / Water Bottles1:14%,250:21%,500:31%,1000:45%,2500:49%White Custom Sports Bottles from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.sportsbottles-whiteSports / Water Bottlescustom-pagewhiteboard-accessories14512310-171 3 5 6 7 8 9 10 22 231Bulletin Boards11Find the Whiteboard Cleaner, Expo, 8 oz. Spray Bottle, 12 Per Carton discounted at TrophyCentral.1ghent-new-partitions11Find whiteboard divider partitions with vinyl tackboards discounted at TrophyCentral. Made in the USA by Ghent. Browse now to see our huge selection of dry erase boards and accessories.custom-pageghent-new-whiteboardsm4-afeer-425-12m4-bkm4-bem4-gnm4-rdm4-aer-425-144sps8-1211Find accessories for your dry erase boards, including markers and erases, at TrophyCentral. Also see our huge selection of bulletin boards and markerboards.1magnetic-dry-erase-boardsnon-magnetic-boardscalendar-whiteboardshorizontal-sliderssmartpak-combination-boardswhiteboard-accessoriesghent-new-partitions11Find whiteboards discounted at TrophyCentral. Each whiteboard is made in the US and has a high-quality appropriate for schools and offices.1Fabulous Whiteboards for Schools and Offices If you are looking to buy a dry erase whiteboard for your school classroom or office, you have come to the right place. We have a huge selection - large & small, with lines & without, mobile & stationary and more! We even have sliding markerboards, popular with colleges.

    Quality Presentation Boards for Conference Rooms & Classrooms

    We also have a fabulous selection of markerboards for every type of office and conference room. Be sure to see our easels and partitions, too.

    Shop with Ease with TrophyCentral

    Yes, we sell online, but we have real people who would love to help you! Whether you have a question about a product or are ready to order, feel free to call us toll-free at 1-888-809-8800.]]>
    custom-pagetrophy-award-guides11TrophyCentral offers fabulous discounts on all products and also features a variety of wholesale and affiliate programs for leagues and retailers. Please contact us at 888-809-8800 for more information.custom-pageribbons-neck-drapejumpringshofordrri10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"ribbons105502-310.3612006.36Classic Medallicsribbons1:22%,100:30%,500:40%Find These Wide Neck Ribbons Discounted At TrophyCentral. Perfect for Award Medals 1 3/4" to 3" in Diameter.necrib30x138Red White Blue, Patrioticcustom-pagesoccerwaterbottles1200"7 business days from receipt of camera-ready artwork" "Oxnard, California" "UPS (FedEx available on request)"930307-810.45367.65PLPromotional ProductsWater Bottles1"Basketball Water Bottles" "Logo Sports Bottles" "Sports Bottles" "Promotional Sports Bottles" "Aluminum Sports Bottles" "Stainless Water Bottles" "Aluminum Water Bottles" "Bike Water Bottles" "Bicycle Water Bottles" "Baseball Water Bottles" "Football Water Bottles" "Promotional Water Bottles" "Soccer Water Bottles"Wide Neck Bike Bottle from TrophyCentral. Also see our great selection of engraved and personalized gifts!Sports / Water Bottlescustom-pageinsert-trophies-awards11trophies105503-610.4512424.45Classic MedallicsTrophiesGeneral1:22%Shop for Wide World Trophies from TrophyCentral. Discounted Trophies, Awards and Promotional Products.03-19-2010custom-pagemascotpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsAcademic1:22%,50:30%,100:33%,500:47%"Mascot Awards" "Mascot Pins"Find these Wildcat Lapel Pins and other colorful mascot pins at TrophyCentral. Fast 1-2 day shipping!em02Mascotcustom-pagemascot-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find These Custom Wildcat Mascot Badges Discounted At TrophyCentral.mascotbadges-wildcatcustom-pagegroomsmengifts1"3-4 business days" "Medina, MN" "UPS (FedEx available on request)"personalized gifts553404-710.451619.65JDSGiftsBridesmaids / Groomsmen1:22%Find this fabulous Wine Accessory Gift Set discounted at TrophyCentral. TrophyCentral is known for its top-rated customer serviceBridesmaids / Groomsmencustom-pagesilver-cup-trophies11trophies105503-611.11221.1trophies1:30%Cupcustom-pagetrackpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsSports, Hobby, Org, Livestock1:22%,50:30%,100:33%,500:47%"Track Awards" "Cross Country Awards" "Track Pins" "Track Lapel Pins"Winged Foot, Torch Letter Pins: EC Series Winged Foot, Torch Lapel Pins feature a high-quality enameled finish and ship in just 1-2 business days!ec6506-23-2010custom-pagemedallion-inserts-general-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these quality Winged Victory (504271) Inserts (Litho) at TrophyCentral. Each Winged Victory (504271) Insert can be used to create a unique plaque, medal or trophy.504271
    custom-pagemedallion-inserts-general-medallion-inserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Find these quality Winged Victory Inserts discounted at TrophyCentral. Each Winged Victory insert can be used to create a unique plaque, medal or trophy.50701
    custom-pagequickshiptrophies-wheel1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with car show, winged wheel driving figure discounted at TrophyCentral. Includes free text engraving!cup-wingedwheel-p03-15-2022custom-pagequickshiptrophies-wheel1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find these popular Winged Wheel Figure year trim trophies discounted at TrophyCentral. Available in multiple sizes and includes free engraving. Features gold year of event trim.qtwingedwheelyr03-15-2022custom-pagequickshiptrophies-wheel1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:27%,100:32%Our popular Winged Wheel participation trophies feature a real slant-front marble base and free engraving.qtwingedwheelnc03-15-2022custom-pagequickshiptrophies-wheel1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular winged wheel figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!qtwingedwheelpl03-15-2022custom-pageblog-trophycentral11Create meaningful recognition for chili cook-offs and baking contests with 15+ award categories, budget strategies, and judging tips for winter events.custom-pagegift-certificate-templates1"Download Only"certificates4985501Trophy CentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our winter themed template is free and designed exclusively for Trophy Central. This gift certificate measures 5" x 3" and can be easily downloaded and printed.Winter-Gift-Certificategc-winter-521Gift Certificate, Holidaycustom-pageblog-trophycentral11Beat winter blues with spirit awards that warm cold months. From ugly sweater contests to perfect attendance, discover 18 recognition ideas for schools and workplaces.custom-pageblog-trophycentral11Discover winter sports trophy ideas for ski clubs and snowboard teams. 30+ categories from speed champions to progression awards. Budget strategies under $190 for 40 athletes. custom-pagemascot-plaques1plaques498552-41JDSPlaques1Find this wolf plaque discounted at TrophyCentral. Our wolf mascot plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Mascotcustom-pagemascottrophies1"4-6 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511016.25Classic MedallicsTrophiesAcademic1:22%,5:24%,10:28%,50:32%"Mascot Awards"Buy this Wolf mascot trophy and other mascot awards at TrophyCentral.mt200810-28-2020Mascotcustom-pagemascotinserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-40.3713003.37Classic MedallicsInsertsMascots1Buy these quality Wolverines Mascot Medal Inserts at TrophyCentral. Each Wolverines Insert can be used to create a unique plaque, medal or trophy.489936Mascot
    custom-pagemascotinserts12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-40.3713003.37Classic MedallicsInsertsMascots1Buy these quality Wolves Mascot Medal Inserts at TrophyCentral. Each Wolves Insert can be used to create a unique plaque, medal or trophy.489940Mascot
    custom-pagesports-inserts1105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Swimming Awards"Buy these quality Swimming (Women's Freestyle) Inserts (Litho) at TrophyCentral. Each Swimming (Women's Freestyle) Insert can be used to create a unique plaque, medal or trophy.504191Swimming / Diving, Sportscustom-pageachievement-certificates-awards1"Download Only"certificates49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Women's History Month template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Women's-History-Month-Certificatewomens-history-monthWomen's History, Academic12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
    498555-8.52This page contains images of wood finishes, such as oak, maple and walnut, available with Waddell Display and Trophy Cases.
    custom-pagegeneral-corporate-awardsstarplaque2blankplaquelapplaqcomso7x9medalframeblprplservice-anniversary-plaque1plaques1Shop premium Wood Plaques in Cherry, Walnut and Black finishes. Perfect for academic, sports, and corporate awards. Fast 1-2 day turnaround.

    Looking for a custom engraved wood plaque that makes a lasting impression? TrophyCentral's wood plaques are handcrafted in Cherry, Walnut, Black, and Black Piano finishes - ideal for employee recognition awards, sports banquet plaques, school achievement awards, retirement gifts, and corporate milestone honors. Each plaque includes free professional engraving, ships in 1-2 business days, and is designed to display proudly on any wall or desk for years to come.

    Available in six standard sizes from 7"x9" up to 12"x15", our engraved wood plaques work equally well as a single personalized gift or for bulk orders recognizing an entire team or department. Cherry wood plaques offer a warm, classic look perfect for academic and sports awards, while Walnut plaques add a rich, dark grain favored for executive and retirement recognition. Our Black Piano finish plaques deliver a sleek, high-gloss look popular for corporate and leadership awards.

    Need help choosing the right award or finding the perfect words? Explore these helpful resources:

    FAQs - Custom Engraved Wood Plaques

    What wood finishes are available for engraved plaques?

    We offer four wood finishes to match any recognition style or setting. Cherry and Walnut are the classic choices - Cherry delivers a warm reddish-brown tone that feels timeless and approachable, making it a perennial favorite for school achievement awards, sports banquet plaques, and coach appreciation gifts. Walnut offers a deeper, darker grain with a more formal elegance, often chosen for retirement awards, years of service recognition, and executive honors. For a more contemporary look, our Black and Black Piano finishes bring a bold, modern aesthetic that stands out in corporate environments and leadership award programs. The Black finish features a sharp matte contrast, while the Black Piano finish adds a premium high-gloss lacquered surface that elevates the presentation for top-tier recognition events.

    Does engraving cost extra on wood plaques?

    Text engraving is always included free on every wood plaque order - no hidden fees, no per-character charges. You can personalize your plaque with names, job titles, dates, achievements, and custom messages at no extra cost. If you would like to add a company logo, organization seal, or custom artwork, logo engraving is available as an optional add-on. Our team reviews every order personally and will reach out if they need any artwork files or clarification before production begins.

    What sizes are available for wood plaques?

    Our wood plaques come in six sizes: 7"x9", 8"x10", 9"x7", 9"x12", 10"x8", and 12"x9". Smaller plaques like the 7"x9" work well for individual student or employee awards, while larger sizes like 12"x9" are popular for team plaques, retirement recognition, or prominent wall displays.

    Can I order wood plaques in bulk for a team or company?

    Yes. TrophyCentral specializes in bulk plaque orders for schools, youth sports leagues, corporate recognition programs, and banquet awards. Volume discounts are available - prices drop as low as $35 per plaque on qualifying orders. Every order is reviewed by a real person, not automated, to catch any issues before production.

    How long does it take to receive a custom engraved wood plaque?

    Most personalized wood plaque orders ship within 1-2 business days. Rush delivery options are available if you need your award faster. Free economy shipping is included on orders over $99.

    What occasions are wood plaques best suited for?

    Engraved wood plaques are a versatile recognition award appropriate for a wide range of occasions, including employee of the month awards, years of service milestones, retirement gifts, sports banquet plaques, academic achievement awards, coach appreciation gifts, volunteer recognition, and memorial tributes. Their traditional appearance suits both formal corporate settings and casual school or league banquets.

    ]]>
    gavelplaques perplaq photoplaques
    custom-pagecalendar-whiteboards14512310-171 3 5 6 7 8 9 10 22 2351Bulletin Boards11Find the Ghent Work from Home Bundle, 4-Month Planner Whiteboard and Magnetic Porcelain Whiteboard, 2'H x 3'W discounted at TrophyCentral.1Plannercustom-pagecalendar-whiteboards14512310-171 3 5 6 7 8 9 10 22 23101Bulletin Boards11Find the Ghent Work from Home Bundle, 4-Month Planner Whiteboard and Natural Cork Bulletin Board, 2'H x 3'W discounted at TrophyCentral.1Plannercustom-pagecalendar-whiteboards14512310-171 3 5 6 7 8 9 10 22 2301Bulletin Boards11Find the Ghent Work from Home Bundle, 4-Month Planner Whiteboard, Magnetic Porcelain Whiteboard and Natural Cork Bulletin Board, 2'H x 3'W discounted at TrophyCentral.1Plannercustom-pageghent-new-partitions145123110-171 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Workstation Divider with Clear Thermoplastic Desk Panel and Floor Panel, Open Channel Aluminum Frame, 57"H x 47"W discounted at TrophyCentral.1custom-pageghent-new-partitions145123110-171 3 4 5 6 7 8 9 10 22 231Bulletin Boards11Find the Ghent Workstation Divider with Clear Thermoplastic Desk Panel and Porcelain Whiteboard Floor Panel, Open Channel Aluminum Frame, 57"H x 47"W discounted at TrophyCentral.1custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsBusiness1:22%Find these World Class Certified ISO 9000 Inserts discounted at TrophyCentral. Each ISO 9000 Insert can be used to create a unique plaque, medal or trophy.518730General
    custom-pagecrystalcups1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"general410187-1010.45214.45JcharlesCrystal Awards1:22%,25:25%"Tennis Awards"Find the World Class Cup discounted at TrophyCentral. This Champion's Cup Award includes free engraving!Leadership, Golf, Tennis, Sportscustom-pageeawardmedals12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    medals105503-60.75130033.75Classic Medallicsaward-medalsSports, Hobby, Org, Livestock1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "School Medals" "General Award Medals"These inexpensive 1 1/4 inch World Class Performance Medals offer a high quality, but low price for those on a tight budget.e985802-01-2008General
    custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsGeneral1:22%Buy these quality World Class Performance Inserts (Litho) at TrophyCentral. Each World Class Performance Insert can be used to create a unique plaque, medal or trophy.507582General
    custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
    105502-41130025Classic MedallicsInsertsGeneral1:22%Buy these high-quality World Class Performance Inserts at TrophyCentral. Each World Class Performance Insert can be used to create a unique plaque, medal or trophy.518371General, Business
    custom-pagefreeawardcertificates1"Download Only"certificates4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our World's Best template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-World's-Best-Certificateworlds-best-freeMost Improved, Academic, Appreciationcustom-pageglobal-crystal-awards1"10 business days" "Aliquippa, PA" "UPS"general1500110-1410.451236.45Glass AmericaCrystal Awards1:22%,10:25%Worldview Awards from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.custom-pagestar-pinsbr476gbr476sbr476b11Find These Wreath Star Pins In Three Finishes: Gold, Silver and Bronze. Each Wreath Star Is Includes a Clutch-Back and Is Discounted.stars-wreath

    Pins with Wreath and Stars

    The above wreath pins are available in three finishes: gold, silver and bronze. Each wreath and star pin features a clutch back and measures 7/8" in diameter. Most pins in this section ship from the factory in just 1-2 days. Bulk discounts are available for larger pin orders. For additional sizes and styles, please see our complete star pins section.]]>
    custom-pageaward-medalsqtwrestncqtwrestscqtwrestdmqtwrestyrqtwrestplqtwrestttqtwrestttwqtwrest3ctr7014tr9923wssx71qtwresperpmqtwrestscbcup-wrest-scbcup-wrest-pwrestling-part-iwrestling-single-iwrestling-champ-iwrestling-plaque-iwrestling-e-part-iwrestling-e-single-icup-wrestling-scb-icup-wrestling-inbdg-wrestlingcl140wrestling-mcwrestling-mc-prir17ir35qcm-53m162gm162sm162bj96323d-wrestling-medalstm9996gwrwrestling-jigfwrestling-jibfwrestling-jisfwrestling-inserts-medals1trophies1"Wrestling Awards" "Sports Trophies"

    At TrophyCentral, we take pride in offering a wide range of wrestling trophies that recognize strength, determination, and sportsmanship on the mat. Whether you need awards for youth wrestling leagues, high school tournaments, or championship events, our collection has something for every budget and style. From classic column trophies to modern resin figures and custom engraved plaques, you will find the perfect way to honor outstanding athletes.

    Our wrestling trophies are fully customizable with free engraving to make each award personal and memorable. We also offer bulk discounts, making it easy to order for entire teams or tournaments without breaking the budget. Fast turnaround times ensure your awards arrive on schedule, so you can focus on celebrating your wrestlers' achievements.

    Choose from small, medium, and large sizes to match your event needs - whether you are recognizing every participant or spotlighting top performers. At TrophyCentral, we are committed to helping coaches, teams, and organizations create meaningful moments with quality awards that wrestlers will treasure for years to come.

    Be sure to see our expert guides: ]]>
    trophies-wrestling
    custom-pagetrophies-wrestling1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with wrestling figure discounted at TrophyCentral. Includes free text engraving!cup-wrest-pWrestling, Sportscustom-pagecoaching-teaching-guides11Creative wrestling award ideas with engraving examples for tournaments and team banquets. From Pin Master to Mat General, discover 15+ unique ways to recognize wrestlers with actual trophy wording templates.custom-pagetrophies-wrestling1498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Find this budget wrestling award trophy discounted at Trophy Central. Features a real marble base and plastic wrester figure. Engraving is free. Fast 1-2 day shipping.1trophies-wrestlingWrestling, Sportscustom-pagefree-sports-templates1"Download Only"certificates49855011TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Wrestling template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Wrestling-Certificatewrestling-freeWrestling, Sportscustom-pagecherry-insert-plaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these wrestling insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Wrestling, Sportscustom-pagetrophies-wrestlingwrestling-ei48962350740549819150729650264111"Wrestling Medals"See these Wrestling Inserts at TrophyCentral; Each insert measures 2".1custom-pagetrophies-wrestling1medals498552-40.525035.5TrophyCentralaward-medals11:22%,25:24%,100,27%,500:30%Find these Wrestling Insert Medals With A Personalized Front Rim Discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Wrestling, Sportscustom-pagetrophies-wrestling50"Standard Service: 8 Business Days from Receipt of Artwork, Rush Service (Extra Charge): 3 Business Days from Receipt of Artwork" "Oxnard, CA" "UPS (FedEx available on request)"medals930335-1010.630033.6Simba Calaward-medalsSports, Hobby, Org, Livestock1:22%,300:40%,500:51%,1000:54%"Wrestling Awards" "Wrestling Medals"These 2 1/2 inch custom Wrestling Medals come with an outer-ring which allows you to add your school or league name, date and location.qcm-53Wrestling, Sports11Shop for wrestling medals at TrophyCentral. Each medal includes a ribbon. Also see our fabulous selection of wrestling awards.1Wrestling Award & Recognition Medals If you are looking for a economical alternative to trophies, our wrestling award medals are the perfect solution. Many wrestling medals come in gold, silver and bronze finishes and offer optional engraving to keep the price as low as possible. Be sure to check out our 1 ¼ Inch Budget Medals and our unique Custom Ring Medals. All of our medals include a free ribbon, and many offer a choice of ribbon color. Medals and wrestling awards qualify for free ground shipping on online orders over $100 (Continental US only).]]>custom-pagetrophies-wrestling1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our wrestling insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - WrestlingWrestling, Sportscustom-pagetrophies-wrestling1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy wrestling insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Wrestling, Sportscustom-pagetrophies-wrestling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%,25:23%,50:29%,100:34%"Wrestling Trophies" "Trophies, Wrestling" "Wrestling Trophy"Our popular Wrestling Participation Trophies feature a real slant-front white marble base and free personalization. Significant quantity discounts available.trophies-wrestlingWrestling, Sportscustom-pagekeychains21105502-40.39125035.39Classic MedallicsGiftsKeychains1:22%,10:25%,25:32%,50:39%,100:47%"Wrestling Awards"Find these popular Pewter Wrestling Key Chains at TrophyCentral; discounted prices!pk73-cmKeychainscustom-pageblog-trophycentral11Wrestlers deserve recognition too. This guide provides 20 award categories that celebrate complete wrestlers - technique, toughness, and the character that wrestling builds. custom-pagetrophies-wrestling1trophies498551-311821.06TrophyCentraltrophies1Wrestling, Sportscustom-pagetrophies-wrestling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%"Wrestling Trophies" "Trophies, Wrestling" "Wrestling Trophy"Find this popular wrestling figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!qtwrestplWrestling, 1st / 2nd / 3rd / Etc., Sportscustom-pagetrophies-wrestling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%"Wrestling Trophies" "Trophies, Wrestling" "Wrestling Trophy"This popular Wrestling Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!qtwrestyrSee our complete selection ofin a wide variety of sizes and styles.trophies-wrestlingWrestling, Sportscustom-pagetrophies-academic1trophies105503-610.4511211.73Classic MedallicsTrophiesAcademic1:22%,10:25%,50:29%,100:34%This sculptured resin Writing Award Trophy Includes Engraving. Be sure to see other section for additional Writing Awards.schooltrophies1401-15-2013Writing, Academiccustom-pageachievement-certificates-awards1"Download Only"certificates4985501TrophyCentralCertificates / CoversAward Certificates1"Free Certificates" "Free Award Certificates"Our Writing template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Writing-Certificatewriting-freeWriting, Academiccustom-pageawardcertificates11certificates290631-31 2 3 230.45100020.45Certificate SourceCertificates / CoversAward Certificates1:22%,25:25%,100:36%,500:51%Find this writing certificate discounted at TrophyCentral. Writing certificates are beautifully printed and measure 11 x 8 1/2 inches.964Writing, Academiccustom-pageletter-shaped-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find these popular X-shaped custom mascot badges at TrophyCentral. Great for fundraising! TrophyCentral is a top-rated Yahoo merchant.letterbadges-xcustom-pageofficesigns11240166-810.55183.25Roanoke1Find thi XpeDate Custom Stamp discounted at TrophyCentral.custom-pageofficesigns11240166-810.55183.25Roanoke1Xstamper Custom Round Stamps from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.custom-pageofficesigns11240166-810.5183.2Roanoke1Find this Xstamper Custom Rubber Stamps at TrophyCentral. Also see our great selection of engraved and personalized gifts!11XSURGO Home Page from TrophyCentral.1custom-pageletter-shaped-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find these popular Y-shaped custom mascot badges at TrophyCentral. Great for fundraising! TrophyCentral is a top-rated Yahoo merchant.letterbadges-y111111custom-pageofficesigns11"2-3 business days" "Roanoke, Virginia" "UPS (FedEx available on request)"240162-310.451222.05RoanokeOffice Signs1Find these Custom Yard Signs (For Outdoor Use) Discounted at TrophyCentral.custom-pagetrophies-gymnastics1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%"Gymnastics Awards" "Gymnastics Trophies" "Gymnast Trophies" "Gymnastics Trophy" "Gymnast Trophy"This popular Gymnastics Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!qtgymyrGymnastics, Sports1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)""PT1=Trophies" "PC12=498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find Year Trim Indicator Trophies Discounted At TrophyCentral. Each Year Trim Subject Trophy Includes Free Personalization. Fast 1-2 Day Shipping!1custom-pagetrophies1trophies498551-212Trophies1:14%,10:18%,50:22%,100:25%Find this popular year trim trophy, marble base and free personalization discounted at TrophyCentral. Ships in a fast 1-2 days!custom-pagelapel-award-pinsplastic-pinbox-t5498551-30.550040.5TrophyCentrallapel-award-pins11:22%,25:24%,100,27%,500:30%Find our 3D Series gold yearbook pins discounted at TrophyCentral. Fast 1-2 day shipping.6072024Yearbook, Academiccustom-pagelapel-award-pinsservicepinsservicepins2servicepins3opmxhp21br345service-anniversary-plaqueopm100rt5-year-pb10-year-pb15-year-pb20-year-pb25-year-pb1corporatepins1"Award for Business" "Awards for Business"Find years of service pins in a variety of sizes and styles at TrophyCentral. Each pin is available in 5 year increments and is perfect for an employee service anniversary. Fast 1-2 day shipping.Find Employee Years of Service Pins with Ease! TrophyCentral.com offers a wide variety of service awards and service anniversary lapel pins to celebrate employee milestones. These pins are a great way to recognize your team for their dedication and commitment to your company. Be sure to see our related resource guides: Need help? Our experts in New York, Michigan and online have been helping customer since 1999 and would be happy to help you!]]>corporatepinscustom-pagebadgeribbonsholders1"7-10 business days from receipt of camera-ready artwork" "City of Industry, CA" "UPS (FedEx available on request)"917457-10146022.6BNRibbonsBadge Holders1Find these yellow neck wallets discounted at TrophyCentral. Price includes a free one-color imprint!nw-3633yelcustom-pagecoaching-teaching-guides11Complete baseball coaching resource covering coach-pitch through tournament play. Features hitting, fielding, and base running drills plus motivational award strategies.custom-pagecoaching-teaching-guides11Complete youth basketball coaching resource with age-specific drills, game strategies, and motivational award systems. Transform your team with proven practice plans for ages 5-14.unused-products11"Quick-Ship Item!: 1-2 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"105502-31313030Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,200:44%Youth Trophy - Basketball. Ideal for leagues, schools, and tournaments. Fast shipping.trophies-basketballSee alltrophies-basketballBasketball, Sportscustom-pageblog-trophycentral11Recognition strategies that genuinely motivate kids ages 5-18. Combine specific praise with strategic awards to build growth mindset and confidence. Free certificates included.custom-pagecoaching-teaching-guides11Everything first-time soccer coaches need: age-appropriate drills, formation basics, and team building strategies. Includes free award certificates and recognition ideas.custom-pageblog-trophycentral11Award ideas for spring youth soccer leagues covering MVP, Golden Boot, goalkeeper, sportsmanship, and participation. Budget breakdown for 20-player rosters and practical ceremony tips for coaches.custom-pagesports-resource-hub11Essential guide for youth sports parents covering age-appropriate awards, budget planning, recognition strategies, and seasonal sports calendars for successful young athlete development.custom-pageletter-shaped-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoPromotional Products1Find these popular Z-shaped custom mascot badges at TrophyCentral. Great for fundraising! TrophyCentral is a top-rated Yahoo merchant.letterbadges-zcustom-pagegeneral-corporate-awards1"14 business days" "Erlanger, KY" "UPS"general410187-1010.451 2 3 4 5 6 7 8 9432.45JcharlesGeneral Awards1:22%,25:25%See this Zephyr Award at TrophyCentral. Also see our great selection of engraved and personalized gifts!Return to ourcategory for other fabulous choices.general-corporate-awards06-02-2014custom-pagecrystalgifts1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"general410187-1010.45420.45JcharlesCrystal AwardsClocks1:22%,100:23%"crystal awards"Zilo Desk Clock from TrophyCentral. See our great selection of engraved and personalized gifts!test12-3 business days
    With engraving:
    4-6 business days" "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
    498555-8.521