custom-pagehonor-roll-certificates15"1-3 business days" "Columbia, South Carolina; Marquette, Michigan" "UPS (FedEx available on request)"certificates290631-21 2 3 230.45100020.45Certificate SourceCertificatesAward Certificates1:22%,50:38%,100:42%Find these "A B" Honor Roll certificates discounted at TrophyCentral. Each "A B" Honor Roll certificate measures 8 1/2 x 11 inches and typically ships in 1-2 days.7038See more:certificatesHonor Roll, Academiccustom-pagehonor-roll-certificates15"1-3 business days" "Columbia, South Carolina; Marquette, Michigan" "UPS (FedEx available on request)""PT1=290631-21 2 3 230.45100020.45Certificate SourceCertificatesAward Certificates1:22%,50:38%,100:42%"Honor Roll" "Honor Society" "Honor Society Awards" "Honor Roll Awards"Find these "A" Honor Roll certificates discounted at TrophyCentral. Each "A" Honor Roll certificate measures 8 1/2 x 11 inches and typically ships in 1-2 days.honor-roll-certificatesHonor Roll, Academiccustom-pagegeneral-corporate-awards11"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"458221512228Vision AwardsTrophies1:22%,26:28%Find the "Balance" Stainless Leadership Teamwork Award at TrophyCentral; this award is perfect to recognize a significant achievement.11-15-2017custom-pagesports-pinsplasticpinboxvelapinbox151-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
lapel pins105502-30.31150030.3Classic MedallicsLapel PinsSports, Hobby, Org, Livestock1:30%,50:36%,100:39%,500:42%,1000:48%"Baseball Pins" "Baseball Lapel Pins" "Soccer Pins" "Soccer Lapel Pins" "Football Pins" "Football Lapel Pins" "Basketball Pins" "Basketball Lapel Pins"Find this fabulous "Co-Captain" letter pin and other sports award pins discounted at TrophyCentral.cl54Sports
custom-pagetrophies-cheerleading-spirit1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.45169.5Tower RibbonTrophies1:14%Each Lightening Boltz Series Cheerleaders Trophy Includes Up to 3 Lines Of Engraving With Choice of Gold Mylar Or Black Engraving Plate.wlbx60Cheerleading, Sportscustom-pagereadingawards1certificates290631-31 2 3 230.45100020.45Certificate SourceCertificatesAward Certificates1:22%,25:24%,100:40%,500:50%"Reading Award" "Reading Awards" "Reading Medals" "Reading Lapel Pins" "Reading Award Pins"Find these Really Into Reading Certificates discounted at TrophyCentral. Each certificate is beautifully printed and measures 8 1/2 x 11.908Readingcustom-pageglass-crystal-awards1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"general410187-1013627JcharlesCrystal Awards1:22%,25:23%Our deeply discounted "The Studio" Awards have a simple, yet dynamic design. Available in two sizes, personalization is included. Order today!06-20-2017Leadershipcustom-pageglass-crystal-awards1"10-15 business days w/engraving" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"general105505-1010.451420.45Classic MedallicsCrystal Awards1:22%,25:23%Find this Crystal #1 Trophy at TrophyCentral; Includes Engraving. TrophyCentral is a Top-Rated Yahoo Merchant.Generalcustom-pagegifcer11"Within 48 hours!" "N/A" "Automatic E-Mail"105091-2111 2 3 4 5 6 7 8 9Gift Certificates1custom-pagegifcer11"Within 48 hours!" "N/A" "Automatic E-Mail"105091-2111 2 3 4 5 6 7 8 9Gift Certificates1custom-pagegifcer11"Within 48 hours!" "N/A" "Automatic E-Mail"105091-2111 2 3 4 5 6 7 8 9Gift Certificates1Select this link to purchase a $250 gift certificate towards any purchase at TrophyCentral. Choose from awards, display cases and personalized gifts!custom-pagegifcer11105091-2111 2 3 4 5 6 7 8 9Gifts1Shop for $35 Gift Certificate from TrophyCentral.custom-pagegifcer11"Within 48 hours!" "N/A" "Automatic E-Mail"105091-2111 2 3 4 5 6 7 8 9Gift Certificates1custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Wrestling (498191) Inserts (Litho) at TrophyCentral. Each 2" insert can be used to create a unique plaque, medal or trophy.498191Wrestling, Sports
custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Wrestling (502641) Inserts (Litho) at TrophyCentral. Each Wrestling (502641) Insert can be used to create a unique plaque, medal or trophy.502641Wrestling, Sports
custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Wrestling (507296) Inserts (Litho) at TrophyCentral. Each Wrestling (507296) Insert can be used to create a unique plaque, medal or trophy.507296Wrestling, Sports
custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Softball (507391) Inserts (Litho) at TrophyCentral. Each Softball (507391) Insert can be used to create a unique plaque, medal or trophy.507391Softball, Sports
custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Wrestling (507405) Inserts (Litho) at TrophyCentral. Each Wrestling (507405) Insert can be used to create a unique plaque, medal or trophy.507405Wrestling, Sports
custom-pagecustommedalswhitcarboarbvelourbox50"5-7 business days" "Mt. Vernon, NY" "UPS"medals105503-610.45115024.45Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,100:33%,300:41%"New Products" "Track Medals"Find these fabulous Silver Boys Track Medals discounted at TrophyCentral. Price includes the name of your school or organization imprinted on the front of the medal!m156scustom-pagecustommedalswhitcarboarbvelourbox50"5-7 business days" "Mt. Vernon, NY" "UPS"medals105503-610.45115024.45Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,100:33%,300:41%"New Products" "Track Medals"Find these fabulous Bronze Girls Track Medals discounted at TrophyCentral. Price includes the name of your school or organization imprinted on the front of the medal!m157bcustom-pagecustommedalswhitcarboarbvelourbox50"5-7 business days" "Mt. Vernon, NY" "UPS"medals105503-610.45115024.45Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,100:33%,300:41%"New Products" "Track Medals"Find these fabulous Silver Girls Track Medals Discounted at TrophyCentral. Price includes the name of your school or organization imprinted on the front of the medal!m157sir11ir12ir13ir14ir15ir16ir17ir18ir19ir20ir21ir22ir23ir24ir25ir26ir27ir28ir29ir30ir31ir32ir33ir35ir36ir37ir38ir39ir4011Shop for these 1 1/2" IR Series Medals at TrophyCentral. Available in sports and school subjects.1custom-pagetrophies-music12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic MedallicsMedalsAcademic1:22%,10:27%,100:36%"Music Medals" "Music Awards"These 1 1/2 Inch Music medals come in gold, silver and bronze finishes and are perfect for recognizing different place winners.ir30Music / Band / Chorus
custom-pagescienceawards12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic MedallicsMedalsAcademic1:22%,10:27%,100:36%"Science Medals" "Science Awards"These 1 1/2 Inch Science medals come in gold, silver and bronze finishes and are perfect for recognizing different place winners.ir223-31-2017Science
custom-pagecustommedals50"5-7 business days" "Mt. Vernon, NY" "UPS"medals105503-610.6115017.1Classic MedallicsMedalsGeneral1:22%,100:33%,300:41%"Achievement Medals"Find these fabulous Silver Achievement Medals discounted at TrophyCentral. Price includes the name of your school or organization imprinted on the front of the medal!m155sGeneral, Custom Medalscustom-pagecustommedalswhitcarboarbvelourbox50"5-7 business days" "Mt. Vernon, NY" "UPS"medals105503-610.45115024.45Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,100:33%,300:41%"New Products" "Sports Medals"Find these fabulous Bronze All Sports Medals discounted at TrophyCentral. Price includes the name of your school or organization imprinted on the front of the medal!m163bCustom Medalscustom-pagecustommedalswhitcarboarbvelourbox50"5-7 business days" "Mt. Vernon, NY" "UPS"medals105503-610.45115024.45Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,100:33%,300:41%"New Products" "Sports Medals"Find these fabulous Gold All Sports Medals discounted at TrophyCentral. Price includes the name of your school or organization imprinted on the front of the medal!m163gCustom Medalscustom-pagecustommedals50"5-7 business days" "Mt. Vernon, NY" "UPS"medals105503-610.6115017.1Classic MedallicsMedalsGeneral1:22%,100:33%,300:41%"New Products" "Achievement Medals"Find these fabulous Bronze Achievement Medals discounted at TrophyCentral. Price includes the name of your school or organization imprinted on the front of the medal!m155bGeneral, Custom Medalscustom-pagecustommedalswhitcarboarbvelourbox50"5-7 business days" "Mt. Vernon, NY" "UPS"medals105503-610.45115024.45Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,100:33%,300:41%"New Products" "Sports Medals"Find these fabulous Silver All Sports Medals discounted at TrophyCentral. Price includes the name of your school or organization imprinted on the front of the medal!m163sCustom Medalscustom-pagecustommedalswhitcarboarbvelourbox50"5-7 business days" "Mt. Vernon, NY" "UPS"medals105503-610.45120032.45Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,100:33%,300:41%"Wrestling Medals"Find these Silver Wrestling Medals discounted at TrophyCentral. Price includes the name of your school or organization imprinted on the front of the medal!m162sWrestling, Sportscustom-pagetrophies-dance12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "Art / Dance / Drama Medals"These inexpensive 1 1/4 inch Ballet Medals offer a high quality, but low price for those on a tight budget.e908407-01-2018Dance
custom-pagetrophies-basketball12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,100:28%,500:34%,1000:45%"Basketball Awards" "Award Medals - All Subjects" "Sports Medals" "Basketball Medals"Basketball Hoop Medal (1 1/4"). Ideal for leagues, schools, and tournaments. Fast shipping.Return to the section for more great choices!basketballmedalsBasketball, Sports
custom-pageart-trophies12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic MedallicsMedalsMusic, Drama, Art, Dance1:22%,100:28%,500:34%,1000:45%"Art Awards" "Award Medals - All Subjects" "School Medals" "Art / Dance / Drama Medals"These inexpensive 1 1/4 inch Art Medals offer a high quality, but low price for those on a tight budget.e992606-01-2014Art, Academic
11 2 3 4 5 6 7 8 91Shop for E-Series Budget Medals at TrophyCentral. Each Budget Medal Includes a Neck Ribbon.1Budget Medals The medals in this section measure 2" in diameter. Where appropriate, medals in this section are available in a gold, silver or bronze finish. Each budget medal includes a free neck or military drape ribbon. Optionally, medals may have individual engraving on the back. These medals also feature an optional inexpensive, but high-quality imprint. An imprint is similar to engraving, but all medals must be the same.

]]>
Budget Medals
custom-pagetrophies-volleyball12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,100:28%,500:34%,1000:45%"Volleyball Awards" "Volleyball Medals"These inexpensive 1 1/4 inch Volleyball (Male) Medals offer a high quality, but low price for those on a tight budget.e9027Volleyball, Sports
custom-pagetrophies-chess12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "Sports Medals" "Chess Medals"These inexpensive 1 1/4 inch Chess Medals offer a high quality, but low price for those on a tight budget.e9824Chess
custom-pagetrophies-bicycle-cycling12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "Sports Medals" "Biking Medals"These inexpensive 1 1/4 inch Bicycle (Bike) Medals offer a high quality, but low price for those on a tight budget.e902904-25-2016Bicycling / Cycling, Sports
custom-pagetrophies-drama12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic MedallicsMedalsMusic, Drama, Art, Dance1:22%,100:28%,500:34%,1000:45%"Drama Medals and Lapel Pins" "Drama Awards" "Award Medals - All Subjects" "School Medals" "Art / Dance / Drama Medals"These inexpensive 1 1/4 inch Drama Medals offer a high quality, but low price for those on a tight budget.e9009See oursection, featuring popular trophies, medals and pins.trophies-dramaDrama
custom-pagetrophies-bowling12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,100:28%,500:34%,1000:45%"Bowling Awards" "Award Medals - All Subjects" "Sports Medals" "Bowling Medals"These inexpensive 1 1/4 inch Bowling Medals offer a high quality, but low price for those on a tight budget.e9136Bowling
sciencemedals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic Medallicsaward-medalsAcademic1:22%,100:28%,500:34%,1000:45%"Science Medals" "Award Medals - All Subjects" "School Medals" "Science Awards"These inexpensive 1 1/4 inch Science Medals offer a high quality, but low price for those on a tight budget.e990106-15-2013Science
custom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic MedallicsMedalsSports, Hobby, Org, Livestock Bottles1:22%,100:28%,500:34%,1000:45%"Track Medals"These inexpensive 1 1/4 inch Triathlon Medals offer a high quality, but low price for those on a tight budget.e697309-15-2013
custom-pagetrophies-honor-roll-society12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic MedallicsMedalsAcademic1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "School Medals" "Honor Roll" "Honor Roll Medals" "Honor Roll Trophies"These inexpensive 1 1/4 inch Honor Roll Medals offer a high quality, but low price for those on a tight budget.e9960Honor Roll, Academic
noindexed-items1"PC12=105502-510.451 2 3 4 5 6 7 8 920036.45Classic Medallics1:22%,100:26%1custom-pagetrophies-ice-hockey12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,100:28%,500:34%,1000:45%"Hockey Awards" "Ice Hockey Awards" "Award Medals - All Subjects" "Sports Medals" "Hockey Medals" "Ice Hockey Medals"These inexpensive 1 1/4 inch Ice Hockey Medals offer a high quality, but low price for those on a tight budget.e9025Hockey, Sports
custom-pagetrophies-lacrosse12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,100:28%,500:34%,1000:45%"Lacrosse Awards" "Award Medals - All Subjects" "Sports Medals" "Lacrosse Medals"These inexpensive 1 1/4 inch Lacrosse Medals offer a high quality, but low price for those on a tight budget.e9080Lacrosse, Sports
custom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic MedallicsMedalsSports, Hobby, Org, Livestock Bottles1:22%,100:28%,500:34%,1000:45%"Track Medals"These inexpensive 1 1/4 inch Cross Country (Male) Medals offer a high quality, but low price for those on a tight budget.e905906-20-2019
custom-pagetrophies-karate-martial-arts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,100:28%,500:34%,1000:45%"Karate Awards" "Award Medals - All Subjects" "Sports Medals" "Karate Medals"These inexpensive 1 1/4 inch Martial Arts Medals offer a high quality, but low price for those on a tight budget.e9385Return to the section for other fabulous choices.karatemedalsKarate / Martial Arts, Sports
noindexed-items12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105503-60.7530033.75Medals1These inexpensive 1 1/4 inch E-Series Medals offer a high quality, but low price for those on a tight budget.1e-medals-all
custom-pagescienceawards1e9005 tm9757 z9005 z9901 br584 br432 hp182-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
"PT1=Medals" "PC11=105503-60.75130033.75Classic MedallicsMedalsAcademic1:22%,100:28%,500:34%,1000:45%"Science Medals" "Award Medals - All Subjects" "School Medals" "Science Awards"This budget science Medal measures 1 1/4" in diameter and offer a high quality for a great price. Fast shipping. Optional engraving on back.e900506-15-2013Science
custom-pagefirst-place-ribbons25award-ribbons-printed"1-2 business days" "Topeka, Indiana" "UPS (Post Office Priority Mail may also be available)"ribbons465711-31 261250025.36Tower RibbonRibbonsStock Ribbons1:22%,100:37%,500:56%Find this 1 5/8 inch economy ribbon discounted at TrophyCentral. These are pre-printed ribbons available in many subjects.resx1st / 2nd / 3rd / Etc., Participant, Blue Ribboncustom-pageaward-ribbons-printed25award-ribbons-printed"1-2 business days" "Topeka, Indiana" "UPS (Post Office Priority Mail may also be available)"ribbons465711-31 261.0250025.36Tower RibbonRibbonsStock Ribbons1:22%,100:37%,500:56%Find this popular economy ribbon discounted at TrophyCentral. Choose from subjects like Perfect Attendance, Most Improved and many more!res6xx1st / 2nd / 3rd / Etc., Participant, Great Job, Good Sport, Perfect Attendance, Honor Roll, Most Improved, Awesome, Citizenship, Happy Birthday, Outstanding, Super Reader, Achievementcustom-pageaward-ribbons-printed25award-ribbons-printed"1-2 business days" "Topeka, Indiana" "UPS (Post Office Priority Mail may also be available)"ribbons465711-31 262250025.36Tower RibbonRibbonsStock Ribbons1:22%,100:34%,500:47%Find this economy ribbon with pinked top discounted at TrophyCentral. These are pre-printed ribbons available in many subjects.1esx1st / 2nd / 3rd / Etc., Honorable Mention, Participant, Participation, Board Member, Chairman, Committee, Director, Exhibitor, Guest, Host, Judge, Member, Official, Press, President, Speaker, Sponsor, Secretary-Treasurer, Staff, Treasurer, Usher, Vice President, Visitortrophy-and-award-buying-lists11Explore 9 awards for your rising star. These awards celebrate the budding talent of young performers and make their hard work shine even brighter.trophy-and-award-buying-lists11trophy-and-award-buying-lists11Discover a guide to fun music awards for students and performers. Explore unique trophies, medals, and lapel pins to celebrate musical achievements and encourage young talent.trophy-and-award-buying-lists11Explore 10 inexpensive motivational reading awards for children from TrophyCentral.com, including medals, trophies, stickers, and free reading certificates.readingawards11Discover 10 popular types of trophies for sports, corporate events, and community celebrations. From classic cups to custom awards, find the perfect trophy to honor excellence and achievement.1trophy-and-award-buying-lists11trophy-and-award-buying-lists11custom-pageservicepins1plastic-pinbox-t1lapel pins498551-20.525040.5TrophyCentralLapel Pins11:22%,25:24%,100,27%,500:30%Find this 10-year service anniversary lapel pins discounted at TrophyCentral. Features a clutch-pin back for easy attachment to clothing.. Fast 1-2 day shipping.10-year-pbcustom-pagepersonalizedleather-leathergifts1"4 to 7 business days w/initials or name, 10 to 14 w/logo , 3 to 5 for stock items, (rush service available – please call)" "Teaneck, NJ" "UPS (FedEx available on request)"498554-710.454.25JDS IndustriesGiftsLeather Gifts11"Executive Gifts"Leatherette Wall Decor from TrophyCentral.Leather Giftscustom-pageclocks1"1-2 business days" "Marquette, MI" "UPS"personalized gifts498852-310.451214.85Quick TrophyGiftsClocks1:14%"New Products"Our Rosewood finish clock features a beautiful gold 3-hand clock with an engraving plate below. Personalize up to 4 lines of engraving. Makes a great gift!10x13rosewoodclockEngraved Clockscustom-pageplaques19x7blackh 12x9blackh 8x10blackp"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498552-310.45818.45JDS-SPlaquesBlank Plaques1:30%,5:32%,10:34%,25:37%Shop our black finish horizontal plaque with choice of engraving plate. Engraving includes up to 13 lines of engraving. Shop our discounted plaques today!10x8blackhBlank, Generalcustom-pageplaques1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498552-310.45818.45JDS-SPlaquesBlank Plaques1:30%,5:32%,10:34%,25:37%"Meeting or Exceeding Goals"Elegant black piano finish plaque with choice of engraving plate. Price includes up to 13 lines of engraving. Horizontal, measures 10"x8". Shop today!10x8pianohBlank, Generalcustom-pageplaques19x7cherryh 12x9cherryh 8x10cherryp"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498552-310.45818.95JDS-SPlaquesBlank Plaques1:30%,5:33%,10:38%,25:43%1:30%,5:33%,10:37%,25:41%1:30%,5:33%,10:37%,25:41%"Minuteman" "Fire Awards" "Fire Trophies" "Special Picks" "Fire Department Awards" "Fire Department Trophies"Cherry finished plaque with choice of engraving plate. Price includes up to 13 lines of engraving . Horizontal, measures 10"x8". Shop our plaques today!10x8cherryhBlank, Generalcustom-pageplaques19x7walnuth 12x9walnuth 8x10walnutp"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498552-310.45818.45JDS-SPlaquesBlank Plaques1:30%,5:34%,10:39%,25:45%"Minuteman" "Meeting or Exceeding Goals"10" x 8" Walnut plaque with choice of engraving plate and finish. Price includes up to 13 lines of engraving. Fast 1-2 day shipping!10x8walnuthBlank, Generalcustom-pagecertificate-diploma-covers11"1-3 business days" "Columbia, South Carolina" "UPS (FedEx available on request)"diploma covers290631-31 2 3 230.61 2 3 4 5 6 7 8 92016.6Diploma Covers1"Award Certificates and Diploma Covers" "Award Certificates and Diploma Holders" "Award Certificates and Diploma Frames" "Award Certificate and Diploma Holders" "Certificate and Diploma Holders" "Certificates and Frames" "Certificates and Diploma Holders" "Diploma Covers and Certificates" "Diploma Covers and Award Certificates" "Diploma Covers, Frames and Holders" "Diploma Covers, Frames, Holders and Certificates"custom-pagecorporatepinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31 2 3 4 5 6 7 8 91150030.3Classic MedallicsLapel PinsBusiness1:30%,50:32%,100:35%,500:39%"Employee Lapel Pins" "Corporate Lapel Pins"Find this 100 Percent Caring Pin at TrophyCentral. 100 Percent Caring and other pins ship in just 1-2 business days!br343Business, Generalcustom-pagecorporatepinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31 2 3 4 5 6 7 8 91150030.3Classic MedallicsLapel PinsBusiness1:30%,50:32%,100:35%,500:39%Find this 100 Percent Quality Pin at TrophyCentral. 100 Percent Quality and other pins ship in just 1-2 business days!br342Business, Generalcustom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality 101st Airmobile Division Inserts at TrophyCentral. Each 101st Airmobile Division Insert can be used to create a unique plaque, medal or trophy.515159Military, Hero
custom-pageseatcushions110"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Texas" "UPS (FedEx available on request)"7745330143427.12PepcoPromotional ProductsSeat Cushions1Find Quality 20" Vinyl Chairback Covers at TrophyCentral.custom-pageplaques11plaques6063010-141 3 230.451622.85RS OwensPlaquesPerpetual Plaques1:22%Eagle Perpetual Plaques from TrophyCentral. Discounted Trophies, Awards and Promotional Products.12-20-2020Leadership, Herocustom-pageseatcushions150"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Texas" "UPS (FedEx available on request)"7745310-14143431.2PepcoPromotional ProductsSeat Cushions1:22%,250:32%,1000:50%12" Square 1" Thick Vinyl Bleacher Seat Cushions Discounted Trophies, Awards and Promotional Products.12x12x1vicucustom-pagepersonalizedleather-leathergifts1"4 to 7 business days w/initials or name, 10 to 14 w/logo , 3 to 5 for stock items, (rush service available – please call)" "Teaneck, NJ" "UPS (FedEx available on request)"498554-710.454.45JDS IndustriesGiftsLeather Gifts11"Personalized Holiday Gifts" "Custom Gifts" "Holiday Gifts" "Personalized Christmas Gifts" "Unique Personalized Gifts" "Unique Custom Gifts" "Unique Holiday Gifts" "Executive Business Gifts" "Business Holiday Gifts" "Select Holiday Gifts"Top Quality Vaqueta Organizer Laptop Case from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.Leather Giftscustom-pageplaques1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498552-310.45729.15JDS-SPlaquesBlank Plaques1:30%,5:31%,10:32%,25:35%Find these 12 x 9 inch (horizontal) Black Finish Award Plaques at TrophyCentral. Each Black Finish Plaque Includes Free Engraving.12x9blackhBlank, Generalcustom-pageplaques1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498552-310.45821.00JDS-SPlaquesBlank Plaques1:30%,5:31%,10:32%,25:35%"Minuteman" These beautiful 12" x 9" horizontal plaques feature a fabulous black piano finish. Each plaque includes free engraving and ships from our factory in just 1-2 business days!Blank, Generalcustom-pageplaques1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498552-310.45821JDS-SPlaquesBlank Plaques1:30%,5:33%,10:35%,25:39%"Minuteman"Find this 12 x 9 Cherry Plaque discounted at TrophyCentral. Price includes free engraving.12x9cherryhBlank, Generalcustom-pagefloating-plaques1"1-2 business days" "Marquette, MI" "UPS"plaques498552-310.451619.65TrophyCentralPlaquesBlank Plaques1:14%"New Products"Find this 12 x 9 inch black piano finish plaque with floating acrylic and other glass plaques at discounted at TrophyCentral.12x9floatingpianoBlank, Generalcustom-pagefloating-plaques1"1-2 business days" "Marquette, MI" "UPS"plaques498552-310.451619.65Quick TrophyPlaquesBlank Plaques1:14%"New Products"Find this fabulous 12 x 9" horizontal floating acrylic plaque discounted at TrophyCentral. Price includes personalization!12x9floatingrosewoodBlank, Generalcustom-pageplaques1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498552-310.45821.00JDS-SPlaquesBlank Plaques1:30%,5:33%,10:37%,25:42%"Minuteman"Find These 12" x 9" Walnut Finish Plaques Discounted at TrophyCentral. Price Includes Free Engraving. Fast 1-2 Day Shipping!12x9walnuthBlank, Generalcustom-pagegavelplaques1"1-2 business days" "Marquette, MI" "UPS"plaques498552-310.451216.05Quick TrophyPlaquesGeneral1:14%"New Products"This fabulous gavel plaque features a gold electroplated gavel and engraving box mounted on a black felt shadowbox with walnut frame. Shop Trophy Central today!Gavelcustom-pageseatcushions150"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Texas" "UPS (FedEx available on request)"7745310-14143431.2PepcoPromotional ProductsSeat Cushions1:14%,1000:36%Quality 14" Square 1 1/4" Thick Vinyl Cushion at TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.custom-pageseatcushions150"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Texas" "UPS (FedEx available on request)"7745310-14143432.56PepcoPromotional ProductsSeat Cushions1:14%,1000:24%Quality 14" Square 2 1/2" Thick Vinyl Cushion at TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.custom-pageseatcushions150"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Texas" "UPS (FedEx available on request)"7745310-14143431.2PepcoPromotional ProductsSeat Cushions1:14%,1000:30%Find Quality 14" Square 2" Thick Vinyl Cushion at TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.custom-pageservicepins1plastic-pinbox-t1lapel pins498551-20.525040.5TrophyCentralLapel Pins11:22%,25:24%,100,27%,500:30%Find this 15-year service anniversary lapel pins discounted at TrophyCentral. Features a clutch-pin back for easy attachment to clothing.. Fast 1-2 day shipping.15-year-pbtrophy-and-award-buying-lists11Explore the top 17 most popular awards from Trophy Central for recognizing employee leadership and sales excellence. Find the perfect award to motivate and celebrate your team.general-corporate-awardscustom-pageribbons1-tiaras1"1-3 business days" "Topeka, Indiana" "UPS (Post Office Priority Mail also available)"465711-21 260.451 2 3 4 5 6 7 8 93629.25Tower RibbonSpiritTiaras1:22%Find Scepters for Pageants and Homecoming Events - all discounted - at TrophyCentral.rtsp69401-02-2011custom-pagetrophies-golf1"10 business days" "Aliquippa, PA" "UPS"trophies1500110-1410.451236.45Glass AmericaCrystal AwardsSports, Hobby, Org, Livestock1:22%,10:25%"Hole-in-One Awards"19th Hole Golf Award (3 Sizes). Ideal for leagues, schools, and tournaments. Fast shipping.Golf, Sportscustom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceSealsEmbosser Seals1:22%,3:28%,5:31%Find these 1st Nine Weeks Embossed Certificate Seals discounted at TrophyCentral. Features Pressure-Sensitive Backing for Easy Sealing.8031nwcustom-pageplace-trophies20medals498552-40.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful 1st Place 2" Epoxy-covered insert decal discounted at TrophyCentral. Fast 1-2 day shipping.1st / 2nd / 3rd / Etc., Sportscustom-pageplace-trophies1medals498552-30.525033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this 1st Place Winner 2 1/4" Antique Gold Medal Discounted at TrophyCentral. Each medal features a free ribbon. Fast shipping!1st / 2nd / 3rd / Etc., Sportscustom-pageplace-trophies1trophies498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a 1st Place insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-1st-Insert1st / 2nd / 3rd / Etc., Sportscustom-pageplace-trophies1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our 1st single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - 1st1st / 2nd / 3rd / Etc., Sportscustom-pageplace-trophies1trophies498551-311821.06TrophyCentralTrophies11st / 2nd / 3rd / Etc., Sportscustom-pageplace-trophies1trophies498551-310.71217.38Trophies11st / 2nd / 3rd / Etc., Sportscustom-pageplace-trophies1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these 1st Place Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.1st / 2nd / 3rd / Etc., Sportscustom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceSealsEmbosser Seals1:22%,3:28%,5:31%Find these 1st Ribbon Embossed Certificate Seals discounted at TrophyCentral.8031stcustom-pageplace-trophies1medals498552-30.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this Colorful 1st Place insert medal with a star design discounted at TrophyCentral. Fast 1-2 day shipping.1st / 2nd / 3rd / Etc., Sportscustom-pageplace-trophies1medals498552-40.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this 1st Place insert medal With A Personalized Front Rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.1st / 2nd / 3rd / Etc., Sportscustom-pageplaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these 1st Place insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.1st / 2nd / 3rd / Etc., Sportscustom-pageplaques1"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498852-310.45811.6Quick TrophyPlaquesInsert1:14%,3:14%Find This 1st Place Color Decal Plaque with a Colorful 2" Torch Emblem and a Cherry Finish Discounted At TrophyCentral. Price Includes Engraving! Fast 1-2 Day Shipping!qsinplaq1stSports, Academic, General, Torch, Achievement, 1st / 2nd / 3rd / Etc.custom-pagemotivational-stickers1first-place-ribbons"1 - 2 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-21 2 3 230.451224.45Certificate SourceStickersStickers1:22%,3:24%Find these colorful 1st Place Motivational Stickers discounted online at TrophyCentral. Fast 1-2 day shipping - free on orders over $100!bstick8Sports, Academic, General, Torch, Achievement, 1st / 2nd / 3rd / Etc.custom-pageplace-trophies1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our 1st insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - 1st1st / 2nd / 3rd / Etc., Sportscustom-pagetrophies-bass-fishings2cx2dgsxblue-ribbonsstocawribwit9csxflatstocpinr4bsxs2bx2dsx4csxresxcusminwfunbustockrosettecusrossinstrstocmin1award-ribbons-rosettes1Celebrate champions with premium 1st place ribbons. Customizable designs, competitive pricing, bulk discounts. Stock items ship fast. Order your awards now!first-place-ribbonsCelebrate Top Achievements with Stunning 1st Place Ribbons

Our eye-catching designs provide instant recognition for winners, featuring vibrant colors and professional finishing that commands attention. These premium awards create lasting memories for recipients while showcasing the prestige of 1st place accomplishments.

Perfect for school competitions, sporting events, corporate recognition programs, and academic achievements where excellence deserves proper acknowledgment. From science fairs to track meets, our ribbons elevate any award ceremony with a distinguished presentation.

Quality Materials & Customization Options

Crafted from premium satin and grosgrain fabrics with vibrant, fade-resistant imprint colors that maintain their brilliance over time. Our superior materials ensure durability while delivering the professional appearance your event deserves.

Personalize your ribbon with custom text, event names, logos, or choose from metallic foil color options for added elegance. Our design team works with you to create unique awards that perfectly reflect your organization's brand and event theme.

Why Buy 1st Place Ribbons from Trophy Central?

With decades of award expertise, we guarantee fast turnaround times and offer substantial bulk discounts for large orders. Our streamlined process ensures your ribbons arrive exactly when you need them for your event.

Thousands of satisfied customers trust our exceptional service and quality craftsmanship, backed by comprehensive customer support. We include free design assistance to make your ordering experience seamless and stress-free.

Order Your 1st Place Ribbons Today

Simply choose your preferred style from our extensive collection, add your custom details, and proceed to our secure checkout process. Our user-friendly ordering system makes it easy to get exactly what you need. Browse our in-stock ribbon collection for immediate availability, or customize designs to match your specific event requirements.

We maintain ample stock levels to ensure fast shipping options and complete satisfaction with every order. Join thousands of satisfied customers who trust Trophy Central for their recognition needs.

Frequently Asked Questions

How does the customization process work?

Simply provide your text, logo, or design requirements during checkout, and our team will create a proof for your approval before production. Whether you're customizing our stock 1st place ribbon designs or creating completely unique awards, our design specialists ensure every detail meets your exact specifications.

What is the minimum order quantity?

Minimum order quantities vary by ribbon style, so please check individual product descriptions for specific requirements and volume discount details. Both our in-stock 1st place ribbon collection and custom awards have no minimum order requirements, making it easy to recognize individual champions or entire teams.

How quickly will my ribbons ship?

Stock items typically ship within 1-2 business days, while custom ribbons require 5-7 business days for production and shipping. Our ready-to-ship stock includes popular 1st place ribbon styles in traditional colors, perfect when you need quality awards delivered fast.

What types of awards do you offer besides 1st place ribbons?

While we specialize in premium 1st place ribbon awards, Trophy Central offers a complete range of recognition products, including trophies, medals, plaques, and certificates. Our awards are perfect for any achievement level, ensuring consistent quality across all your recognition needs.

Many items are available in stock for immediate shipping, and we can coordinate matching 1st place ribbon designs with complementary awards for a cohesive recognition program.

]]>
custom-pageaward-medals1st-plaque-i2nd-plaque-i3rd-plaque-ihonorable-plaque-iclasac1st-ei1achievement-trophies-awards"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"2-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Standout Designs & Quality Materials

Our 1st place trophies range from budget-friendly options to impressive, large cup styles that truly crown your top performers.

Personalization Options to Celebrate Winners

Every first place trophy includes our signature free engraving service, allowing you to customize each piece with names, dates, event details, or special messages. Our personalized trophies transform standard awards into meaningful keepsakes that winners will treasure for years to come.

Whether you need individual names or team achievements engraved, our precision customization ensures each first place award tells a unique story of success.

Why Choose Trophy Central for Your First Place Trophies?

Trusted by over 100,000 customers, we offer a wide range of 1st place trophy choices for sports, academics, corporate recognition, and more. You also enjoy fast shipping, usually 1-2 days, with same-day shipping also available depending on location, so your awards arrive on time.

Frequently Asked Questions

Can I order different sizes for 1st, 2nd, and 3rd place awards?

Absolutely! We offer coordinated trophy sets in graduated sizes so that 1st place trophies are larger than 2nd place, which are larger than 3rd place, creating a clear visual distinction.

Are quantity discounts available for large orders?

Yes, we offer bulk discounts, allowing you to save more on large quantities. Contact us for bulk pricing on your specific trophy needs.

]]>
photography-trophies-and-awards medals-general1st Place
custom-pageplace-trophies12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic MedallicsMedalsGeneral1:22%,25:29%,100:38%"General Recognition Awards" "Most Popular Items" "Sports Medals" "General Recognition Medals" "First Place Ribbons" "1st Place Ribbons"See Our 1st, 2nd 3rd Place Medals With A Diamond-Cut Edge. Also See Our Other High-Quality 1st, 2nd 3rd Place Awards At TrophyCentral!z98xxSee our completesection for more great choices.1st-place-medals03-02-2018General, Torch, Achievement, 1st / 2nd / 3rd / Etc.
custom-pagetrophies1trophies498551-212Trophies1:14%,10:18%,50:22%,100:25%Find this popular column trophy with 1st, 2nd or 3rd place trim, marble base and free personalization discounted at TrophyCentral. Ships in a fast 1-2 days!custom-pagetrophies-soccer12-3 business days
With engraving:
4-6 business days "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
medals105503-60.5115017Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,100,27%,500:30%2 1/2 Inch ME Series Color Medals - Soccer. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.me104gSoccer, Sports
custom-page1st-place-medals12-3 business days
With engraving:
4-6 business days "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
medals105503-60.5115020Classic MedallicsMedalsGeneral1:22%,25:24%,100,27%,500:30%"General Medals"Find these 2 1/2" Color Achievement Torch medals at TrophyCentral. Each Achievement Torch Medal includes a free neck or drape ribbon and choice of gold, silver, or bronze finish.me100g11-06-2009Academic
custom-pagetrophies-basketball12-3 business days
With engraving:
4-6 business days "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
medals105503-60.5115017JDS-SMedalsSports, Hobby, Org, Livestock1:22%,25:24%,100,27%,500:30%"Basketball Medals"2 1/2" Medal - Basketball Design with Neck Ribbon. Ideal for leagues, schools, and tournaments. Fast shipping.me102gBasketball, Sports
custom-pagetrophies-cheerleading-spirit12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.5115017Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,100,27%,500:30%"Cheer Awards" "Cheerleading Awards" "Cheerleader Awards" "Cheerleading Medals" "Cheerleader Medals"Find these 2 1/2" Color Cheerleader medals at TrophyCentral. Each Cheerleader Medal includes a free neck or drape ribbon and choice of gold, silver, or bronze finish.me110gCheerleading, Sports
custom-pagetrophies-chess12-3 business days
With engraving:
4-6 business days "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
medals105503-60.5115017Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,100,27%,500:30%"Chess Medals"Find these 2 1/2" Color Chess medals at TrophyCentral. Each Chess Medal includes a free neck or drape ribbon and choice of gold, silver, or bronze finish.me111gChess
custom-pagetrophies-golf12-3 business days
With engraving:
4-6 business days "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
medals105503-60.5115017Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,100,27%,500:30%"Golf Trophies" "Golf Medals" "Golf Awards"2 1/2" Color Medals - Golf. Ideal for leagues, schools, and tournaments. Fast shipping.me108gGolf, Sports
custom-pagetrophies-music12-3 business days
With engraving:
4-6 business days "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
medals105503-60.5115017Classic MedallicsMedalsMusic, Drama, Art, Dance1:22%,25:24%,100,27%,500:30%"Music Medals"Find these 2 1/2" Color Music medals at TrophyCentral. Each Music Medal includes a free neck or drape ribbon and choice of gold, silver, or bronze finish.me113gMusic / Band / Chorus
custom-pagetrophies-football12-3 business days
With engraving:
4-6 business days "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
medals105503-60.5115017Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,100,27%,500:30%"Football Medals"2 1/2" Medals - Football Design with Neck Ribbon. Ideal for leagues, schools, and tournaments. Fast shipping.me101gFootball, Sports
custom-pagetrophies-music12-3 business days
With engraving:
4-6 business days "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
medals105503-60.5115017Classic MedallicsMedalsMusic, Drama, Art, Dance1:22%,25:24%,100,27%,500:30%"Music Medals"Find these 2 1/2" Color Musical Note medals at TrophyCentral. Each Musical Note Medal includes a free neck or drape ribbon and choice of gold, silver, or bronze finish.me112gMusic / Band / Chorus
custom-pagetrophies-swimming-diving12-3 business days
With engraving:
4-6 business days "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
medals105503-60.37115016.87Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,100,27%,500:30%"Swimming Medals" "Swimming Awards"Find these 2 1/2" Color Swimming ME Series Medals at TrophyCentral. Each medal includes a free neck or drape ribbon and choice of gold, silver, or bronze finish.me106gSwimming / Diving, Sports
custom-pagemascot-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115016.87Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Mascot Medals"See These High-Quality 2 1/4 Inch Bears Medals And Other Mascot Awards At TrophyCentral.tm9929gMascot
custom-pagemascot-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115016.87Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Mascot Medals"See These High-Quality 2 1/4 Inch Blue Devils Medals And Other Mascot Awards At TrophyCentral.tm9950gMascot
custom-pagemascot-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115016.87Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Mascot Medals"See These High-Quality 2 1/4 Inch Blue Jays Medals And Other Mascot Awards At TrophyCentral.tm9939gMascot
custom-pagemascot-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115016.87Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Mascot Medals"See These High-Quality 2 1/4 Inch Bobcats Medals And Other Mascot Awards At TrophyCentral.tm9951gMascot
custom-pagemascot-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115016.87Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Mascot Medals"See These High-Quality 2 1/4 Inch Buffalo TM Series Medals And Other Mascot Awards Discounted At TrophyCentral.tm9919gMascot
custom-pagemascot-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115016.87Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Mascot Medals"See These High-Quality 2 1/4 Inch Bulldogs Medals And Other Mascot Awards At TrophyCentral.tm9922g06-20-2019Mascot
custom-pagemascot-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115016.87Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Mascot Medals"See These High-Quality 2 1/4 Inch Cardinals Medals And Other Mascot Awards At TrophyCentral.tm9952gMascot
custom-pagemascot-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115016.87Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Mascot Medals"See These High-Quality 2 1/4 Inch Cougars TM Series Medals And Other Mascot Awards Discounted At TrophyCentral.tm9921gMascot
custom-pagemascot-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115016.87Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Mascot Medals"See These High-Quality 2 1/4 Inch Cowboys Medals And Other Mascot Awards At TrophyCentral.tm9944gMascot
custom-pageeagle-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115016.87Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Mascot Medals"See These High-Quality 2 1/4 Inch Eagles TM Series Medals And Other Mascot Awards Discounted At TrophyCentral.tm9924gMascot
custom-pagemascot-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115016.87Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Mascot Medals"See These High-Quality 2 1/4 Inch Falcons Medals And Other Mascot Awards At TrophyCentral.tm9946gMascot
custom-pagemascot-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115016.87Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Mascot Medals"See These High-Quality 2 1/4 Inch Gators Medals And Other Mascot Awards At TrophyCentral.tm9935gMascot
custom-pagemascot-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115016.87Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Mascot Medals"See These High-Quality 2 1/4 Inch Hawks Medals And Other Mascot Awards At TrophyCentral.tm9943gMascot
custom-pagemascot-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115016.87Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Mascot Medals"See These High-Quality 2 1/4 Inch Indians Medals And Other Mascot Awards At TrophyCentral.tm9938gMascot
custom-pagemascot-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115016.87Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Mascot Medals"See These High-Quality 2 1/4 Inch Knights TM Series Medals And Other Mascot Awards Discounted At TrophyCentral.tm9934gMascot
custom-pagemascot-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115016.87Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Mascot Medals"See These High-Quality 2 1/4 Inch Lions Medals And Other Mascot Awards At TrophyCentral.tm9925gMascot
custom-pagemascot-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115016.87Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Mascot Medals"See These High-Quality 2 1/4 Inch Longhorns Medals And Other Mascot Awards At TrophyCentral.tm9941gMascot
custom-pagemascot-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115016.87Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Mascot Medals"See These High-Quality 2 1/4 Inch Mustangs TM Series Medals And Other Mascot Awards Discounted At TrophyCentral.tm9945gMascot
custom-pagemascot-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115016.87Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Mascot Medals"See These High-Quality 2 1/4 Inch Owls Medals And Other Mascot Awards At TrophyCentral.tm9948gMascot
custom-pagemascot-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115016.87Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Mascot Medals"See These High-Quality 2 1/4 Inch Panthers Medals And Other Mascot Awards At TrophyCentral.tm9926gMascot
custom-pagemascot-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115016.87Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Mascot Medals"See These High-Quality 2 1/4 Inch Pirates Medals And Other Mascot Awards At TrophyCentral.tm9927gMascot
custom-pagemascot-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115016.87Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Mascot Medals"See These High-Quality 2 1/4 Inch Rams TM Series Medals And Other Mascot Awards Discounted At TrophyCentral.tm9928gMascot
custom-pagemascot-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115016.87Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Mascot Medals"See These High-Quality 2 1/4 Inch Ravens Medals And Other Mascot Awards At TrophyCentral.tm9949gMascot
custom-pagemascot-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115016.87Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Mascot Medals"See These High-Quality 2 1/4 Inch Red Devils Medals And Other Mascot Awards At TrophyCentral.tm9947gMascot
custom-pagemascot-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115016.87Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Mascot Medals"See These High-Quality 2 1/4 Inch Tigers TM Series Medals And Other Mascot Awards Discounted At TrophyCentral.tm9923g12-20-2020Mascot
12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-515016.5award-medalsSports, Hobby, Org, Livestock1"Mascot Medals"See these colorful 2 1/4" Mascot Medals at TrophyCentral. We have a great selection of mascots, including, cougars, tigers, panthers, eagles and many more.tm-mascot-allMascot
custom-pagemascot-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115016.87Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Mascot Medals"See These High-Quality 2 1/4 Inch Tornados Medals And Other Mascot Awards At TrophyCentral.tm9735gMascot
custom-pagemascot-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115016.87Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Mascot Medals"See These High-Quality 2 1/4 Inch Trojans Medals And Other Mascot Awards At TrophyCentral.tm9730gMascot
custom-pagemascot-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115016.87Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Mascot Medals"See These High-Quality 2 1/4 Inch Vikings Medals And Other Mascot Awards At TrophyCentral.tm9742gMascot
custom-pagemascot-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115016.87Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Mascot Medals"See These High-Quality 2 1/4 Inch Wolverines Medals And Other Mascot Awards At TrophyCentral.tm9936gMascot
custom-pagemascot-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115016.87Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Mascot Medals"See These High-Quality 2 1/4 Inch Wolves Medals And Other Mascot Awards At TrophyCentral.tm9940gMascot
custom-pagetrophies-dance12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Dance Awards" "Dance Medals"Your athletes will love these colorful Mylar Dance Medals from TrophyCentral. Each Dance medal includes a neck ribbon!tm9975g07-01-2018Dance
custom-pagetrophies-basketball12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Basketball Awards" "Basketball Medals"Color Medal (2 3/16 Inch) - Basketball. Ideal for leagues, schools, and tournaments. Fast shipping.tm9970g04-01-2019Basketball, Sports
custom-pagetrophies-lacrosse12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Lacrosse Awards" "Lacrosse Medals"Your athletes will love these colorful Mylar Lacrosse Medals from TrophyCentral. Each Lacrosse medal includes a neck ribbon!tm9984gLacrosse, Sports
noindexed-items12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105503-6150211Your athletes will love these colorful Mylar 2 3/16" Color Medals - Sports Subjects Medals from TrophyCentral. Each 2 3/16" medal includes a neck ribbon!1tm-sports-medals
custom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.371 2 3 4 5 6 7 8 9115021.37Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%Your athletes will love these colorful Mylar Triathlon Medals from TrophyCentral. Each Triathlon medal includes a neck ribbon!tm9993g
custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality 2 Inch Air Force Material Command Inserts at TrophyCentral. Each 2 Inch Air Force Material Command Insert can be used to create a unique plaque, medal or trophy.518141Military, Hero, Air Force
custom-pagetrophies-baseball12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:29%,100:38%"Baseball Awards" "Baseball Medals"2 Inch Diamond Cut Edge Baseball Batter and Catcher Medal with Ribbon. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.z9411Baseball / T-Ball, Sports
custom-pagetrophies-baseball12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:29%,100:38%"Baseball Medals"2 Inch Diamond Cut Edge Baseball Medal with Ribbon. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.z9011Baseball / T-Ball, Sports
custom-pagetrophies-soccer12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:29%,100:38%"Soccer Awards" "Soccer Medals"2 Inch Diamond Cut Edge Boys Soccer Medal with Ribbon. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.z9022Soccer, Sports
custom-pagetrophies-gymnastics12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:29%,100:38%"Gymnastics Awards" "Gymnastics Medals"See Our Gymnastics (Female) Medals With A Diamond-Cut Edge. Also See Our Other High-Quality Gymnastics (Female) Awards At TrophyCentral!z903005-21-2006Gymnastics, Sports
custom-pagetrophies-soccer12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:29%,100:38%"Soccer Awards" "Soccer Medals"2 Inch Diamond Cut Edge Girls Soccer Player Medal with Ribbon. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.z9021Soccer, Sports
custom-pagetrophies-baseball11"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)""PT1=Medals" "PC12=498852-30.3716021.6Quick TrophyMedalsSports, Hobby, Org, Livestock1:14%,10:25%,100:36%"Baseball Awards" "Award Medals - All Subjects" "Sports Medals" "Baseball Medals" "Baseball Trophies and Medals" "Baseball Medals and Trophies"2 Inch Fast Shipping Medal with Baseball Design. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.1qushbameBaseball / T-Ball, Sportscustom-pagetrophies-baseball12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
trophies105503-60.37115021.37Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,50:28%,100:34%,500:41%"Baseball Trophies and Medals" "Baseball Medals and Trophies" "Baseball Awards" "Award Medals - All Subjects" "Sports Medals" "Baseball Medals"Baseball: 2 Inch Olympic-Style J-Series Medal. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.j9011Baseball / T-Ball, Sports
custom-pagetrophies-cheerleading-spirit11"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"medals498852-30.3716021.6Quick TrophyMedalsSports, Hobby, Org, Livestock1:14%,10:25%,100:36%"Cheerleading Medals" "Cheer Awards" "Cheerleading Awards" "Cheerleader Awards" "Award Medals - All Subjects" "Sports Medals"Find these 2" Cheerleading Antique Series Medals Discounted Online at TrophyCentral. Includes Ribbon and Ships in Just 1-2 Days!quchmeCheerleading, Sportscustom-pagemedals-diamond-cut-edge12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic MedallicsMedalsGeneral1:22%,25:29%,100:38%"General Medals"See Our Achievement Medals With A Diamond-Cut Edge. Also See Our Other High-Quality Achievement Awards At TrophyCentral!z9128General, Academic
custom-pagemedals-diamond-cut-edge12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
"PT1=Medals" "PC12=105503-60.3715021.37Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:29%,100:38%"Basketball Medals" "Basketball Awards"2" Diamond Cut Edge Medal with Ribbon - Basketball. Ideal for leagues, schools, and tournaments. Fast shipping.z9396Basketball, Sports
custom-pagemedals-diamond-cut-edge12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:29%,100:38%See Our Culinary Arts / Cooking Medals With A Diamond-Cut Edge. Also See Our Other High-Quality Culinary Arts / Cooking Awards At TrophyCentral!z913507-31-2021Cooking / Culinary
custom-pagemedals-diamond-cut-edge12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic MedallicsMedalsGeneral1:22%,25:29%,100:38%"General Medals"See Our Handshake Medals With A Diamond-Cut Edge. Also See Our Other High-Quality Handshake Awards At TrophyCentral!z915212-20-2040General, Academic
custom-pagemedals-diamond-cut-edge12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic MedallicsMedalsGeneral1:22%,25:29%,100:38%"General Medals"See Our In Honor of Excellence Medals With A Diamond-Cut Edge. Also See Our Other High-Quality In Honor of Excellence Awards At TrophyCentral!z916307-22-2016General, Academic (General)
custom-pagereadingawards12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic MedallicsMedalsAcademic1:22%,25:29%,100:38%"School Awards" "Reading Medals" "School Award Medals"See Our Reading Medals With A Diamond-Cut Edge. Also See Our Other High-Quality Reading Awards At TrophyCentral!z9078Reading
custom-pagemedals-diamond-cut-edge12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic MedallicsMedalsAcademic1:22%,25:29%,100:38%"School Awards" School Award Medals"Find This General Science Medal With A Diamond-Cut Edge Discounted at TrophyCentral. Also See Our Other High-Quality Science Awards!z900506-20-2019Science
custom-pagemedals-diamond-cut-edge12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic MedallicsMedalsAcademic1:22%,25:29%,100:38%"School Awards" "School Award Medals"Find Our Science Medals With A Diamond-Cut Edge, And Other High-Quality Science Awards, Discounted At TrophyCentral!z9901Science
custom-pagemedals-diamond-cut-edge12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic MedallicsMedalsGeneral1:22%,25:29%,100:38%"General Medals"Find World Class Performance Medals With A Diamond-Cut Edge Discounted at TrophyCentral. Price Includes a Neck or Drape Ribbon!z985807-22-2016General, Business
z9003z9005z9007z9011z9014z9018z9021z9022z9030z9031z9038z9039z9046z9049z9078z9128z9135z9141z9152z9163z9231z9396z9411z9858z98xxz990111Shop for these high-quality diamond cut edge medals at TrophyCentral. Each diamond cut medal includes a neck ribbon.1High-Quality Medals The medals above are our highest quality award medals. Each medal features a diamond cut edge and includes your choice of medal ribbon, either a neck or military style drape ribbon. Options include a medal display box and engraving on the back of the medal.]]>12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-515021Medals1High-quality medals with a diamond-cut edge, neck ribbon and optional engraving on medal back.1z-medals-all
custom-pagetrophies-music12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic MedallicsMedalsMusic, Drama, Art, Dance1:22%,25:29%,100:38%"Music Awards" "School Awards" "Music Trophies" "Music Medals"See Our Music Medals With A Diamond-Cut Edge. Also See Our Other High-Quality Music Awards At TrophyCentral!z9007Music / Band / Chorus
custom-pagestar-trophies1star-medals2-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic MedallicsMedalsGeneral1:22%,25:29%,100:38%"Dance Medals" "Star Award" "Music Awards" "General Recognition Awards" "Drama Awards" "Art Awards" "Star Awards" "General Medals"See Our Star Performer Medals With A Diamond-Cut Edge. Also See Our Other High-Quality Star Performer Awards At TrophyCentral!z923106-01-2014General, Drama, Star
custom-pagetrophies-swimming-diving12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:29%,100:38%"Swimming Awards" "Swimming Medals"See Our Swimming Medals With A Diamond-Cut Edge. Also See Our Other High-Quality Swimming Awards At TrophyCentral!z903803-08-2010Swimming / Diving, Sports
custom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:29%,100:38%"Track Awards" "Track Medals"See Our Track Medals With A Diamond-Cut Edge. Also See Our Other High-Quality Track Awards At TrophyCentral!z9039
custom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:29%,100:38%"Track Awards" "Track Medals"See Our Track (Female) Medals With A Diamond-Cut Edge. Also See Our Other High-Quality Track (Female) Awards At TrophyCentral!z9046
custom-pagetrophies-softball12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:29%,100:38%"Softball Awards" "Softball Medals"See Our Softball Medals With A Diamond-Cut Edge. Also See Our Other High-Quality Softball Awards At TrophyCentral!z9014Softball, Sports
12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-3130025Inserts1Buy these high-quality 2" etched inserts at TrophyCentral. Each 2" etched insert can be used to create a unique plaque, medal or trophy.1etched-inserts-all
custom-pagetrophies-basketball11"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"medals498852-30.3716021.6Quick TrophyMedalsSports, Hobby, Org, Livestock1:14%,10:25%,100:36%"Basketball Awards" "Award Medals - All Subjects" "Sports Medals" "Basketball Medals"Basketball - Fast Ship 2" Medal. Ideal for leagues, schools, and tournaments. Fast shipping.qushbame1Basketball, Sportscustom-pagetrophies-softball11"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"medals498852-30.3716021.6Quick TrophyMedalsSports, Hobby, Org, Livestock1:14%,10:25%,100:36%"Softball Awards" "Most Popular Items" "Award Medals - All Subjects" "Sports Medals"Find these 2 inch quick-ship Softball medals discounted online at TrophyCentral. Medals include ribbon and ship fast - just 1-2 days!softballmedalsSoftball, Sportscustom-pagetrophies-golf11"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)""PT1=Medals" "PC12=498852-30.3716021.6Quick TrophyMedalsSports, Hobby, Org, Livestock1:14%,10:25%,100:36%"Golf Awards" "Award Medals - All Subjects" "Sports Medals" "Golf Medals" "Golf Trophies"2" Fast Shipping Medals with Golf Design. Ideal for leagues, schools, and tournaments. Fast shipping.golfmedals1Golf, Sports11Medal, Trophy and Plaque Inserts in a Variety of Sports, Academic, General and Business Subjects. Each insert is 2" in diameter.111Find these 2" J-Series Medals in Gold, Silver and Bronze Finishes Discounted at TrophyCentral. Price Includes Neck Ribbon! Fast 1-2 Day Shipping!1

Shop with Confidence at TrophyCentral

We offer a huge selection, discounted prices and top-rated customer service. Do you need help with some ideas or with ordering? Yes, we sell online, but we have real people who would love to help you! Feel free to call our customer service experts in Michigan, New York and online. TrophyCentral - delivering smiles since 1999!


]]>
12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-3130025Inserts1Buy these quality 2" Inserts (Litho) at TrophyCentral. Each 2" Insert can be used to create a unique plaque, medal or trophy.1litho-inserts-all
12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-33003Inserts1Buy these quality 2" Mascot Inserts at TrophyCentral. Each 2" Mascot Insert can be used to create a unique plaque, medal or trophy.mascot-inserts-allMascot
custom-pagetrophies-music11"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)""PT1=Medals" "PC11=498852-30.3716021.6Quick TrophyMedalsSports, Hobby, Org, Livestock1:14%,10:25%,100:36%"Music Awards" "Award Medals - All Subjects" "Music Medals" "Music Trophies"Find these 2 inch quick-ship Music medals discounted online at TrophyCentral. Medals include ribbon and ship fast - just 1-2 days!Music / Band / Chorus12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-33003Inserts1mylar-decals-all
custom-page1st-place-medals1j96722-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130042.75Classic MedallicsMedalsGeneral1:22%,50:28%,100:34%,500:41%"General Recognition Awards" "Award Medals - All Subjects" "Sports Medals" "General Medals" "Sports Medals"Find our 2" Olympic-style torch medals at a super price point at TrophyCentral. Each Olympic-style medal includes a neck ribbons.j966504-01-2019General, Torch, Achievement, 1st / 2nd / 3rd / Etc.
custom-pagetrophies-basketball12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,50:28%,100:34%,500:41%Basketball MedalsBasketball Medalsj9531Basketball, Sports
custom-pagetrophies-softball12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,50:28%,100:34%,500:41%"Softball Awards" "Award Medals - All Subjects" "Sports Medals" "Softball Medals"Find our Softball 2" Olympic-Style J-Series Medals at a super price point at TrophyCentral. Large quantity discounts available!Softball MedalsSoftball Medalsj979010-10-2010Softball, Sports
custom-pagetrophies-wrestling12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,50:28%,100:34%,500:41%"Award Medals - All Subjects" "Sports Medals" "Wrestling Medals"Find our Wrestling 2" Olympic-Style J-Series Medals at a super price point at TrophyCentral. Large quantity discounts available!j96322-28-2019Wrestling, Sports
custom-pagetrophies-tennis11"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"medals498852-30.3716021.6Quick TrophyMedalsSports, Hobby, Org, Livestock1:14%,10:25%,100:36%"Tennis Awards" "Award Medals - All Subjects" "Sports Medals" "Tennis Medals"Find this 2" quick-ship antique gold tennis medal discounted online at TrophyCentral. Features a free neck ribbon. Tennis, Sportsnoindexed-items11Shop for colorful TM Series Sports and School Medals at TrophyCentral. Each TM Medal includes a neck ribbon!1custom-pagefirst-place-ribbons25"1-2 business days" "Topeka, Indiana" "UPS (Post Office Priority Mail may also be available)"ribbons465711-31 260.36250025.36Tower RibbonRibbonsStock Ribbons1:22%,100:32%,500:46%2" x 6" Standard Ribbons (pinked) and Medals at TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.2dsx1st / 2nd / 3rd / Etc., Blue Ribboncustom-pagefirst-place-ribbons1award-ribbons-printed"1-2 business days" "Topeka, Indiana" "UPS (Priority Mail also available)"465711-31 26110020.36Tower RibbonRibbonsStock Ribbons1:22%,40:47%2dgsx1st / 2nd / 3rd / Etc., Sportscustom-pagefirst-place-ribbons25award-ribbons-printed"1-2 business days" "Topeka, Indiana" "UPS (Post Office Priority Mail may also be available)"465711-31 261250025.36Tower RibbonRibbonsStock Ribbons1:22%,100:27%,500:33%Find these popular Pinked Top Sublimated Printed Ribbons at TrophyCentral. Titles include 1st through 3rd place and participant.s2cx1st / 2nd / 3rd / Etc., Participantcustom-pagefirst-place-ribbons25"1-2 business days" "Topeka, Indiana" "UPS (Post Office Priority Mail may also be available)"465711-31 260.36250025.36Tower RibbonRibbonsStock Ribbons1:22%,100:28%,500:38%2" x 8" Celebration Line Place Ribbon Awards (pinked top). Ribbon titles include 1st, 2nd, 3rd place and participant.9csx1st / 2nd / 3rd / Etc., Participantcustom-pagefirst-place-ribbons1"1-2 business days" "Topeka, Indiana" "UPS (Post Office Priority Mail may also be available)"465711-31 260.3610020.36Tower RibbonRibbonsStock Ribbons1:22%,40:45%s2bx1st / 2nd / 3rd / Etc., Participant, Blue Ribboncustom-pagefirst-place-ribbons1"1-2 business days" "Topeka, Indiana" "UPS (Priority Mail also available)"ribbons465711-31 260.3610020.36Tower RibbonRibbonsStock Ribbons1:22%,40:38%Find this 2" x 8" Printed Ribbon Pack at TrophyCentral. Titles include 1st through 3rd place and participant.4bsx1st / 2nd / 3rd / Etc., Participantcustom-pagefirst-place-ribbons25"1-2 business days" "Topeka, Indiana" "UPS (Post Office Priority Mail may also be available)"ribbons465711-31 260.36250025.36Tower RibbonRibbonsStock Ribbons1:22%,100:28%,500:38%Find this Crown Jewel Line Pinked Ribbon Discounted at TrophyCentral. Titles include 1st through 3rd place and participant. Fast Shipping!4csx1st / 2nd / 3rd / Etc., Participantcustom-pageaward-ribbons-printed25"1-2 business days" "Topeka, Indiana" "UPS (Post Office Priority Mail may also be available)"465711-31 261250025.36Tower RibbonRibbonsStock Ribbons1:22%,100:27%,500:33%Full Color Printed Ribbons (pinked) and Medals at TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.rsubxx1st / 2nd / 3rd / Etc., Participant Award, Honorable Mention, Star Student, Im a Winner, Award of Excellence, Leadership Award, Super Star,#1, Great, Special Achievement, Grand Champion, Great Performance, Life, Excellent, Wow, Terrific, Very Special Person, Congratulations, Im Special, The Lord is my Shepherd, Super, Great Job, Spirit Award, Jesus Rockscustom-pageaward-ribbons-printed25"1-2 business days" "Topeka, Indiana" "UPS (Post Office Priority Mail may also be available)"ribbons465711-31 26110020.36Tower RibbonRibbonsStock Ribbons1:22%,40:45%rsubxxc1st / 2nd / 3rd / Etc., Participant Award, Honorable Mention, Star Student, Im a Winner, Award of Excellence, Leadership Award, Super Star,#1, Great, Special Achievement, Grand Champion, Great Performance, Life, Excellent, Wow, Terrific, Very Special Person, Congratulations, Im Special, The Lord is my Shepherd, Super, Great Job, Spirit Award, Jesus Rockscustom-pagefirst-place-ribbons1award-ribbons-printed"1-2 business days" "Topeka, Indiana" "UPS (Priority Mail also available)"465711-21 261Tower RibbonRibbons1:22%,250:31%,500:42%Find this flat ribbon discounted at TrophyCentral. Available in a huge number titles, including 1st-4th place in Spanish.pinked ribbons, printed ribbons, award ribbons, pinked ribbons, printed ribbons, ribbons and rosettes, pinked award ribbonBlue Ribbon, Red Ribbon, Exhibitor, 1st / 2nd / 3rd / Etc., 4th Place, 5th Place, 6th Place, 7th Place, 8th Place, 9th Place, 10th Place, Honorable Mention, Participant, Achievement, Assistant, Chairman, Board Member, Best of Show, Chairperson, Co-Chairman, Co-Chairperson, Committee, Contestant, Director, Excellent, Exhibitor, Facilitator, Finalist, Grand Price, Good, Grand Champion, Hostess, Hospitality, Guest, Speaker, Host, Judge, Participation, Past President, Perfect Attendance, Official, Presenter, President, Press, Reserve Champion, Secretary, Treasurer, Staff, Steward, Sponsor, Usher, Vice President, Visitor, Volunteer, Winner, Meritcustom-pagefirst-place-ribbons11"1-2 business days" "Topeka, Indiana" "UPS (Priority Mail also available)"ribbons465711-21 26120030.36Tower RibbonRibbons1:22%,40:45%Blue Ribbon, Red Ribbon, Exhibitor, 1st / 2nd / 3rd / Etc., 4th Place, 5th Place, 6th Place, 7th Place, 8th Place, 9th Place, 10th Place, Honorable Mention, Participant, Achievement, Assistant, Chairman, Board Member, Best of Show, Chairperson, Co-Chairman, Co-Chairperson, Committee, Contestant, Director, Excellent, Exhibitor, Facilitator, Finalist, Grand Price, Good, Grand Champion, Hostess, Hospitality, Guest, Speaker, Host, Judge, Participation, Past President, Perfect Attendance, Official, Presenter, President, Press, Reserve Champion, Secretary, Treasurer, Staff, Steward, Sponsor, Usher, Vice President, Visitor, Volunteer, Winner, Meritcustom-pageservicepins1plastic-pinbox-t1lapel pins498551-20.525040.5TrophyCentralLapel Pins11:22%,25:24%,100,27%,500:30%Find this 20-year service anniversary lapel pins discounted at TrophyCentral. Features a clutch-pin back for easy attachment to clothing.. Fast 1-2 day shipping.20-year-pbcustom-pageribbons1-tiaras1"1-3 business days" "Topeka, Indiana" "UPS (Post Office Priority Mail also available)"465711-21 260.73629.5Tower RibbonSpiritScepters1:22%Find Scepters and Pageant / Homecoming Scepters at TrophyCentral.rtsp409212-20-2040acpin10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)""PT1=Medals" "PC11=105502-30.36100021Classic Medallics1:22%,100:28%Find this 2020 Year Guard discounted at TrophyCentral. Your 2020 graduating class will wear this pin with pride!custom-pagescholarship-award1111custom-pagetrophies1trophies498551-212Trophies1:14%,10:18%,50:22%,100:25%Find this popular year trim trophy, marble base and free personalization discounted at TrophyCentral. Ships in a fast 1-2 days!custom-pageservicepins1plastic-pinbox-t1lapel pins498551-20.525040.5TrophyCentralLapel Pins11:22%,25:24%,100,27%,500:30%Find this 25-year service anniversary lapel pins discounted at TrophyCentral. Features a clutch-pin back for easy attachment to clothing.. Fast 1-2 day shipping.25-year-pbcustom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality 25th Infantry Division Inserts at TrophyCentral. Each 25th Infantry Division Insert can be used to create a unique plaque, medal or trophy.515148Military, Hero, Army
custom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceSealsEmbosser Seals1:22%,3:28%,5:31%Find these 2nd Nine Weeks Certificate Seals discounted at TrophyCentral. Features Pressure-Sensitive Backing for Easy Sealing.8032nwcustom-pagemedallion-inserts-general-medallion-inserts1498552-40.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful 2nd Place 2" Epoxy-covered insert decal discounted at TrophyCentral. Fast 1-2 day shipping.1st / 2nd / 3rd / Etc., Sportscustom-pageplace-trophies1medals498552-30.525033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Antique Gold 2nd Place Medals Discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.1st / 2nd / 3rd / Etc., Sportscustom-pageplace-trophies1trophies498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a 2nd Place insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-2nd-Insert1st / 2nd / 3rd / Etc., Sportscustom-pageplace-trophies1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our 2nd single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - 2nd1st / 2nd / 3rd / Etc., Sportscustom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceSealsEmbosser Seals1:22%,3:28%,5:31%Find these 2nd Ribbon Certificate Seals discounted at TrophyCentral.8032ndcustom-pageplace-trophies1medals498552-30.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this Colorful 2nd Place insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.1st / 2nd / 3rd / Etc., Sportscustom-pageplace-trophies1medals498552-40.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this 2nd Place insert medal With A Personalized Front Rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.1st / 2nd / 3rd / Etc., Sportscustom-pageplace-trophies1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these 2nd Place insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.1st / 2nd / 3rd / Etc., Sportscustom-pageplaques1"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498852-310.45811.6Quick TrophyPlaquesInsert1:14%,3:14%Find This 2nd Place Plaque With a Colorful 2" Emblem and a Cherry Finish Discounted At TrophyCentral. Price Includes Engraving! Fast 1-2 Day Shipping!qsinplaq2ndSports, Academic, General, Torch, Achievement, 1st / 2nd / 3rd / Etc.custom-pagemotivational-stickers1"1 - 2 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-21 2 3 230.451224.45Certificate SourceStickersStickers1:22%,3:24%Find these popular 2nd Place motivational stickers discounted online at TrophyCentral. Fast 1-2 day shipping!bstick9Sports, Academic, General, Torch, Achievement, 1st / 2nd / 3rd / Etc.custom-pageplace-trophies1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our 2nd insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - 2nd1st / 2nd / 3rd / Etc., Sportscustom-pageplace-trophies1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these 2nd Place Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.1st / 2nd / 3rd / Etc., Sportscustom-pageacrylicawards11"1-2 business days" "Marquette, MI" "UPS"general498852-310.4544.05Quick TrophyCrystal Awards1:14%"New Products"Find these popular 3" x 5" Mirage Acrylic Awards discounted at TrophyCentral. Price includes free engraving.Blank, Generalcustom-pagemedallion-inserts-fraternal-organizational-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "Clubs, Organizations, Charities"Buy these high-quality 32 Degree Masonic Inserts at TrophyCentral. Each 32 Degree Masonic Insert can be used to create a unique plaque, medal or trophy.517454
custom-pagetrophies-marksman-shooting-rifle12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-31130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Shooting Medals"Buy these quality 38 Caliber Revolver Inserts (Litho) at TrophyCentral. Each 38 Caliber Revolver Insert can be used to create a unique plaque, medal or trophy.501261
1"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"498552-316021.6award-medals1These 3D medals are a kid's favorite! Best of all, they feature a great low price and fast 1-2 day shipping!13d-medals-allcustom-pageglass-crystal-awards1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"plaques410187-1010.45417.65JcharlesPlaquesEngraved Plaques1:22%,6:23%,25:24%Find these fabulous 3D Plaques discounted at TrophyCentral. TrophyCentral is known for its top-rated customer servicecustom-pageplaques1qsinplaqsoccer wood-soccer-plaque-and-figure"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498852-310.45811.6Quick TrophyPlaquesInsert1:14%,3:14%"Soccer Awards"Soccer 3-D Plaque. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.qsinplaq3dsoccerSoccer, Coach, Sportscustom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceSealsEmbosser Seals1:22%,3:28%,5:31%Find these 3rd Nine Weeks Certificate Seals discounted at TrophyCentral. Features Pressure-Sensitive Backing for Easy Sealing.8033nwcustom-pagemedallion-inserts-general-medallion-inserts20498552-40.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful 3rd Place 2" Epoxy-covered insert decal discounted at TrophyCentral. Fast 1-2 day shipping.1st / 2nd / 3rd / Etc., Sportscustom-pageplace-trophies1medals498552-30.525033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Antique Gold 3rd Place Medals Discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.1st / 2nd / 3rd / Etc., Sportscustom-pageplace-trophies1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these 3rd Place Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.1st / 2nd / 3rd / Etc., Sportscustom-pageplace-trophies1trophies498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a 3rd Place insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-3rd-Insert1st / 2nd / 3rd / Etc., Sportscustom-pageplace-trophies1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our 3rd single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - 3rd1st / 2nd / 3rd / Etc., Sportscustom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceSealsEmbosser Seals1:22%,3:28%,5:31%Find these 3rd Ribbon Embossed Certificate Seals discounted at TrophyCentral.8033rdcustom-pageplace-trophies1medals498552-30.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this Colorful 3rd Place insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.1st / 2nd / 3rd / Etc., Sportscustom-pageplace-trophies1medals498552-40.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this 3rd Place insert medal With A Personalized Front Rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.1st / 2nd / 3rd / Etc., Sportscustom-pageplace-trophies1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these 3rd Place insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.1st / 2nd / 3rd / Etc., Sportscustom-pageplaques1"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498852-310.45811.6Quick TrophyPlaquesInsert1:14%,3:14%Find This 3rd Place Plaque With a Colorful 2" Torch Emblem and a Cherry Finish Discounted At TrophyCentral. Price Includes Engraving! Fast 1-2 Day Shipping!qsinplaq3rdSports, Academic, General, Torch, Achievement, 1st / 2nd / 3rd / Etc.custom-pagemotivational-stickers1"1 - 2 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-21 2 3 230.451224.45Certificate SourceStickersStickers1:22%,3:24%Find these popular 3rd Place motivational stickers discounted online at TrophyCentral. Fast 1-2 day shipping!bstick10Sports, Academic, General, Torch, Achievement, 1st / 2nd / 3rd / Etc.custom-pageplace-trophies1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our 3rd insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - 3rd1st / 2nd / 3rd / Etc., Sportscustom-pagemedallion-inserts-fraternal-organizational-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-31130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "Clubs, Organizations, Charities"Buy these quality 4 H Club Inserts (Litho) at TrophyCentral. Each 4 H Club Insert can be used to create a unique plaque, medal or trophy.493181
custom-page11flplw flexiplates1 desblocnampl"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"498552-310.35100021TrophyCentralNameplates1:14%,100:35%4 Inch Flexi-Brass Replacement Name Plates w/Engraving at TrophyCentral. Price of Replacement Plates Includes Engraving!flexiplates2custom-pageglass-crystal-awards6"7-10 business days" "Kentucky" "UPS (FedEx available on request)"personalized gifts410187-1010.45520.45JcharlesGiftsCrystal Gifts1:22%,100:23%"personalized gifts"Find Quality 4 x 6 Mainliner Photo Frames Awards at TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.Crystal Giftscustom-pageplaques1"4-6 business days " "Mount Vernon, NY" "UPS"plaques105503-610.4511213.65Classic MedallicsPlaquesInsert1:22%"Baseball Awards"4" Cast Stone Subject Plaque - 6" x 8" .ps586410-25-2018custom-pageplaques1"4-6 business days " "Mount Vernon, NY" "UPS"plaques105503-610.4512016.85Classic MedallicsPlaquesInsert1:22%"Music Awards"Find this 8" x 10" cast-stone insert plaque. Choose from hundreds of subject inserts (discs)!ps5866custom-pageacrylicawards11"1-2 business days" "Marquette, MI" "UPS"general498852-310.451010.45Quick TrophyCrystal Awards1:14%"New Products"Find these 4" x 6" Mirage Acrylic Awards Discounted at TrophyCentral. Free Engraving! Feature 1" hick with reflective gold base. Price includes engraving.mirage4x6acrylicLeadershipcustom-pagecustomlapel1250"4 - 6 Weeks" "Mt. Vernon, N.Y." "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins1055028-4210.461150030.46Classic MedallicsLapel PinsGeneral1:30%,5000:48%Shop for 4-Color Process Photo Pins at TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant With Excellent Customer Service.custom-pagehonorrollpinsplastic-pinbox-t5498551-30.550040.5TrophyCentralLapel Pins11:22%,25:24%,100,27%,500:30%Find our 3D Series gold honor student 4.0 pin discounted at TrophyCentral. Fast 1-2 day shipping.Honor Roll, Academiccustom-pagehonorrollpinsplastic-pinbox-t10lapel pins498551-30.5200040.5TrophyCentralLapel Pins11:22%,25:24%,100,27%,500:30%Find this 4.0 Gold Enamel lapel pin discounted at TrophyCentral. Features a clutch-pin back for easy attachment to clothing.. Fast 1-2 day shipping.Honor Roll, Academiccustom-pagehonorrollpinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:30%,50:32%,100:35%,500:39%"Honor Roll" "Honor Roll Pins" "Honor Roll Trophies" "School Pins"Find 4.0 pins discounted at TrophyCentral. Each 4.0 lapel pin features a quality clutch back. Perfect for recognizing your students with a perfect average.br353Honor Roll, Academic11Fresh recognition titles for every personality type — from the Quiet Excellence Award to the Bridge Builder. For managers tired of the same five categories.custom-pagetrophy-award-guides11Transform boring trophies into comedy gold! Discover 40+ hilarious inscription ideas for sports, corporate, academic awards and more. Funny engraving ideas that create unforgettable memories.custom-pagemedallion-inserts-general-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these quality 45 Caliber Automatic Pistol Inserts (Litho) at TrophyCentral. Each 45 Caliber Automatic Pistol Insert can be used to create a unique plaque, medal or trophy.501281
custom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceSealsEmbosser Seals1:22%,3:28%,5:31%Find these 4th Nine Weeks Certificate Seals discounted at TrophyCentral.8034nwcustom-pagemedallion-inserts-general-medallion-inserts1498551-30.5100021TrophyCentralInsertsSports, Hobby, Org, Livestock1Find this colorful 4th Place 2" epoxy-covered insert sticker discounted at TrophyCentral. Fast 1-2 day shipping.1st / 2nd / 3rd / Etc., Sportscustom-pageplace-trophies1trophies498551-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a 4th Place insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.1st / 2nd / 3rd / Etc., Sportscustom-pageplace-trophies1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our 4th Place single column insert trophy features a choice of column color, a marble base and free trophy engraving.1st / 2nd / 3rd / Etc., Sportscustom-pageplace-trophies1medals498551-30.525035.5TrophyCentralMedalsSports, Hobby, Org, Livestock1Find this colorful 4th Place insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.1st / 2nd / 3rd / Etc., Sportscustom-pageplace-trophies1medals498551-30.525035.5TrophyCentralMedalsSports, Hobby, Org, Livestock1Find this 4th Place insert medal with a personalized front rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.1st / 2nd / 3rd / Etc., Sportscustom-pageplaques1plaques498551-311.1Plaques1Find these 4th place insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.1st / 2nd / 3rd / Etc., Sportscustom-pageplace-trophies1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our 4th Place insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.1st / 2nd / 3rd / Etc., Sportscustom-pageplace-trophies1medals498551-31.520033TrophyCentralMedalsSports, Hobby, Org, Livestock1Find these 4th Place epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.1st / 2nd / 3rd / Etc., Sportscustom-pageribbons111"1-3 business days" "Topeka, Indiana" "UPS (FedEx available on request)"4657114-211 260.3650030.36Tower RibbonRibbons1:22%,5:22%"Quick-Ship Items"Pack of 10 5 1/2" rosette contestant numbers with your choice of color and sequence. Perfect for races and similar events with multiple contestants. Fast 1-2 day shipping.trophy-and-award-buying-lists11Explore five fun music lapel pins that are perfect for recognizing musical talent. Discover affordable and unique pins from TrophyCentral.musicartpins1custom-pageservicepins1plastic-pinbox-t1lapel pins498551-20.525040.5TrophyCentralLapel Pins11:22%,25:24%,100,27%,500:30%Find this 5-year service anniversary lapel pins discounted at TrophyCentral. Features a clutch-pin back for easy attachment to clothing.. Fast 1-2 day shipping.5-year-pbcustom-pageribbons11opsafpin1"1-3 business days" "Topeka, Indiana" "UPS (FedEx available on request)"465711-31 261526Tower RibbonRibbons1:22%,5:23%"Quick-Ship Items"Pack of 100 5" x 7" white contestant numbers with your choice of sequence (ex. 101-200). Perfect for races and similar events with multiple contestants. Fast 1-2 day shipping.custom-pagephotoplaques11plaques105503-610.4511638.85Plaques1:30%Shop for Photo Plaques and Awards from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.photo plaque, photo award plaque, photo plaques, picture plaquescustom-pageplaques11plaques105503-610.4511818.45Classic MedallicsInsert Award1:14%,10:32%"Meeting or Exceeding Goals"custom-pagetrophies-car-truck1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:24%Fabulous 57 Chevy Place Trophy with 1st, 2nd or 3rd Place Trim, Marble Base and Free personalization. Ships in a fast 1-2 days!qtchevyplcustom-pagetrophies-car-truck1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:24%Find these popular '57 Chevy year trim trophies discounted at TrophyCentral. Available in multiple sizes and includes free personalization. Features gold year of event trim.qtchevyyrcustom-pagetrophies-car-truck1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with 57 chevy figure discounted at TrophyCentral. Includes free text engraving!cup-chevy-pcustom-pagetrophies-car-truck1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these 57 chevy budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtchevyscbcustom-pagetrophies-car-truck1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:26%Find these fabulous two-tier Chevy (57) Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtchevyttcustom-pagetrophies-car-truck1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.751434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:28%See this championship trophy with a Chevy (57) figure at TrophyCentral. Be sure to see all of our Chevy (57) figure awards.qtchevyttwcustom-pagetrophies-car-truck1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:21%,100:24%This popular 57 Chevy Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtchevysccustom-pagetrophies-car-truck1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.05Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%These quick-ship trophies from TrophyCentral feature a Chevy (57) figure, real marble base and marble trophy figure platform, choice of column size and color.qtchevydmcustom-pagetrophies-car-truck1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with 57 Chevy figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-chevy-scbcustom-pagetrophies-car-truck1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.41226Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:18%,10:23%Find these fabulous two-tier, 3-column champion Chevy (57) Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtchevy3ccustom-pagetrophies-car-truck1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:27%,100:32%Our popular Car Show, 57 Chevy participation trophies feature a real slant-front marble base and free engraving.qtchevynccustom-pageplaques11plaques105503-610.4511827.45Classic MedallicsInsert Award1:22%,10:25%"Volunteer Items"Walnut plaques with medallion insert and engraving. TrophyCentral is a Top-Rated Yahoo Merchant.walnut plaque, plaques, award plaques, walnut plaques, engraved plaquescustom-pageglass-crystal-awards12"7-10 business days" "Kentucky" "UPS (FedEx available on request)"personalized gifts410187-1010.451515.45JcharlesGiftsCrystal Gifts1:22%,100:21%"personalized gifts"Shop our eye-catching optic crystal 6" ruler. Our customer design will dress up any desk! Personalize with text or logo. Shop our discounted prices today!Crystal Giftscustom-pageglass-crystal-awards1"1-2 business days" "Marquette, MI" "UPS"general498852-310.451236Quick TrophyCrystal Awards1:14%"New Products"Find this 6" x 8" Marble Glass Fusion Award discounted at TrophyCentral. Browse our fabulous selection of crystal and glass awards now!Generalcustom-pagecertificate-diploma-covers110"1-3 business days wo/imprinting, 8-14 days w/imprinting" "Columbia, South Carolina" "UPS (FedEx available on request)""PT1=290631-30.455042.95Certificate SourceDiploma Covers1:14%,10:19%,50:28%,100:35%"Diploma Covers" "Padded Diploma Covers" "Diploma Holders" "School Diploma Covers" "Award Certificates and Diploma Covers" "Award Certificates and Diploma Holders" "Award Certificates and Diploma Frames" "Award Certificate and Diploma Holders" "Certificate and Diploma Holders" "Certificates and Frames" "Certificates and Diploma Holders" "Diploma Covers and Certificates" "Diploma Covers and Award Certificates" "Diploma Covers, Frames and Holders" "Diploma Covers, Frames, Holders and Certificates"Our padded diploma covers feature a lined interior with satin ribbon corners to safely hold diplomas and certificates. Available in black and blue. Save today!certificate-diploma-coverscustom-pagecertificate-diploma-covers1logsetfordiplogoproof50"12 business days text only, 21 business days w/logo" "Columbia, South Carolina" "UPS (FedEx available on request)""PC60=2906312-210.457564.2Certificate SourceDiploma Covers1:22%,1000:34%"Diploma Covers" "Padded Diploma Covers" "Custom Diploma Covers" "Diploma Holders" "School Diploma Covers" "Award Certificates and Diploma Covers" "Award Certificates and Diploma Holders" "Award Certificates and Diploma Frames" "Award Certificate and Diploma Holders" "Certificate and Diploma Holders" "Certificates and Frames" "Certificates and Diploma Holders" "Diploma Covers and Certificates" "Diploma Covers and Award Certificates" "Diploma Covers, Frames and Holders" "Diploma Covers, Frames, Holders and Certificates"Shop for these 6" x 8" certificate covers at TrophyCentral. Add your organization name and even a logo.oppercustom-pagegifts-desk-general1personalized gifts498552-411015Gifts1:22%Find this Laserable Stainless Steel Flask with personalization at Top-Rated TrophyCentral.custom-pagephotoplaques1"1-2 business days" "Marquette, MI" "UPS"plaques498552-310.453021.45Quick TrophyPlaques1:14%"New Products"Find These Quality 7" x 9" Photo Plaques Discounted at TrophyCentral. Each Plaque with Photo includes Free Engraving!7x9photoBlank, General, Photo, Engraved Gifts, Coachcustom-pageplaques1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498552-310.451022.45JDS-SPlaquesBlank Plaques1:22%,5:26%,10:32%,25:37%Find these 7 x 9 inch (vertical) Black Finish Award Plaques at TrophyCentral. Each Black Finish Plaque Includes Free Engraving.7x9blackpBlank, Generalcustom-pageplaques1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498552-310.45816.95JDS-SPlaquesBlank Plaques1:22%,5:26%,10:32%,25:37%"Meeting or Exceeding Goals"These beautiful 7" x 9" plaques feature a fabulous black piano finish. Each plaque includes free engraving!7x9pianopBlank, Generalcustom-pageplaques1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498552-310.45815.62TrophyCentralPlaquesBlank Plaques1:14%,5:21%,10:25%,25:32%"Meeting or Exceeding Goals" "Father's Day Gifts"Find this 7 x 9 Cherry Plaque discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping!7x9cherrypBlank, Generalcustom-pageplaques1105503-610.4511214.85Classic MedallicsPlaques1:14%custom-pageplaques1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498552-310.45816.95JDS-SPlaquesBlank Plaques1:22%,5:27%,10:33%,25:42%"Meeting or Exceeding Goals"Find quality Walnut finish plaques at TrophyCentral. Features free engraving and fast 1-2 day shipping.7x9walnutpBlank, Generalcustom-pagehonorrollpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:22%,50:30%,100:35%,500:48%"Honor Roll" "Honor Roll Pins" "Honor Roll Trophies" "School Pins"Find These Fabulous Honor Student Pins - 7/8" Discounted At Top-Rated TrophyCentral.hp12Honor Roll, Academiccustom-pagestudent-council-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"Find Outstanding Student pins discounted at TrophyCentral. Each Outstanding student pin features a clutch-back. Fast 1-2 day shipping.br469Academiccustom-pagehonorrollpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:22%,50:30%,100:35%,500:48%"Honor Roll" "Honor Roll Pins" "Honor Roll Trophies" "School Pins"Find these popular School Honor Roll HP Series Award Pins Discounted at TrophyCentral. Fast 1-2 Days Shipping. Buy in Bulk and Save!hp0903-22-2012Honor Roll, Academiccustom-pagecertificate-diploma-covers1logsetfordip50"12 business days text only, 21 business days w/logo" "Columbia, South Carolina" "UPS (FedEx available on request)"diploma covers2906312-210.85045.8Certificate SourceDiploma Covers1:22%,1000:28%"Diploma Covers" "Padded Diploma Covers" "Custom Diploma Covers" "Diploma Holders" "School Diploma Covers" "Award Certificates and Diploma Covers" "Award Certificates and Diploma Holders" "Award Certificates and Diploma Frames" "Award Certificate and Diploma Holders" "Certificate and Diploma Holders" "Certificates and Frames" "Certificates and Diploma Holders" "Diploma Covers and Certificates" "Diploma Covers and Award Certificates" "Diploma Covers, Frames and Holders" "Diploma Covers, Frames, Holders and Certificates"Find These Two Sided Custom Diploma Covers Discounted At TrophyCentral. Add You Own Text And Logo!Diploma Cover (Custom, 2-Sided)custom-pagecertificate-diploma-covers110"1-3 business days wo/imprinting, 8-14 days w/imprinting" "Columbia, South Carolina" "UPS (FedEx available on request)""PC11=290631-30.85045.8Certificate SourceDiploma Covers1:22%,2500:47%"Diploma Covers" "Padded Diploma Covers" "Diploma Holders" "School Diploma Covers" "Award Certificates and Diploma Covers" "Award Certificates and Diploma Holders" "Award Certificates and Diploma Frames" "Award Certificate and Diploma Holders" "Certificate and Diploma Holders" "Certificates and Frames" "Certificates and Diploma Holders" "Diploma Covers and Certificates" "Diploma Covers and Award Certificates" "Diploma Covers, Frames and Holders" "Diploma Covers, Frames, Holders and Certificates"Find there 8 1/2" x 11" Diploma Covers at TrophyCentral. We offer a great selection high-quality school diploma and certificate covers.1custom-pagecertificate-diploma-covers1logsetfordiplogoproof50"12 business days text only, 21 business days w/logo" "Columbia, South Carolina" "UPS (FedEx available on request)"diploma covers2906312-211 2 3 230.375045.37Certificate SourceDiploma Covers1:22%,2500:49%"Diploma Covers" "Padded Diploma Covers" "Custom Diploma Covers" "Diploma Holders" "School Diploma Covers" "Award Certificates and Diploma Covers" "Award Certificates and Diploma Holders" "Award Certificates and Diploma Frames" "Award Certificate and Diploma Holders" "Certificate and Diploma Holders" "Certificates and Frames" "Certificates and Diploma Holders" "Diploma Covers and Certificates" "Diploma Covers and Award Certificates" "Diploma Covers, Frames and Holders" "Diploma Covers, Frames, Holders and Certificates"Shop for 8 1/2x 11 Single-Sided Custom Diploma Covers at TrophyCentral. We offer high-quality custom diploma and personalized certificate covers.Diploma Cover (Custom, 1-Sided)custom-pagecertificate-diploma-covers110"1-3 business days wo/imprinting, 8-14 days w/imprinting" "Columbia, South Carolina" "UPS (FedEx available on request)"diploma covers290631-31 2 3 230.85050.8Certificate SourceDiploma Covers1:22%,1000:31%"Diploma Covers" "Padded Diploma Covers" "Diploma Holders" "School Diploma Covers" "Award Certificates and Diploma Covers" "Award Certificates and Diploma Holders" "Award Certificates and Diploma Frames" "Award Certificate and Diploma Holders" "Certificate and Diploma Holders" "Certificates and Frames" "Certificates and Diploma Holders" "Diploma Covers and Certificates" "Diploma Covers and Award Certificates" "Diploma Covers, Frames and Holders" "Diploma Covers, Frames, Holders and Certificates"Find these 2-sided, stock (blank) diploma covers discounted at TrophyCentral. Holds 8 1/2" x 11" diploma or certificate. Ships from the factory in just 1-2 business days.trophy-and-award-buying-lists11Motivational certificates and awards for students can inspire achievement, boost self-esteem, and encourage positive behavior. Explore a range of certificates to reward students for various accomplishments.freeawardcertificatescustom-pageplaques1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498552-310.45816.45JDS-SPlaquesBlank Plaques1:30%,5:32%,10:34%,25:37%Find these 8 x 10 inch (vertical) Black Finish Award Plaques at TrophyCentral. Each Black Finish Plaque Includes Free Engraving.8x10blackpBlank, Generalcustom-pageplaques1simenplaq"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498552-410.45818.45JDS-SPlaquesBlank Plaques1:30%,5:33%,10:38%,25:43%Find This 8" x 10" Vertically Oriented Cherry Plaque Discounted at TrophyCentral. Fast 1-2 Day Shipping!Blank, Generalcustom-pagegifts-desk-general1photoplaques"1-2 business days" "Marquette, MI" "UPS"plaques498552-310.452419.65TrophyCentralPlaques1:14%"New Products"Find These Quality 8" x 10" Photo Plaques Discounted at TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.8x10photoEngraved Gifts, Coachcustom-pageplaques1"1-2 business days" "Marquette, MI" "UPS"plaques498852-310.452422.05Quick TrophyPlaquesBlank Plaques1:14%"New Products"Find This Fabulous 8" x 10" Rosewood Eagle Plaque Discounted At TrophyCentral. Price Includes Engraving!Blank, General, Eaglecustom-pageplaques1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498552-310.45818.45JDS-SPlaquesBlank Plaques1:30%,5:35%,10:42%,25:46%"Minuteman"Find this 8" x 10" Vertical Oriented Walnut Finish Plaque Discounted at TrophyCentral. Features Free Engraving! Fast 1-2 Day Shipping!8x10walnutpBlank, Generalcustom-pageglass-crystal-awards1"1-2 business days" "Marquette, MI" "UPS"general498852-310.451234Quick TrophyCrystal Awards1:14%"New Products"Find This 8" x 6" Marble Glass Fusion Award with a Green Marble Accent Discounted at TrophyCentral. Price Includes Engraving.Leadershipcustom-pageplaques1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498552-310.45818.45JDS-SPlaquesBlank Plaques1:30%,5:32%,10:34%,25:37%These beautiful 8" x 10" wood plaques feature a fabulous black piano finish. Each plaque includes free engraving!8x10pianopBlank, Generalcustom-pagegifts-desk-general1498552-411018Gifts1:22%8 oz Ceramic Square Laser Coffee Mug in your choice of color!trophy-and-award-buying-lists11Explore a guide to affordable medals for children to celebrate achievements in academics, sports, and personal growth. Find inspiration and motivation for young achievers.trophy-and-award-buying-lists11Discover nine fun and inexpensive pickleball awards perfect for any event or tournament. These budget-friendly options, including some free ideas, are sure to make your pickleball event memorable.pickleball-trophiescustom-pageplaques1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498552-310.45729.15JDS-SPlaquesBlank Plaques1:30%,5:31%,10:32%,25:35%Find these 9 x 12 inch (vertical) Black Finish Award Plaques at TrophyCentral. Each Black Finish Plaque Includes Free Engraving.9x12blackpBlank, Generalcustom-pageplaques1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498552-310.45821.00JDS-SPlaquesBlank Plaques1:30%,5:31%,10:32%,25:35%"Minuteman"These beautiful wood plaques feature a fabulous black piano finish. Each plaque includes free engraving!9x12pianopBlank, Generalcustom-pagefloating-plaques1"1-2 business days" "Marquette, MI" "UPS"plaques498552-310.451619.65TrophyCentralPlaquesBlank Plaques1:14%"New Products" "Special Picks"Find this 9 x 12 inch vertical black finish plaque with floating acrylic and other glass plaques at discounted at TrophyCentral.9x12floatingpianoBlank, Generalcustom-pageplaques1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498552-310.45821.00JDS-SPlaquesBlank Plaques1:30%,5:33%,10:35%,25:39%Find this 9 x 12 Cherry Plaque discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Blank, Generalcustom-pagegifts-desk-general1photoplaques"1-2 business days" "Marquette, MI" "UPS"plaques498552-310.451619.65Quick TrophyPlaques1:14%"New Products" "Special Picks"Find These 9" x 12" Engraved Photo Plaques (Cherry Finish) Discounted at TrophyCentral. Free Engraving! TrophyCentral is a Top-Rated Merchant.9x12photoEngraved Giftscustom-pagefloating-plaques1"1-2 business days" "Marquette, MI" "UPS"plaques498552-310.451619.65Quick TrophyPlaquesBlank Plaques1:14%"New Products"Find this 9 x 12 inch vertical orientation, rosewood finish plaque with floating acrylic and other glass plaques at discounted at TrophyCentral.9x12floatingrosewoodBlank, Generalcustom-pageplaques1"1-2 business days" "Marquette, MI" "UPS"plaques498552-310.451614.85Trophy CentralPlaquesGeneral1:14%"New Products"Find this 9" x 12" Soaring Eagle Plaque at TrophyCentral. Eagle plaque includes engraving.Blank, General, Eaglecustom-pageplaques1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498552-310.45821.00JDS-SPlaquesBlank Plaques1:30%,5:33%,10:37%,25:42%"Minuteman"Find Quality Walnut Finish Plaques Discounted At TrophyCentral. Features Free Engraving and Fast 1-2 Day Shipping!9x12walnutpBlank, Generalcustom-pagegavelplaques1"1-2 business days" "Marquette, MI" "UPS"plaques498552-310.451618.05AirflytePlaquesGeneral, Gavel Plaques1:14%"New Products"Find Quality 9" x 12" Walnut Gavel Plaques at TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.See all of our populargavelplaques02-25-2025Gavelcustom-pageplaques1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498552-310.451022.45JDS-SPlaquesBlank Plaques1:22%,5:26%,10:32%,25:37%"New Products"Find these 9 x 7 inch (horizontal) Black Finish Award Plaques at TrophyCentral. Each Black Finish Plaque Includes Free Engraving.9x7blackhBlank, Generalcustom-pageplaques1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498552-310.45815.62JDS-SPlaquesBlank Plaques1:22%,5:26%,10:32%,25:37%"Meeting or Exceeding Goals"These beautiful 9" x 7" plaques feature a fabulous black piano finish. Each plaque includes free engraving!9x7pianohBlank, Generalcustom-pageplaques1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498552-310.45818.92TrophyCentralPlaquesBlank Plaques1:14%,5:21%,10:25%,25:32%1:14%,5:21%,10:24%,25:30%1:14%,5:21%,10:24%,25:30%Find This Fabulous 9" x 7" Horizontally Oriented Engraved Cherry Finish Plaque Discounted At TrophyCentral. Price Includes Free Engraving! Fast 1-2 Day Shipping!9x7cherryhBlank, Generalcustom-pageplaques1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498552-310.458052615.62JDS-SPlaquesBlank Plaques1:22%,5:27%,10:33%,25:42%"Meeting or Exceeding Goals"Find These 9" x 7" Walnut Finish Plaques at TrophyCentral. Features Free Engraving and Fast 1-2 Day Shipping!9x7walnuthBlank, Generalcustom-pageclocks1"4-6 business days " "Mount Vernon, NY" "UPS"personalized gifts105503-610.4511258.05Classic MedallicsGiftsClocks1:22%Shop for 9-1/2 X 12 Clock Plaque from TrophyCentral.Engraved Clockscustom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Shooting Medals"Buy these quality 9m Beretta Inserts (Litho) at TrophyCentral. Each 9mm Beretta Insert can be used to create a unique plaque, medal or trophy.507415
noindexed-items111noindexed-items111noindexed-items111111noindexed-items111imgexport1111Comprehensive guide for coaches on leading character discussions with athletes. Includes ready-to-use discussion formats and facilitation techniques.11Complete framework for coaches to write powerful scholarship recommendation letters using specific examples that makes athletes stand out to selection committees.11Hit a home run with perfect baseball awards! Discover creative trophy ideas for every player from T-ball tots to travel ball stars, plus budget-friendly options that celebrate America's pastime.111498552-31111Discover the ultimate pickleball trophy and medal guide! From tournament champions to recreational players, find creative award ideas that celebrate America's fastest-growing sport.11Discover various spelling bee contests in the U.S., including competitions for all ages, notable winners, and awards. A detailed look at the nation's love for spelling challenges.spelling bee contests, U.S. spelling bees, Scripps National Spelling Bee, adult spelling bees, homeschool spelling bee, spelling contest awards, spelling bee winnersemployee-resource-hub11Explore the rich history and tradition of service pins, from their early origins to their modern role in honoring employee loyalty and dedication.custom-pagehonor-roll-certificates1certificates290631-31 2 3 230.45100020.45Certificate SourceCertificatesAward Certificates1:22%,25:24%,100:40%,500:50%Find These Printed "A" Honor Roll Award Certificates At TrophyCentral. Each "A" Honor Roll measures 8 1/2 x 11 inches. Fast 1-2 day shipping.926Honor Roll, Academiccustom-pagehonorrollpinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:30%,50:34%,100:39%,500:43%"Honor Roll" "Honor Roll Pins" "Honor Roll Trophies" "School Pins"Find these A Honor Roll Pins discounted at TrophyCentral. Each A Honor Roll pin features a high-quality finish and clutch-pin back.br589Honor Roll, Academiccustom-pagehonor-roll-certificates1certificates290631-31 2 3 230.45100020.45Certificate SourceCertificatesAward Certificates1:22%,25:24%,100:40%,500:50%"Honor Roll" "Honor Society" "Honor Society Awards" "Honor Roll Awards"Find These Printed "A-B" Honor Roll Certificate Templates Discounted At TrophyCentral. Each "A-B" Honor Roll Template Measures 8 1/2 x 11 Inches.928Honor Roll, Academiccustom-pageletter-shaped-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoName Badges1Find these popular A-shaped custom mascot badges at TrophyCentral. Great for fundraising! TrophyCentral is a top-rated Yahoo merchant.letterbadges-acustom-page11About Us: Find information about TrophyCentral - A leading provider of online awards.custom-pageglass-crystal-awards1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"general410187-1010.45454.05JcharlesCrystal Awards1:22%,25:32%"crystal awards"Generalcustom-pagecorporatepins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsBusiness1:30%,50:34%,100:39%,500:43%"Meeting or Exceeding Goals"Find this American British Flag Pin at TrophyCentral. American British Flag and other pins ship in just 1-2 business days!abbelapin02-22-2009General, Academic (General), Businesscustom-pagetrophies-golf1"10 business days" "Aliquippa, PA" "UPS"trophies1500110-1410.45412.45Glass AmericaCrystal AwardsSports, Hobby, Org, Livestock1:22%,10:25%Absolute Optical Crystal Golf Ball Award. Ideal for leagues, schools, and tournaments. Fast shipping.Golf, Sportscustom-pageaward-ribbons-rosettes11"5-7 business days" "Topeka, Indiana" "UPS (Priority Mail also available)"ribbons465712-141 260.468024.46Tower RibbonRibbonsAwareness Ribbons1:22%,50:36%"Customized Ribbons" "Blue Ribbons" Find Abuse Ribbons discounted at TrophyCentral. Each blue abuse awareness ribbon features choice of backing and optional imprint.abawriShop for Blue Awareness Ribbons with Ease at TrophyCentral TrophyCentral has a wonderful selection, discounted and bulk pricing and great customer service. Each awareness ribbon comes with a tape or pin back and is available with optional imprinting.]]>Abuse, Domestic Violencecustom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these quality Academic (In Honor Of Academic Excellence) Inserts (Litho) at TrophyCentral. Each Academic (In Honor Of Academic Excellence) Insert can be used to create a unique plaque, medal or trophy.5074859-25-2021General
custom-pagetrophies-academic1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesAcademic1:14%,10:18%,50:22%,100:25%Find this popular academic lamp of learning figure trophy with 1st, 2nd or 3rd place trim, with marble base and free personalization, discounted at trophyCentral. Ships in a fast 1-2 days!qtacadplAcademic, 1st / 2nd / 3rd / Etc.custom-pagetrophies-academic1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesAcademic1:14%,10:18%,50:22%,100:25%This popular Academic trophy features a real marble base, column, figure and trim indicating year of award. Includes up to three lines of free engraving!qtacadyrAcademiccustom-pagefree-school-certificate-templates1"Download Only"certificates49855011TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Free Academic Achievement Award certificate template from TrophyCentral. Measures 11 x 8 1/2 inches - download and print in minutes.Free-Academic Achievement Award-Certificateacademic-freeAcademic, Achievementcustom-pagetrophies-academic1trophies498552-311821.06TrophiesAcademic1Find this achievement cup trophy with academic lamp figure discounted at TrophyCentral. Includes free text engraving!cup-acad-pAcademiccustom-pageacademic-general-medals102-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105503-60.37115021.37Classic MedallicsMedalsAcademic1:22%,25:24%,50:30%,100:36%,500:42%"School Medals" "School Award Medals" "Scholastic Medals" "Scholastic Award Medals" "Academic Medals" "Academic Award Medals" "Medals, School"Your students will love these colorful Mylar Academic Achievement Medals from TrophyCentral. Each Academic Achievement medal includes a neck ribbon!tm9897Academic
custom-pageacademic-general-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic MedallicsMedalsAcademic1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "School Medals"These inexpensive 1 1/4 inch Academic Achievement Medals offer a high quality, but low price for those on a tight budget.e998405-29-2019Academic
custom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsAcademic1:22%"Award Medals" "Award Medals - All Subjects" "School Medals"Buy these quality Mylar Academic Achievement Decal Inserts at TrophyCentral. Each decal can be used to create a unique plaque, medal or trophy.489897Achievement
custom-pagestudent-council-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:30%,50:34%,100:39%,500:43%"School Pins" "School Lapel Pins"Find this Peak Performance Pin at TrophyCentral. Peak Performance and other pins ship in just 1-2 business days!br54105-20-2014Academiccustom-pagefree-school-certificate-templates1"Download Only"free-academic4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Academic Award template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Academic-Award-Certificateacademic-award-freeAcademic, Achievementcustom-pagetrophies-academic1trophies498552-312421.33TrophiesAcademic1Find these academic lamp budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtacadscbAcademiccustom-pagetrophies-academic1498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Find this budget school / academic award trophy discounted at Trophy Central. Features a real marble base and plastic lamp of learning figure. Engraving is free. Fast 1-2 day shipping.bdg-academicAcademiccustom-pagetrophies-academic1trophies498552-411229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find this academic lamp champion's cup trophy discounted at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's Cup - Academic-LampAcademiccustom-pagetrophies-academic1trophies498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Academic insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-Academic-InsertAcademiccustom-pagetrophies-academic1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75219Quick TrophyTrophiesAcademic1:14%,3:19%,10:27%Find these fabulous Academic Figure Champions Line 3-column Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qtacadttAcademiccustom-pagetrophies-academic1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.2115Quick TrophyTrophiesAcademic1:14%,3:19%,10:28%See this championship trophy with an Academic figure at TrophyCentral. Be sure to see all of our Academic figure awards.qtacadttwAcademiccustom-pagetrophies-academic1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Academic single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - AcademicAcademiccustom-pagetrophies-academic1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesAcademic1:14%,10:18%,50:24%,100:28%Find these popular Academic Lamp single column trophies discounted and with free personalization at TrophyCentral.qtacadscSee more:trophies-schoolAcademiccustom-pageblog-trophycentral11Strategic recognition for academic competitions. Science fair trophies, spelling bee medals, math league awards. Tiered approaches that celebrate winners and participants.custom-pagetrophies-academic1trophies498551-311821.06TrophyCentralTrophies1Academiccustom-pagecustommedals50"Standard Service: 8 Business Days from Receipt of Artwork, Rush Service (Extra Charge): 3 Business Days from Receipt of Artwork" "Oxnard, CA" "UPS (FedEx available on request)"medals930335-1010.630033.6Simba CalMedalsAcademic1:22%,300:40%,500:51%,1000:54%"School Medals" "School Awards"These 2 1/2 inch custom Academic Lamp and Book Medals come with an outer-ring which allows you to add your school or league name, date and location.qcm-8Academiccustom-pagetrophies-academic1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.05Quick TrophyTrophiesAcademic1:14%,10:18%Find The Popular Academic Lamp Deluxe Platform Series Trophies Discounted at TrophyCentral. Real Marble Base; Free Personalization!qtacaddmAcademiccustom-pagemedals-diamond-cut-edge12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic MedallicsMedalsAcademic1:22%,25:29%,100:38%"School Awards" "School Award Medals"See Our Academic Excellence Medals With A Diamond-Cut Edge. Also See Our Other High-Quality Academic Excellence Awards At TrophyCentral!z914109-30-2019General, Academic
custom-pageacademic-general-medals20medals498552-40.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful Academic Excellence 2" Epoxy-covered insert decal discounted at TrophyCentral. Fast 1-2 day shipping.Academiccustom-pagegold-pins-lapelplastic-pinbox-t5lapel pins498551-20.550040.5TrophyCentralLapel Pins11:22%,25:24%,100,27%,500:30%Find our 3D Series gold academic excellence pin discounted at TrophyCentral. Each academic excellence pin features a clutch back so it can be easily and safely attached to clothing. Fast 1-2 day shipping.Academiccustom-pageacademic-general-medals1medals498552-30.525033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this Academic Excellence 2 1/4" Antique Gold Medal Discounted at TrophyCentral. Each medal features a free ribbon. Fast shipping!Academiccustom-pagefree-school-certificate-templates1"Download Only"free-academic49855011TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Academic Excellence template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Academic-Excellence-Certificateacademic-excellence-freeAcademic, Achievementcustom-pageacademic-general-medals1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Academic Excellence Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Academiccustom-pageawardcertificates117021 hp03 tm9779 e9141certificates290631-31 2 3 230.45100020.45Certificate SourceCertificatesAward Certificates1:22%,25:24%,100:40%,500:50%Find These Printed Academic Excellence At TrophyCentral. Each Academic Excellence Measures 8 1/2 x 11.921Academiccustom-pagefree-school-certificate-templates1"Download Only"free-academic49855011TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Free printable Academic Excellence certificate template from TrophyCentral, designed to recognize outstanding academic achievement. Measures 11 x 8 1/2 inches.Free-Academic-Achievement-Award-Certificateacademic-achievement-freeAcademic, Achievementcustom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceSealsEmbosser Seals1:22%,3:28%,5:31%Find these Academic Excellence Certificate Seals discounted at TrophyCentral. Features Pressure-Sensitive Backing for Easy Sealing.803aGeneralcustom-pageschool-pinsplastic-pinbox-t10498551-30.5200040.5TrophyCentralLapel Pins11:22%,25:24%,100,27%,500:30%Find this Academic Excellence Gold Enamel lapel pin discounted at TrophyCentral. Fast 1-2 day shipping.academic-u-pbAcademiccustom-pageacademic-general-medals1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Academic Excellence Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Academiccustom-pageacademic-general-medals1medals498552-30.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this Colorful Academic Excellence insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Academiccustom-pageacademic-general-medals1medals498552-40.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this Academic Excellence insert medal With A Personalized Front Rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Academiccustom-pagetm9779plasticpinboxvelapinbox10921 br326 tm9779 e9141"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:22%,50:30%,100:35%,500:48%"Honor Student Awards" "Honor Awards"Find these popular Academic Excellence HP Series Award Pins Discounted at TrophyCentral. Fast 1-2 Days Shipping!hp0301-08-2009AcademicAcademic Excellencecustom-pageschool-pinsplastic-pinbox-t5lapel pins498551-20.550040.5TrophyCentralLapel Pins11:22%,25:24%,100,27%,500:30%Find this Academic Excellence Gold Enamel lapel pin discounted at TrophyCentral. Features a clutch-pin back for easy attachment to clothing.. Fast 1-2 day shipping.academic-u-pbAcademiccustom-pageacademic-general-medals1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Academic Excellence Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Academiccustom-pagetrophies-academic1trophies498552-311218.84TrophiesAcademic1Find this unique cup trophy with Academic Lamp figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-acad-scbAcademiccustom-pagetrophies-academic1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.4118Quick TrophyTrophiesAcademic1:14%,3:19%,10:24%Find these fabulous two-tier, 3-column champion Academic Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtacad3cAcademiccustom-pageacademic-general-medals10tm9746 7021 hp03 br326 e91412-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic MedallicsMedalsAcademic1:22%,25:24%,50:30%,100:36%,500:42%"School Medals" "School Award Medals" "Scholastic Medals" "Scholastic Award Medals" "Academic Medals" "Academic Award Medals" "Medals, School"Your students will love these colorful Mylar Academic In Honor Of Academic Excellence Medals from TrophyCentral. Each Academic In Honor Of Academic Excellence medal includes a neck ribbon!tm9779Academic
custom-pageplaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these academic insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Academiccustom-pagetrophies-academic1trophies498551-310.452429Trophies1Find this popular Academic Lamp trophy discounted at TrophyCentral. Features a real marble base, stylish 4-inch gold cup, free engraving and fast shipping.academic-lamp-cup-place-trophycustom-pagetrophies-academic1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511230.45Classic MedallicsTrophiesAcademic1:22%,6:23%,12:24%,24:26%Shop for Cast Stone School Lamp of Learning Awards at TrophyCentral. We have a great selection of School Lamp of Learning and other recognition trophies at discounted prices.tr9911Academiccustom-pageacademic-general-medals102-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic MedallicsMedalsAcademic1:22%,25:24%,50:30%,100:36%,500:42%"School Medals" "School Award Medals" "Scholastic Medals" "Scholastic Award Medals" "Academic Medals" "Academic Award Medals" "Medals, School"Your students will love these colorful Mylar Academic Lamp of Learning Medals from TrophyCentral. Each medal includes a neck ribbon!tm9746Academic
custom-pagetrophies-academic1trophies498551-310.452429Trophies1Find our Academic Lamp star column trophy discounted at TrophyCentral. Features a real marble base, 6 inch gold star-shaped column, free engraving and fast shipping.academic-lamp-star-column-trophycustom-pagefreeawardcertificatesachievement-medalsart-medalsband-medalschess-medalsdancemedalsdrama-medals-pinstrophies-honor-roll-societyattendance-medals-pinsreadingawardsscienceawardsquickshiptrophies-spellingtrophies-mathmusicmedalstm9812e9984debate-trophiesacademic-mcacademic-mc-pracademic-mgtm9897tm9779tm9748tm9841m155m146me109gl324-principalacademic-jigfacademic-jisfacademic-jibftm9746tm9755tm9667scholmedcomsoonecschtm9812quickshiptrophies-graduatee9930e4791e9914e9229e9003e9128e9962e99511award-medals1

Academic Medals - Subject-Specific School Awards for Every Grade Level and Recognition Program

Academic medals give schools a practical and affordable way to recognize student achievement across every subject, competition, and recognition occasion without requiring a separate trophy line for each activity. The subject-specific insert design on the front of each medal immediately communicates the area of achievement being recognized, whether that is a math competition first place, a reading program completion, a science fair ribbon, or a spelling bee championship, connecting the award directly to the accomplishment in a way that a generic medal cannot. Each academic medal includes a free neck ribbon for immediate wearable presentation at assemblies, award ceremonies, and classroom recognition events, and optional back engraving personalizes the award with the student's name, school, and year so it serves as a lasting keepsake rather than a generic participation item. Bulk pricing makes academic medals practical for large school-wide recognition programs presenting awards to dozens or hundreds of students across multiple grade levels and subject categories in a single ceremony, keeping per-student costs manageable without sacrificing the meaningful, subject-specific recognition that motivates continued academic effort.

Frequently Asked Questions About Academic Medals

What school events and occasions are academic medals most commonly used for?

Academic medals serve a wide range of school recognition needs precisely because the subject-specific insert format allows a single medal style to cover every curricular and extracurricular achievement area with a design that connects directly to the activity. Spelling bees from classroom level through district and regional competitions use academic medals as the primary recognition award, with gold, silver, and bronze finishes communicating placement to every observer without any explanation needed. Science fairs present academic medals for project placement across grade levels and subject categories, giving students a wearable recognition item they can display on a lanyard alongside their project board during judging. Math competitions including Math Olympiad, Math Counts, and classroom-level math challenges use math-specific insert medals to honor top performers in a format that travels home from the event and remains meaningful as a keepsake. Reading program completions, accelerated reader milestones, and summer reading challenges use reading insert medals to reward the sustained individual effort that independent reading programs require. End of year school award ceremonies presenting recognition across multiple subjects benefit from the insert medal format because a consistent base style with subject-specific inserts creates a cohesive, professional appearance across the full event regardless of how many different subjects and achievement categories are being recognized at the same time.

Should academic medals be presented to every student or only to top performers?

The right approach depends on the specific program and the goal of the recognition, and most effective school recognition programs use a combination of competitive placement medals for top performers and participation or achievement medals for broader recognition rather than choosing one approach exclusively. Competitive academic events like spelling bees, science fairs, and math competitions benefit from presenting gold, silver, and bronze medals to top finishers since the placement recognition communicates genuine competitive achievement and motivates students to prepare seriously for future competitions. Participation medals for all competitors in these events acknowledge the effort required to prepare and compete, particularly at the elementary level where building positive associations with academic competition matters more than creating sharp distinctions between winners and other participants. Program completion medals for reading challenges, subject mastery programs, and academic enrichment courses suit universal presentation since every student who completed the program earned the recognition through sustained personal effort rather than competitive performance. Schools running year-end award ceremonies typically reserve medals for students earning specific honors such as subject excellence, most improved, and outstanding achievement rather than presenting them to all students, using the medal as a meaningful distinction rather than a universal participation item. The grade level matters too: elementary programs generally benefit from more inclusive medal presentation while middle and high school programs appropriately shift toward merit-based recognition that prepares students for increasingly competitive academic and extracurricular environments.

What should be engraved on an academic medal?

Academic medal engraving appears on the back of the medal and works best when it captures the essential recognition details concisely given the limited surface area available. For competitive event medals, include the student name, placement or award title, event name, school or district, and year, for example: Emma Rodriguez, First Place, District Spelling Bee, Jefferson Elementary, 2025, or Marcus Chen, Science Fair Excellence, 6th Grade, Riverside Middle School, Spring 2025. For program completion and achievement medals, student name, program name, and year provide clean, readable recognition: Sofia Park, Accelerated Reader Champion, 2024-2025. Honor roll and academic excellence medals benefit from noting the specific recognition tier: Tyler Walsh, High Honor Roll, All Four Quarters, Lincoln Academy, 2025. When presenting medals to large numbers of students at a single ceremony where individual engraving for every medal would be impractical or cost-prohibitive, the subject-specific insert design on the front already communicates the achievement clearly, and a simple school name and year on the back provides enough context to make the medal meaningful as a keepsake. See our complete collection of honor roll pins and academic pins for additional recognition options that complement academic medals in a complete school recognition program.

If you need more information before deciding, see our expert resource section:
]]>
trophies-academicAcademic / School
custom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these quality Mylar Academic Decal Inserts at TrophyCentral. Each decal can be used to create a unique plaque, medal or trophy.489746Academic
custom-pagetrophies-academic1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our academic excellence insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - AcademicAcademiccustom-pagetrophies-academic1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453633.4Quick TrophyTrophiesGeneral1:14%,10:17%,25:23%,50:29%,100:34%Our Academic Lamp Participation Trophies feature a real slant-front white marble base and free personalization. Significant quantity discounts available.qtacadncBe sure to see our fabulous selection oftrophies-school7-14-2009Academiccustom-pagetrophies-academic1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.41234Quick TrophyTrophiesPerpetual Trophies11:14%,3:15%,10:16%Find this Perpetual School Trophy Discounted at TrophyCentral. Each Trophy has enough room for 32 names. Ships in just 1-2 days.qtacadperpAcademiccustom-pageplaques1"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498852-310.45811.6Quick TrophyPlaquesInsert1:14%,3:14%See this stunning Academic plaque and other Holographic Plaques at TrophyCentral.qsinplaqacAcademicscholarship-guideclassroom-managementpta-guidestudent-recognition-guidegraduation-ceremony-guide1trophy-award-guides1Your complete guide to academic awards and educational recognition. From graduation ceremonies to academic achievement awards, discover expert insights for celebrating educational excellence and student success.custom-pageplaques1"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498852-310.45811.6Quick TrophyPlaquesInsert1:14%,3:14%See this stunning Academic Star plaque and other Holographic Plaques at TrophyCentral.qsinplaqacstarAcademic,Starcustom-pagefree-school-certificate-templatescitizenship-awardsdebate-trophiesquickshiptrophies-graduatetrophies-honor-roll-societytrophies-mathreadingawardsscienceawardsquickshiptrophies-spellingperfect-attendance-awardsacademic-plaque-iclasacschooltrophies14schooltrophies181trophies1Celebrate Every Achievement with Our Academic Trophies

Our extensive selection covers every academic milestone, from math and science competitions to art showcases, debate tournaments, spelling bee victories, and citizenship awards. Choose from hundreds of trophy styles, elegant plaques, and commemorative medals that perfectly match your school's awards and recognition needs.

Our academic trophy range includes specialized options for every occasion, while our plaques offer timeless elegance for honor roll recognition and wall displays. Personalization is simple with our free engraving service and easy logo upload options for truly customized academic awards.

Premium Quality & Customization Options

Each award features superior construction using premium materials, including polished metal, crystal, durable resin, and clear acrylic components that ensure lasting beauty. From engraved medals for individual achievements to impressive academic awards for graduating seniors, every piece reflects the prestige of educational success.

Our expert craftsmanship guarantees these academic trophies, plaques, and medals will withstand years of display while maintaining their prestigious appearance. Fast turnaround times and bulk-friendly personalization options make ordering for entire graduating classes or large tournaments effortless.

Why Choose Trophy Central for Your Academic Awards?

With decades of experience serving schools nationwide, Trophy Central maintains an extensive inventory of achievement trophies, plaques, medals, and academic awards ready for immediate customization. From spelling bee trophies to perfect attendance recognition, we stock thousands of options ready for your school's specific needs.

Our expert support team guides you through every step, from selection to personalization, ensuring perfect results every time. Enjoy free engraving, fast shipping, and our comprehensive satisfaction guarantee on every order.

Recognize Academic Excellence Today

Browse our complete collection of academic trophies, medals, plaques, and academic awards to discover the perfect recognition for your students' achievements. Start customizing your recognition program now with our user-friendly design tools and competitive pricing.

Whether you need plaques for semester recognition, perfect attendance awards for dedicated students, or spelling bee medals for competition winners, Trophy Central delivers quality and value. Shop today to celebrate knowledge, dedication, and academic excellence with awards that students will treasure forever.

Frequently Asked Questions

What types of academic trophies do you offer?

We offer a great selection of academic trophies, including traditional trophy columns, resin figure trophies, crystal awards, medals with ribbons, and wall-mounted plaques. Popular categories include spelling bee trophies, 100% attendance medals, and subject-specific awards for math, science, reading, art, and citizenship.

Can I order different academic awards for various achievement levels?

Absolutely! Many schools order tiered recognition, with gold, silver, and bronze medals for spelling bee competitions, different-sized plaques for honor roll levels (Principal's List, Honor Roll, Merit Roll), and varied trophy heights for 1st, 2nd, and 3rd place academic achievements. Our great selection of styles ensures you'll find options that fit every achievement level and budget.

Do you offer bulk discounts for large school orders?

Yes, significant savings are available through our bulk pricing on large quantities. Whether you're ordering plaques, medals, or spelling bee trophies, you'll enjoy competitive pricing and free economy shipping on all orders over $99. Our great selection makes it easy to find quality awards at any price point to fit your budget.

What personalization options are available for academic trophies and awards?

All our academic trophies and plaques include free engraving. You can add student names, achievement dates, school names, grade levels, and subjects. We also offer logo uploads for school emblems on plaques and larger trophies. With our great selection of styles and sizes available at various price points, you can create custom medals, trophies, and plaques that match your budget.

]]>
academic-general-medalsAcademic / School
custom-pageschool-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:22%,50:30%,100:35%,500:48%"School Pins" "School Lapel Pins"Find These Fabulous Academics Pins Discounted At Top-Rated TrophyCentral.hp02Academic11Find achievement certificates discounted at TrophyCentral. Each achievement certificate measures 8 1/2 x 11. Fast 1-2 day shipping. Start browsing now!

Shop with Ease at TrophyCentral

If you have any questions regarding our certificates, templates or awards, our expert staff in Michigan, New York and online can help! Just give us a call!!

]]>
certificate-diploma-covers certificateplaques
custom-pagetrophies-baseball1certificates290631-31 2 3 230.45100020.45Certificate SourceCertificatesAward Certificates1:22%,25:27%,100:40%,500:50%Achievement Baseball Certificate. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.1033Baseball / T-Ball, Sportscustom-pageawardcertificates115"1-3 business days" "Columbia, South Carolina; Marquette, Michigan" "UPS (FedEx available on request)"certificates290631-21 2 3 230.45100020.45Certificate SourceCertificatesAward Certificates1:22%,50:38%,100:42%Find these Photo Achievement certificates discounted at TrophyCentral. Each certificate measures 8 1/2 x 11 inches and typically ships in 1-2 days.7004Generalcustom-pagetrophies1trophies498551-212Trophies1Find this achievement cup trophy with marble base discounted at TrophyCentral. Includes free text engraving! Fast 1-2 day shipping.custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsGeneral1:22%Buy these quality Achievement Inserts (Litho) at TrophyCentral. Each Achievement Insert can be used to create a unique plaque, medal or trophy.501101General
custom-pageacademic-general-medals1st-place-medalsmedals-generale98xxe9423e9035e9152me100gtm9903eagle-medals1award-medals1Shop Achievement Medals in gold, silver, and bronze finishes. Perfect for celebrating accomplishments in school, sports, and more. Includes ribbon and fast shipping.

Achievement Medals - Gold, Silver and Bronze Recognition for Every Milestone

Achievement medals honor the dedication and effort behind every success, from a student's first honor roll recognition to an employee's years of service milestone to a competitor's first-place finish at a championship tournament. Available in classic torch designs evoking the Olympic tradition of excellence, eagle motifs representing strength and accomplishment, and general achievement styles suited for any recognition context, our medals come in gold, silver, and bronze finishes that instantly communicate achievement level within a program. The 1-1/4 inch size delivers affordable recognition for large ceremonies where every participant deserves acknowledgment, while the 2-1/2 inch premium medallion carries the visual weight appropriate for distinguished individual honors and top performers. Each achievement medal includes a free neck ribbon for immediate wearable presentation at banquets, assemblies, and award ceremonies, and optional engraving on the back personalizes the award with recipient names, event details, and dates.

Frequently Asked Questions About Achievement Medals

What occasions are achievement medals best suited for?

Achievement medals work well across a broader range of recognition contexts than sport-specific medals because the design communicates excellence and accomplishment rather than a particular activity. Schools use them for honor roll assemblies, academic excellence programs, perfect attendance recognition, and end-of-year awards spanning multiple subjects and extracurricular activities. Sports leagues present achievement medals for most improved player, best sportsmanship, and all-around excellence awards where a general design is more appropriate than a sport-specific figurine. Corporate programs use them for employee of the month, sales achievement, years of service milestones, and team performance recognition. Community organizations award them for volunteer service, citizenship, and leadership contributions. The versatility of achievement medal designs makes them practical for programs recognizing diverse accomplishments within a single ceremony, presenting a consistent, professional award format regardless of the specific achievement being honored.

What is the difference between the torch, eagle, and general achievement medal styles?

Torch medals feature a victory torch design drawn from the Olympic tradition, making them a natural choice for athletic recognition programs and competitive events where the imagery reinforces the spirit of striving and achievement. They are available in 1st, 2nd, and 3rd place versions in gold, silver, and bronze, making them ideal for programs that want a complete podium set with consistent design language across all three placement levels. Eagle medals feature an eagle motif that carries associations with strength, leadership, and distinction, making them popular for scouting programs, academic honors, and corporate recognition where those qualities are central to the award's meaning. General achievement medals use broader symbolic imagery appropriate for any milestone or accomplishment, giving programs the flexibility to present a meaningful award without the design implying a specific competitive or athletic context. All three styles are available in the same finishes and sizes, so the choice comes down primarily to which imagery best fits the culture and purpose of your recognition program.

How should I choose between the 1-1/4 inch and 2-1/2 inch achievement medal sizes?

Medal size communicates the relative significance of the achievement, so aligning size with the importance of the recognition helps set appropriate expectations for recipients. The 1-1/4 inch medals are the practical choice for large programs recognizing many participants, such as school-wide honor roll ceremonies, league-wide participation acknowledgment, or corporate events where dozens of employees receive recognition simultaneously. Their lower price point makes it financially realistic to recognize every deserving recipient without limiting the program to only top performers. The 2-1/2 inch premium medallion carries significantly more visual and physical presence, making it appropriate for top individual honors, annual award recipients, championship recognition, and distinguished achievement programs where the medal itself should convey the weight of the accomplishment. Many programs use both sizes together, presenting the smaller medal for broad category recognition and reserving the larger medallion for a single standout recipient in each category, creating a clear visual hierarchy that motivates recipients at every level.

If you need more information before deciding, see our expert resource section:
]]>
medals-generalAchievement
custom-pageacademic-general-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic MedallicsMedalsGeneral1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "School Medals" "General Award Medals" "Sports Medals"These inexpensive 1 1/4 inch Achievement (General) Medals offer a high quality, but low price for those on a tight budget.e912805-16-2015General
custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsGeneral1:22%Buy these quality Mylar Achievement Decal Inserts at TrophyCentral. Each Achievement Decal can be used to create a unique plaque, medal or trophy.489735Achievement
11Find a wide variety of achievement pins discounted at TrophyCentral. Each achievement pin features a clutch back for easily attaching to clothing. Achievementcustom-pageachievement-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic MedallicsMedalsGeneral1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "School Medals" "General Award Medals"These inexpensive 1 1/4 inch Achievement Recognition Medals offer a high quality, but low price for those on a tight budget.e915206-20-2019General, Academic
custom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceSealsEmbosser Seals1:22%,3:28%,5:31%Find these Achievement Certificate Seals discounted at TrophyCentral.803achGeneralcustom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsGeneral1:22%Buy these quality Achievement Star Handshake Inserts (Litho) at TrophyCentral. Each Achievement Star Handshake Insert can be used to create a unique plaque, medal or trophy.507388General
custom-pageplace-trophies12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic MedallicsMedalsGeneral1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "School Medals" "General Recognition Awards" "General Award Medals" "Sports Medals" "First Place Ribbons" "1st Place Ribbons"These inexpensive 1 1/4 inch Achievement (1st, 2nd, 3rd Place) Medals offer a high quality, but low price for those on a tight budget.e98xxNot what you are looking for? No problem, we have a huge selection ofto met all of your needs!award-medalsGeneral, Torch, Achievement, 1st / 2nd / 3rd / Etc.
custom-pageaward-medalsinsert-trophies-awardstrophies-generalstar-trophiesplace-trophiestorch-trophiestrophies-victoryall-star-trophiesmvp-trophies1trophies1Celebrate success with achievement awards including trophies, medals, ribbons and certificates. Honor first place finishes, participation, and motivational recognition with free engraving.Frequently Asked Questions
What is an achievement trophy used for?
Achievement trophies are used to recognize excellence, effort, or a milestone where a general design is more appropriate than a sport- or subject-specific figure. Common uses include employee recognition, end-of-year ceremonies, community service honors, and any event where the accomplishment being recognized does not fit a single category.
What is the difference between an achievement trophy and a participation trophy?
Achievement trophies are given to recognize a specific accomplishment, merit, or distinction, typically to a winner, honoree, or standout performer. Participation trophies are given to all participants regardless of outcome to acknowledge effort and involvement. Both styles are available at TrophyCentral and include free engraving.
Are your achievement trophies affiliated with the Academy Awards or Oscars?
No. Our classic achievement trophy figures are inspired by the traditional standing figure design but are not affiliated with, licensed by, or associated with the Academy of Motion Picture Arts and Sciences or the Oscars in any way.
What engraving goes on an achievement award?
Most customers include the recipient's name, the award title such as Employee of the Year or Outstanding Achievement, the organization or event name, and the year. Each trophy accommodates up to four lines of text at no additional charge.
Can I order achievement awards in bulk for a large ceremony?
Yes. Volume discounts apply automatically as quantity increases, and our standard 1 to 2 day production turnaround makes it practical to order for groups of any size. Contact us for quantity pricing on orders of 25 or more pieces.
How do I choose between an achievement trophy and an achievement medal?
Trophies make a stronger visual impression and are well suited for individual honorees, top performers, and award ceremony centerpieces. Medals are a practical choice when recognizing a larger group. They are easy to distribute, wearable for immediate presentation, and available in gold, silver, and bronze to tier recognition levels within one program.
]]>
Achievement
custom-pageschool-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:22%,50:30%,100:40%,500:46%"School Pins" "School Lapel Pins"Find these popular Achievement HP Series Award Pins Discounted at TrophyCentral. Fast 1-2 Days Shipping. Buy in Bulk and Save!ho0406-15-2012General11Discover the perfect achievement trophies and awards! From star trophies to Oscar-style recognition, find creative achievement awards that celebrate victories, milestones, and personal accomplishments.11Acme Home Page From TrophyCentral.1custom-pageglass-crystal-awards1general410187-101Trophies1:22%,25:24%Find This Acrobat Glass Art Award Discounted at TrophyCentral. Price Includes Engraving and Gift Box!Leadershipcustom-pageacrylicawards11"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"general105503-610.451515.45Classic MedallicsCrystal Awards1:30%Shop for Acrylic Arrowhead Trophy from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.Generalcustom-pagebaseballdisplay111"3-5 business days" "Tamarac, Florida" "UPS (FedEx available on request)"display case333213-51 3 22 230.45112.45Case WorksDisplay Cases11:14%"Sports Display Case" "Sports Displays" "Sports Display" "Sports Display Cases" "Sport Display Cases" "Acrylic Sports Display" "Acrylics Displays" "Acrylic Display Cases" "Sports Ball Holder" "Sports Ball Holders" "Baseball Holder" "Baseball Holders" "Baseball Display" "Baseball Cases" "Baseball Display Cases" "Baseball Display Case" "Baseball Card Cases" "Baseball Card Case" "Baseball Card Display" "Baseball Displays"Acrylic Baseball Bat Cube. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.12-20-2020Baseball / T-Ball, Sportscustom-pagebaseballdisplay111"3-4 business days" "Marquette, Michigan" "UPS"498552-410.451110.75Display Cases11:14%,25:27%"Sports Display Case" "Sports Displays" "Sports Display" "Sports Display Cases" "Sport Display Cases" "Acrylic Sports Display" "Acrylics Displays" "Acrylic Display Cases" "Sports Ball Holder" "Sports Ball Holders" "Baseball Holder" "Baseball Holders" "Baseball Display" "Baseball Cases" "Baseball Display Cases" "Baseball Display Case" "Baseball Card Cases" "Baseball Card Case" "Baseball Card Display" "Baseball Displays"Acrylic Baseball Bat Holder. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Baseball / T-Ball, Sportscustom-pagebaseballdisplay111"3-4 business days" "Marquette, Michigan" "UPS"498552-410.4528.45Case WorksDisplay Cases1:14%,2:29%"Sports Display Case" "Sports Displays" "Sports Display" "Sports Display Cases" "Sport Display Cases" "Acrylic Sports Display" "Acrylics Displays" "Acrylic Display Cases" "Sports Ball Holder" "Sports Ball Holders" "Baseball Holder" "Baseball Holders" "Baseball Display" "Baseball Cases" "Baseball Display Cases" "Baseball Display Case" "Baseball Card Cases" "Baseball Card Case" "Baseball Card Display" "Baseball Displays"Acrylic Baseball Holder / Display - 6 Pack. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Baseball / T-Ball, Sportscustom-pagetrophies-t-ball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.552418.55Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,50:29%Find These T-Ball Black Oval Awards Discounted At TrophyCentral. Price Includes Up to 4 Lines of Engraving!qttballacrBaseball / T-Ball, Sportscustom-pagecup-trophies-large-and-small11trophies105503-610.5511616.55Classic MedallicsTrophies1:22%Cupcustom-pageacrylicawards11"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"general105503-610.451525.45Classic MedallicsCrystal Awards1:22%Unique Flame Design Obelisk Acrylic Award with Free Engraving; Discounted Online!ac270custom-pagefootballdisplay111"3-4 business days" "Marquette, Michigan" "UPS"498552-410.45116.95Display Cases11:22%"Sports Display Case" "Sports Displays" "Sports Display" "Sports Display Cases" "Sport Display Cases" "Acrylic Sports Display" "Acrylics Displays" "Acrylic Display Cases" "Sports Ball Holder" "Sports Ball Holders" "Football Displays" "Football Holders" "Football Display Case" "Football Displays Cases" "Football Cases" "Football Display" "Football Display Cases" "Football Holder"Acrylic Football Display Case. Ideal for leagues, schools, and tournaments. Fast shipping.Football, Sportscustom-pagefootballdisplay111"3-4 business days" "Marquette, Michigan" "UPS"display case498552-410.451115Display Cases11"Sports Display Case" "Sports Displays" "Sports Display" "Sports Display Cases" "Sport Display Cases" "Acrylic Sports Display" "Acrylics Displays" "Acrylic Display Cases" "Sports Ball Holder" "Sports Ball Holders" "Football Displays" "Football Holders" "Football Display Case" "Football Displays Cases" "Football Cases" "Football Display" "Football Display Cases" "Football Holder"Acrylic Football Helmet Holder. Ideal for leagues, schools, and tournaments. Fast shipping.Football, Sportscustom-pagetrophies-golf1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.451515.45Classic MedallicsCrystal Awards1:30%"Hole-in-One Awards"Acrylic Golf Award. Ideal for leagues, schools, and tournaments. Fast shipping.Return to oursection for more great stories and choices.trophies-golfGolf, Sportscustom-pagefootballdisplay111display case498552-410.451111.65Display Cases11:14%Acrylic Helmet Holder: Acrylic Helmet Holder With Wood Basecustom-pagehockeypuckdisplays11"3-4 business days" "Marquette, Michigan" "UPS"498552-410.45126.80Display Cases1:14%,2:20%Hockey, Sportscustom-pagesoccerwaterbottles72"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14144016.8Glass AmericaPromotional ProductsSports / Water Bottles1:14%,1980:43%"Basketball Water Bottles" "Logo Sports Bottles" "Sports Bottles" "Promotional Sports Bottles" "Aluminum Sports Bottles" "Stainless Water Bottles" "Aluminum Water Bottles" "Bike Water Bottles" "Bicycle Water Bottles" "Baseball Water Bottles" "Football Water Bottles" "Promotional Water Bottles" "Soccer Water Bottles"Acrylic Ice-Up From TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.Sports / Water Bottlescustom-pagefootballdisplay111"3-4 business days" "Marquette, Michigan" "UPS"498552-411.01416.45Display Cases1:14%"Sports Display Case" "Sports Displays" "Sports Display" "Sports Display Cases" "Sport Display Cases" "Acrylic Sports Display" "Acrylics Displays" "Acrylic Display Cases" "Sports Ball Holder" "Sports Ball Holders" "Football Displays" "Football Holders" "Football Display Case" "Football Displays Cases" "Football Cases" "Football Display" "Football Display Cases" "Football Holder"custom-pageracingdisplays11"3-4 business days" "Marquette, Michigan" "UPS"498552-410.451816.45TrophyCentralDisplay Cases1:14%Racing, Sportscustom-pagebaseballdisplay111"3-4 business days" "Marquette, Michigan" "UPS"display case498552-410.45212.85Display Cases1:14%,2:18%"Sports Display Case" "Sports Displays" "Sports Display" "Sports Display Cases" "Sport Display Cases" "Acrylic Sports Display" "Acrylics Displays" "Acrylic Display Cases" "Sports Ball Holder" "Sports Ball Holders" "Baseball Holder" "Baseball Holders" "Baseball Display" "Baseball Cases" "Baseball Display Cases" "Baseball Display Case" "Baseball Card Cases" "Baseball Card Case" "Baseball Card Display" "Baseball Displays"Find this acrylic softball holder (six-pack) discounted at TrophyCentral. Fast 1-2 day shipping!Softball, Sportscustom-pagetrophycasesjerseyholdersoccerdisplayvolleydisplaytennisdisplaywallmountsoccerwallmountvolleyballbaseballdisplay1footballdisplay1hockeypuckdisplaysgolfballdisplayracingdisplaysbasketballdispaynoname1011"Personalized Gifts" "Retail Displays" "Retail Display Cases" "Retail Display" "Retail Cases" "Retail Store Display" "Retail Store Displays" "Retail Display Case"Display Cases for Sports and Collectables Whether you need one display case for a special ball, or several for your entire collection, we can help. Many of the items in the sections above are available with optional engraving.

Shop with Confidence at Trophy Central

Since 1999, Trophy Central has been serving customers with top-rated customer service. Please feel free to call us if you need any help and experience the Trophy Central difference!]]>
Sports Display Cases
custom-pagestar-trophies1"1-2 business days" "Marquette, MI" "UPS"trophies498552-310.451611.65Quick TrophyCrystal Awards1:14%"New Products"Find these fun Jade Acrylic Rising Star Awards Discounted at TrophyCentral. Free engraving!Starcustom-pagetrophies1trophies"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498551-3121820Trophies1Find These Acrylic Subject Imprint Awards Discounted At TrophyCentral. Features Stock Logo, Free Personalization And Fast 1-2 Day Shipping!acrylic-triangle-allcustom-pagetrophies-volunteer11acrylicawards1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-3111820JDS-STrophiesGeneral1:14%,10:19%Find This Unique Acrylic Triangle Award with Black Base Discounted At TrophyCentral. Price Includes Free Personalization! Ships From Factory in a Fast 1-2 Days!blankawardGeneralcustom-pagetrophies-academic1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451820JDS-STrophiesAcademic1:14%,10:19%Find This Unique Academic Acrylic Triangle Award Discounted At TrophyCentral. Price Includes Free personalization! Ships From Factory in a Fast 1-2 Days!qtacadtrAcademiccustom-pagetrophies-archery1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311820JDS-STrophiesSports, Hobby, Org, Livestock1:14%,10:19%Acrylic Archery Triangle Awards with Free Engraving from TrophyCentral.qtarchtrArchery, Sportscustom-pagetrophies-boxing1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311820JDS-STrophiesSports, Hobby, Org, Livestock1:14%,10:19%Acrylic Boxing Triangle Awards with Free Engraving from TrophyCentral.qtboxtrBoxingcustom-pagetrophies-cards-poker1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311820JDS-STrophiesSports, Hobby, Org, Livestock1:14%,10:19%Acrylic Cards Triangle Awards with Free Engraving from TrophyCentral.qtcardtrcustom-pagetrophies-disc-golf1"1-4 (typically 1-2) business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451820JDS-STrophiesSports, Hobby, Org, Livestock1:14%,10:19%Acrylic Triangle Award With Black Base - Disc Golf. Ideal for leagues, schools, and tournaments. Fast shipping.qtdisctrDisc Golfcustom-pagetrophies-downhill-skiing1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311820JDS-STrophiesSports, Hobby, Org, Livestock1:14%,10:19%Find This Unique Downhill Skiing Acrylic Triangle Award Discounted At TrophyCentral. Price Includes Free personalization! Ships From Factory in a Fast 1-2 Days!qtdowntrSkiing (Downhill), Sportscustom-pagetrophies-tennis1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451820JDS-STrophiesSports, Hobby, Org, Livestock1:14%,10:19%"Tennis Trophies" "Tennis Trophy" "Trophies, Tennis"Find This Unique Tennis Acrylic Triangle Award Discounted At TrophyCentral. Price Includes Free Engraving! Ships From Factory in a Fast 1-2 Days!qttennistrTennis, Sports11Shop for acrylic triangle trophies at TrophyCentral. Each acrylic triangle award includes engraving. Fast 1-2 day shipping!1Triangle Awards - Acrylic Each of the unique triangle trophies above features a shiny black back and an acrylic top. Choose from popular stock images, both academic and sports, or select our blank award and add your own image. If you need a general award, our Victory Torch is a great choice. All of our triangle awards include free engraving and most ship in just 1-2 business days. Remember, TrophyCentral offers free shipping on award orders over $100!]]>custom-pagetrophies-dance1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311820JDS-STrophiesMusic, Drama, Art, Dance1:14%,10:19%Acrylic Ballet Triangle Awards with Free Engraving from TrophyCentral.qtballtrDancecustom-pagetrophies-baseball1trophies498552-310.451820JDS-STrophiesSports, Hobby, Org, Livestock1Acrylic Triangle Baseball Award. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Baseball / T-Ball, Sportscustom-pagetrophies-basketball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451820JDS-STrophiesSports, Hobby, Org, Livestock1:14%,10:19%Acrylic Triangle Basketball Award With Black Base. Ideal for leagues, schools, and tournaments. Fast shipping.qtbasktrBasketball, Sportscustom-pagetrophies-bowling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451820JDS-STrophiesSports, Hobby, Org, Livestock1:14%,10:19%"Bowling Trophies" "Trophies, Bowling" "Bowling Trophy"Acrylic Bowling Triangle Awards with Free Engraving from TrophyCentral. Fast 1-2 Day Shipping!qtbowltrBowlingcustom-pagetrophies-cheerleading-spirit1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311820JDS-STrophiesSports, Hobby, Org, Livestock1:14%,10:19%qtcheertrCheerleading, Sportscustom-pagetrophies-bicycle-cycling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311820JDS-STrophiesSports, Hobby, Org, Livestock1:14%,10:19%Find This Unique Cycling Acrylic Triangle Award Discounted At TrophyCentral. Price Includes Free Engraving! Ships From Factory in a Fast 1-2 Days!qtbictrReturn to oursection to see our complete selection.trophies-bicycle-cyclingBicycling / Cycling, Sportscustom-pagetrophies-equestrian-horse1"1-4 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451820JDS-STrophiesSports, Hobby, Org, Livestock1:14%,10:19%Find This Unique Equestrian / Horse Acrylic Triangle Award Discounted At TrophyCentral. Price Includes Free personalization! Ships From Factory in a Fast 1-2 Days!qtequesttrEquestrian, Sportscustom-pagetrophies-football1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451820JDS-STrophiesSports, Hobby, Org, Livestock1:14%,10:19%Acrylic Triangle Award With Black Base - Football. Ideal for leagues, schools, and tournaments. Fast shipping.qtfoottrSee more greatin a large variety of styles and sizes.trophies-footballFootball, Sportscustom-pagetrophies-golf1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451820JDS-STrophiesSports, Hobby, Org, Livestock1:14%,10:19%Acrylic Triangle Golf Award With Black Base - Golf. Ideal for leagues, schools, and tournaments. Fast shipping.qtgolftrGolf, Sportscustom-pagequickshiptrophies-graduate1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311820JDS-STrophiesAcademic1:14%,10:19%Find This Unique Graduate / Graduation Acrylic Triangle Award Discounted At TrophyCentral. Price Includes Free Engraving! Ships From Factory in a Fast 1-2 Days!qtgradtrGraduation, Academiccustom-pagetrophies-ice-hockey1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451820JDS-STrophiesSports, Hobby, Org, Livestock1:14%,10:19%"Hockey Trophies" "Ice Hockey Trophies" "Hockey Trophy" "Ice Hockey Trophy"Find This Unique Hockey Acrylic Triangle Award Discounted At TrophyCentral. Price Includes Free personalization! Ships From Factory in a Fast 1-2 Days!qthocktrHockey, Sportscustom-pagetrophies-music1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451820JDS-STrophiesMusic, Drama, Art, Dance1:14%,10:19%Find This Unique Music Acrylic Triangle Award Discounted At TrophyCentral. Price Includes Free personalization! Ships From Factory in a Fast 1-2 Days!qtmusictrMusic / Band / Choruscustom-pagetrophies-pinewood-derby-scouts1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311820JDS-STrophiesAcademic1:14%,10:19%Find This Unique Pinewood Derby Acrylic Award Discounted At TrophyCentral. Price Includes Free personalization! Ships From Factory in a Fast 1-2 Days!qtpinetrPinewood Derbycustom-pagetrophies-soccer1trophies498552-311820JDS-STrophiesSports, Hobby, Org, Livestock1Acrylic Triangle Soccer Award With Black Base. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagetrophies-softball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451820JDS-STrophiesSports, Hobby, Org, Livestock1:14%,10:19%"Softball Trophies" "Softball Trophy" "Trophies, Softball"Acrylic Softball Triangle Awards with Free Engraving from TrophyCentral.qtsofttrNot what you want? See more greatin a large choice of styles and sizes.trophies-softballSoftball, Sportscustom-pagetrophies-swimming-diving1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451820JDS-STrophiesSports, Hobby, Org, Livestock1:14%,10:19%Acrylic Swimming Triangle Awards with Free Engraving from TrophyCentral.qtswimtrSwimming / Diving, Sportscustom-pagetrophies-track-field1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311820JDS-STrophiesSports, Hobby, Org, Livestock1:14%,10:19%Acrylic Track Triangle Awards with Free Engraving from TrophyCentral.qttracktrcustom-pagetrophies-victory1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311820JDS-STrophiesGeneral1:14%,10:19%Acrylic Victory Triangle Awards with Free Engraving from TrophyCentral.qtvicttrGeneralcustom-pagetrophies-volleyball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451820JDS-STrophiesSports, Hobby, Org, Livestock1:14%,10:19%Acrylic Volleyball Triangle Awards with Free Engraving from TrophyCentral.qtvollytrVolleyball, Sportscustom-pagetrophiesblankawardmirage5x7acrylicmirage4x6acrylicmirage3x5acrylicac269ac266ac268ac265starawardqteaglebrassacrylicovalacrylicac267ac2701trophies1Find a great selection of acrylic awards and trophies discounted at TrophyCentral. Each acrylic award includes up to three lines of free personalization. Shop Custom Acrylic Trophies and Awards with Ease

Find custom acrylic trophies and awards for corporate events, employee recognition, academic honors, sales achievements, sports banquets, and special celebrations. Each acrylic trophy award in this section includes free engraving and a gift box, with optional logo engraving available on many styles.

Choose from a variety of acrylic trophy shapes, sizes, colors, and price points. Many items ship quickly, and our team is happy to help if you need guidance choosing the right acrylic award for your event.

Frequently Asked Questions

What are acrylic trophies and awards?

Acrylic trophies and awards are personalized recognition pieces made from durable acrylic material. They offer a clear, modern look similar to glass or crystal, but are often lighter and more affordable.

Can acrylic trophies be engraved?

Yes. Acrylic trophies can be engraved with names, award titles, dates, messages, and logos on many styles. Free engraving is included on acrylic awards in this section.

How quickly do custom acrylic awards ship?

Many acrylic awards ship within 1 to 2 business days, while some custom styles may take 3 to 5 business days. Expedited shipping options are available when timing is important.

Do acrylic awards come in different sizes and styles?

Yes. Acrylic awards are available in many shapes, sizes, colors, and designs, including clear acrylic, blue acrylic, gold-accented acrylic, jade-style acrylic, and modern geometric styles.

What other award options are available?

TrophyCentral also offers crystal awards, award plaques, and traditional trophies for events that need a different style of recognition.

]]>
Business, Generalglass-crystal-awards
11custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality Adjutant GENERAL Corps Inserts (Etched, 515409) at TrophyCentral. Each Adjutant GENERAL Corps Inserts (Etched, 515409) can be used to create a unique plaque, medal or trophy.515409Military, Hero
custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality Adjutant GENERAL Corps Inserts (Etched, 517511) at TrophyCentral. Each Adjutant GENERAL Corps Inserts (Etched, 517511) can be used to create a unique plaque, medal or trophy.517511Military, Hero
custom-pageglass-crystal-awards1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"general410187-1010.45424.45JcharlesCrystal Awards1:22%,25:24%"crystal awards" "Retirement Awards" "Retirement Plaques, Awards and Gifts"The Aeroscape Crystal Art Award features an artistic oblong design with a blue inner sculpture. Available in two sizes, personalization is free!Leadershipcustom-pagefreeawardcertificates1"Download Only"certificates49855011TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Agriculture Award template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Agriculture-Award-Certificateagriculture-award-freeAgriculturecustom-pageaward-ribbons-rosettes11"5-7 business days" "Topeka, Indiana" "UPS (Priority Mail also available)"ribbons465712-141 260.4620016.46Tower RibbonRibbonsAwareness Ribbons1:22%,50:36%"Customized Ribbons" "Pink Ribbons" "Red Ribbons"Find Aids Ribbons discounted at TrophyCentral. Each red aids ribbon features choice of backing and optional imprint.aidsribbonsAidscustom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality Air Combat Command Inserts at TrophyCentral. Each Air Combat Command Insert can be used to create a unique plaque, medal or trophy.518136Military, Hero
custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality Air Education Training Command Inserts at TrophyCentral. Each Air Education Training Command Insert can be used to create a unique plaque, medal or trophy.518193Military, Hero
custom-pagetrophies-military-hero1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511230.45Classic MedallicsTrophiesHero1:22%,6:23%,12:24%,24:26%"Hero Awards"Shop for Cast Stone Air Force Emblem Awards at TrophyCentral. We have a great selection of Air Force Emblem and other recognition trophies at discounted prices.tr9929Military, Air Force, Herocustom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality Air Force Reserve Inserts at TrophyCentral. Each Air Force Reserve Insert can be used to create a unique plaque, medal or trophy.515303Military, Hero
custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality Air Force ROTC Inserts at TrophyCentral. Each Air Force ROTC Insert can be used to create a unique plaque, medal or trophy.514069Military, Hero, Air Force
custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality Air Mobility Command Inserts at TrophyCentral. Each Air Mobility Command Insert can be used to create a unique plaque, medal or trophy.518140Military, Hero
custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality Air National Guard Inserts at TrophyCentral. Each Air National Guard Insert can be used to create a unique plaque, medal or trophy.514068Military, Hero
custom-pagecustommedals50"4-6 business days" "Mount Vernon, NY" "UPS"medals105502-50.75130033.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,100:33%,300:41%Find these fabulous Personalized All Sport Front Imprint Medals at TrophyCentral. Price includes the name of your school or organization imprinted on the front of the medal!m163Sportscustom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-31130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality All Sports Female Inserts (Litho) at TrophyCentral. Each All Sports Female Insert can be used to create a unique plaque, medal or trophy.506681sports
custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-31130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality All Sports Inserts (Litho) at TrophyCentral. Each All Sports Insert can be used to create a unique plaque, medal or trophy.497833Sports
custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-31130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality All Sports Male Inserts (Litho) at TrophyCentral. Each All Sports Male Insert can be used to create a unique plaque, medal or trophy.504581Sports
custom-pageall-star-trophies20trophies498551-30.5100021TrophyCentralInsertsSports, Hobby, Org, Livestock1Find this colorful All Star 2" Epoxy-covered insert discounted at TrophyCentral. Fast 1-2 day shipping.All Starcustom-pageall-star-trophies1medals498551-31.520033TrophyCentralMedalsSports, Hobby, Org, Livestock1Find these All Star Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.All Starcustom-pageall-star-trophies1trophies498551-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a All Star insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.All Starcustom-pageall-star-trophies1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our All Star single column insert trophy features a choice of column color, a marble base and free trophy engraving.All Starcustom-pageall-star-trophies1trophies498551-310.71217.38Trophies1All Starcustom-pageall-star-trophies1medals498551-31.520033TrophyCentralMedalsSports, Hobby, Org, Livestock1Find these All Star Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.All Starcustom-pageall-star-trophies1medals498551-30.525035.5TrophyCentralMedalsSports, Hobby, Org, Livestock1Find this colorful All Star insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.All Starcustom-pageall-star-trophies1medals498551-30.525035.5TrophyCentralMedalsSports, Hobby, Org, Livestock1Find this All Star insert medal with a personalized front rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.All Starcustom-pageall-star-trophies1plaques498551-311.11623.5TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these All Star insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.All Starcustom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these high-quality All Star Inserts at TrophyCentral. Each All Star Insert can be used to create a unique plaque, medal or trophy.518215All Star
11Find All Star medals discounted at TrophyCentral Each medal features a free neck ribbon. Fast 1-2 day shipping.all-star-trophiesAll Starcustom-pageall-star-trophies1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our all-star insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.All Starcustom-pagesports-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsSports, Hobby, Org, Livestock1:22%,50:30%,100:33%,500:47%"Baseball Pins" "Baseball Lapel Pins" "Soccer Pins" "Soccer Lapel Pins" "Football Pins" "Football Lapel Pins" "Basketball Pins" "Basketball Lapel Pins"ALL STAR - Color Letter Pins: EC Series ALL STAR - Color Lapel Pins feature a high-quality enameled finish and ship in just 1-2 business days!ec22Sportscustom-pageall-star-trophies1medals498551-31.520033TrophyCentralMedalsSports, Hobby, Org, Livestock1Find these All Star Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.All Starcustom-pageaward-medalsall-star-part-iall-star-single-iall-star-champ-iall-star-e-part-iall-star-e-single-iall-star-plaque-icup-all-star-scb-iall-star-jigfall-star-jisfall-star-jibfall-star-mcall-star-mc-pr1achievement-trophies-awards1Find All Star trophies discounted at TrophyCentral. Choose from a variety of sizes and styles. Each All Star Trophy features 3 lines of personalization. Order Your All Star Trophy Today

Browse our complete collection of All Star trophies and find the perfect award for your next sports banquet or end-of-season celebration. Each trophy includes free engraving, fast shipping, and our 100% satisfaction guarantee. For individual achievement recognition, also check out our Star Trophies collection including Star Performer and Rising Star awards.

]]>
trophies All Star
custom-pagesoccerwaterbottles51060510765107051079510849906099084990709907672670726767267972684726857268811"Basketball Water Bottles" "Logo Sports Bottles" "Sports Bottles" "Promotional Sports Bottles" "Aluminum Sports Bottles" "Stainless Water Bottles" "Aluminum Water Bottles" "Bike Water Bottles" "Bicycle Water Bottles" "Baseball Water Bottles" "Football Water Bottles" "Promotional Water Bottles" "Soccer Water Bottles"Find aluminum water bottles discounted at TrophyCentral. Each aluminum sports bottle includes personalization!

Shop for Custom Water Bottles with Confidence at TrophyCentral

We offer a huge selection, discounted prices and free shipping on orders for trophies, awards and top-rated customer service. Do you need help with some ideas or with ordering? Yes, we sell online, but we have real people who would love to help you! Feel free to call our customer service experts in Michigan, New York and online. TrophyCentral - delivering smiles since 1999!


]]>
custom-pagegeneral-corporate-awards1"14 business days" "Erlanger, KY" "UPS"general410187-1010.451 2 3 4 5 6 7 8 9436.45JcharlesTrophies1:22%,25:25%Classic in shape, our Ambient Corporate Award is anything but old-fashioned due to its contemporary etched patterns and use of cool colors.custom-pagemedallion-inserts-general-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"513051Flags
custom-pagemedallion-inserts-general-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"512931Flags
custom-pagemedallion-inserts-general-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"512911Flags
custom-pagemedallion-inserts-general-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"513421Flags
custom-pagemedallion-inserts-general-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"512341Flags
custom-pagemedallion-inserts-organizations12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these high-quality American Cancer Society Inserts at TrophyCentral. Each American Cancer Society Insert can be used to create a unique plaque, medal or trophy.51355112-20-2020
custom-pagegeneral-corporate-awards1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511230.45Classic MedallicsTrophiesHero1:22%,6:23%,12:24%,24:26%Shop for Cast Stone American Eagle Awards at TrophyCentral. We have a great selection of American Eagle and other recognition trophies at discounted prices.tr9932Generalcustom-pageflaglapelpins110"1-3 business days" "Marquette, Michigan" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins498552-30.3150030Trophy CentralLapel PinsHero1:30%,25:34%,100:37%,500:41%"Flag Pin Section" "Flag Lapel Pins" "Lapel Pins - Flag" "Discount Flag Pins" "Cheap Flag Pins" "Flag Pins Cheap" "Buy Flag Pins" "Shop For Flag Pins" "U.S. Flag Pins" "American Flag Pins" "Flag Pins US" "Flag Pins American" "Hero Pins"Find this Waving Flag Pin discounted at TrophyCentral. Features a clutch back and ships in just 1-2 business days.flagpins101-15-2011

TrophyCentral carries a large selection of flag pins, stock lapel pins and custom pins. If you do not see what you want, please use the search feature on top of the left-navigation bar or call us at 1-888-809-8800.]]>
custom-pageflaglapelpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsHero1:22%,50:30%,100:38%,500:58%"Flag Pin Section" "Flag Lapel Pins" "Lapel Pins - Flag" "Discount Flag Pins" "Cheap Flag Pins" "Flag Pins Cheap" "Buy Flag Pins" "Shop For Flag Pins"amjaflpin01-15-2011Flagcustom-pagetrophies-military-hero1"10 business days" "Aliquippa, PA" "UPS"trophies1500110-1410.451236.45Glass AmericaCrystal Awards1:22%,10:25%American Pride From TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.12-20-2020custom-pagemedallion-inserts-organizations12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these high-quality American Red Cross Inserts at TrophyCentral. Each American Red Cross Insert can be used to create a unique plaque, medal or trophy.517084
custom-pagemedallion-inserts-organizations12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these high-quality American Rescue Dog Association Inserts at TrophyCentral. Each American Rescue Dog Association Insert can be used to create a unique plaque, medal or trophy.518478
custom-pageperplaq11"7-10 business days w/engraving" "Chicago, Illinois" "UPS (FedEx available on request)"perpetual plaques606307-101 3 230.6524.45RS OwensPlaques1:22%custom-pageaward-ribbons-rosettes1"5-7 business days" "Topeka, Indiana" "UPS (Priority Mail also available)"ribbons465712-141 260.468024.46Tower RibbonRibbonsAwareness Ribbons1:22%,50:36%Buy Purple Domestic Abuse Ribbons at TrophyCentral. Each Domestic Abuse / Animal Abuse Ribbon Features A Tape Or Pin Back And Is Available With Optional Imprinting.anabuawareShop for Animal Abuse Ribbons with Ease at TrophyCentral TrophyCentral has a wonderful selection, discounted and bulk pricing and top-rated customer service. Each purple awareness ribbon comes with a tape or pin back and is available with optional imprinting.]]>Animal Abuse, Domestic Violencecustom-pagetrophies-honor-roll-society12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105502-50.37115016.87Classic MedallicsMedalsAcademic1:22%,25:24%,50:30%,100:36%,500:42%Find this antique brass honor roll medal at TrophyCentral. Also see our other great honor roll and honor society awards. Fast shipping!Antique Brass Honor Roll MedalSee all of our greatin a variety of styles.honorrollmedals
custom-pagetrophies-ice-hockey11"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"medals498852-30.3716021.6Quick TrophyMedalsSports, Hobby, Org, Livestock1:14%,10:25%,100:36%"Hockey Awards" "Ice Hockey Awards" "Award Medals - All Subjects" "Sports Medals"Find these Antique Series Hockey Medals Discounted at TrophyCentral. Include Neck Ribbon and Ships in Just 1-2 Business Days!hockeyHockey, Sportscustom-pagetrophies-football11"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"medals498852-30.3716021.6Quick TrophyMedalsSports, Hobby, Org, Livestock1:14%,10:25%,100:36%"Football Medals" "Football Awards" "Award Medals - All Subjects" "Sports Medals"Antique Series Medals - Football. Ideal for leagues, schools, and tournaments. Fast shipping.football1Be sure to see all of our greatin a large variety of finishes and styles.footballmedalsFootball, Sportscustom-page1st-place-medals11qushcume medals1 medals2 insertmedals"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"medals498852-30.3716021.6Quick TrophyMedalsSports, Hobby, Org, Livestock1:14%,10:25%,100:36%"Achievement / General Medals" "General Recognition Awards" "Award Medals - All Subjects" "General Award Medals"Find these Victory Torch Antique Series Medals Discounted at TrophyCentral. Include Neck Ribbon and Ships in Just 1-2 Business Days!victorymedalsReturn to our mainsection for more wonderful choices!award-medalsGeneralcustom-pagetrophies-volleyball11"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"medals498852-30.3716021.6Quick TrophyMedalsSports, Hobby, Org, Livestock1:14%,10:25%,100:36%"Volleyball Awards" "Award Medals - All Subjects" "Sports Medals""Volleyball Awards" "Volleyball Medals"Find these Volleyball Antique Series Medals Discounted at TrophyCentral. Include Neck Ribbon and Ships in Just 1-2 Business Days!voVolleyball, Sportscustom-pagetrophies-wrestling11"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"medals498852-30.3716021.6Quick TrophyMedalsSports, Hobby, Org, Livestock1:14%,10:25%,100:36%"Wrestling Awards" "Award Medals - All Subjects" "Sports Medals"Find these Antique Series Medals with a Wrestling Design Discounted at TrophyCentral. Include Neck Ribbon and Ships in Just 1-2 Business Days!Wrestling, Sportscustom-pagehonorrollpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:22%,50:28%,100:32%,500:42%"Honor Roll" "Honor Roll Pins" "Honor Roll Trophies" "School Pins"Find honor pins at TrophyCentral. Each AP Series Honor pin includes a clutch back. Bulk discounts.ap05See our completesection for our industry-leading selection!lapel-award-pinsHonor Roll, Academicplasticpinboxvelapinbox1"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"105502-31150030lapel-award-pins1"School Pins" "Spelling Pins and Medals" "Spelling Medals and Pins"Find AP Series pins at TrophyCentral. Each AP Series AP Series pin includes a clutch back.1ap-pins-allcustom-pagebr584plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:22%,50:28%,100:32%,500:42%"Science Awards" "School Pins"This AP Series pin with a science design ships from New York. Features a clutch back for easy attachment to clothing.ap7807-25-2011Sciencecustom-pagecitizenship-awardsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:22%,50:28%,100:32%,500:42%"School Pins" "School Lapel Pins"Find these popular Citizenship AP Series Lapel Pins discounted at TrophyCentral. Fast 1-2 day shipping!ap67Citizenshipcustom-pageglass-crystal-awards1"1-2 business days" "Marquette, MI" "UPS"general498852-310.45822Quick TrophyCrystal Awards1:14%"New Products"Apex Glass Awards From TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.Leadershipcustom-pagekeychains21105502-40.39125035.39Classic MedallicsGiftsKeychains1:22%,10:25%,25:32%,50:39%,100:47%"School Awards"pk100-cmKeychains, Teacher's Award, Academic (Teacher)custom-pageteacher-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"Find Apple shaped pins discounted at TrophyCentral. Each apple pin features a clutch back and is perfect for your favorite teacher.br30305-15-2012Teacher's Awardcustom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceSealsEmbosser Seals1:22%,3:28%,5:31%Find these Apple (Die Cut) Embossed Certificate Seals discounted at TrophyCentral.803daGeneralcustom-pagename-badges-tagswoyoulipr100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoName Badges1Find These Custom Apple Shaped Badges Discounted At TrophyCentral.namebadges-applecustom-pagefreeawardcertificates17012 912"Download Only"free-appreciation49855011TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"See this Appreciation Certificate designed exclusively for TrophyCentral! Appreciation Certificates can be downloaded for free! Each appreciation certificate measures 11 x 8 1/2 inches.apprecfrAppreciation, Thank Youcustom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsGeneral1:22%Buy these high-quality Appreciation Flowers Inserts at TrophyCentral. Each Appreciation Flowers Insert can be used to create a unique plaque, medal or trophy.518206General, Thank You, Volunteer, Wedding, Fundraising, Appreciation
custom-pageteacher-appreciation1plaques498552-41JDSPlaques1Appreciationcustom-pagegeneral-corporate-awards11"7-10 business days w/engraving" "Kentucky" "UPS (FedEx available on request)"general410187-1010.45432.45JcharlesTrophies1:22%,25:24%"Crystal Trophies"Arabesque Crystal Trophies From TrophyCentral. Discounted Trophies, Awards and Promotional Products.custom-pageglass-crystal-awards1"1-2 business days" "Marquette, MI" "UPS"general498852-310.45823Quick TrophyCrystal Awards1:14%"New Products"Find this Arch Award discounted at TrophyCentral. Prices includes text etching. Fast shipping!Leadershipcustom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-31130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Archer Modern Male Inserts (Litho) at TrophyCentral. Each Archer Modern Male Insert can be used to create a unique plaque, medal or trophy.504321Archery, Sports
custom-pagetrophies-archery1trophies498551-310.452429Trophies1Find this popular Archery trophy discounted at TrophyCentral. Features a real marble base, stylish 4-inch gold cup, free engraving and fast shipping.archery-cup-place-trophycustom-pagetrophies-archery1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular archery figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!qtarchplSee our industry-leading selection of awards andtrophiesArchery, 1st / 2nd / 3rd / Etc., Sportscustom-pagetrophies-archery1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%This popular Archery Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!qtarchyrBe sure to see our complete selection oftrophiesArchery, Sportscustom-pagetrophies-archery1trophies498852-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with archery figure discounted at TrophyCentral. Includes free text engraving!cup-arch-pArchery, Sportscustom-pagefree-sports-templates1"Download Only"free-sports49855011TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Archery template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Archery-Certificatearchery-freeArchery, Sportscustom-pagetrophies-archery1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these archery budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtarchscbArchery, Sportscustom-pagetrophies-archery1498852-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Find this budget archery award trophy discounted at TrophyCentral. Features a real marble base and plastic archery figure. Engraving is free. Fast 1-2 day shipping.bdg-archeryArchery, Sportscustom-pagetrophies-archery1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous two-tier Archery Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtarchttArchery, Sportscustom-pagetrophies-archery1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.2115Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%Find this awesome Archery two tier championship trophy discounted at TrophyCentral. Add up to 3 lines of Free Personalization!qtarchttwArchery, Sportscustom-pagetrophies-archery1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:19%,50:26%,100:31%Find these popular Archery single column trophies discounted and with free personalization at TrophyCentral.qtarchscArchery, Sportscustom-pagetrophies-archery1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.05Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:19%Find This Popular Archery Deluxe Platform Series Trophy Discounted at TrophyCentral. Real Marble Base; Free Personalization!qtarchdmBe sure to see all of our fabulousandtrophies-archerytrophiesArchery, Sportscustom-pagetrophies-archery1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Archery figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-arch-scbArchery, Sportscustom-pagetrophies-archery1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.4118Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous two-tier, 3-column champion Archery Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtarch3cArchery, Sportscustom-pagetrophies-archery1"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498852-310.45811.6Quick TrophyPlaquesInsert1:14%,3:14%"Archery Awards"See this stunning Archery plaque and other Holographic Plaques at TrophyCentral.qsinplaqarcheryArchery, Sportscustom-pagetrophies-archery12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these high-quality Archery Inserts (Etched, 516088) at TrophyCentral. Each Archery GENERAL Inserts (Etched, 516088) can be used to create a unique plaque, medal or trophy.516088Archery, Sports
1trophies-archery1Shop for Archery Medals and Lapel Pins at TrophyCentral. Archery Medals and Pins Ship in Just 1-2 Days!Archery Medals If, on the other hand, you are looking for a budget-friendly alternative to trophies, our award medals are the perfect solution. Many archery medals come in gold, silver and bronze finishes and offer optional engraving to keep the price as low as possible. Be sure to check out our Economy Archery Medals and our unique 'Build Your Own' Medals. All of our medals include a neck ribbon, and many offer a choice of ribbon color. Without engraving, your order will typically ship in just 1-2 business days, so no need to worry if you have waited for the last minute. For something completely different, see our colorful Holographic Archery Plaque.

Shop with Confidence at TrophyCentral!

If you are looking to archery medals online, look no further! TrophyCentral has an industry-leading selection that will fit any budget, all at discounted prices. Our top-rated representatives are happy to assist you with all of your archery medal and award needs. Our experts in New York and Michigan have been providing suggestions and guidance since 1999! To find the perfect archery medal, click on an image above, or for personal service, call us toll-free at 1-888-809-8800.
]]>
trophies-archeryArchery
custom-pagetrophies-archery12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "Sports Medals" "Archery Medals"These inexpensive 1 1/4 inch Archery Medals offer a high quality, but low price for those on a tight budget.e907910-01-2016Archery, Sports
custom-pagetrophies-archery1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:38%Our popular Archery participation trophies feature a real slant-front marble base and free engraving.qtarchncSee ourand full selection oftrophies-archerytrophiesArchery, Sportscustom-pagetrophies-archery1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498852-311.41234Quick TrophyTrophiesPerpetual Trophies11:14%,3:15%,10:16%Find this Perpetual Series Trophy - ArcheryDiscounted at TrophyCentral. Each Trophy has enough room for 32 names. Ships in just 1-2 days.qtarchperpSee more greatin a variety of styles.trophies-archeryArchery, Sportscustom-pagetrophies-archery1trophies498551-310.452429Trophies1Find our Archery star column trophy discounted at TrophyCentral. Features a real marble base, 6 inch gold star-shaped column, free engraving and fast shipping.archery-star-column-trophycustom-pageaward-medalsqtarchncqtarchscqtarchyrqtarchplqtarchttqtarchttwqtarch3cqtarchtrqtarchdmqtarchperpmqtarchscbcup-arch-scbcup-arch-pbdg-archeryarchery-cup-place-column-trophyarchery-cup-place-trophyarchery-star-column-trophye9079qsinplaqarchery1trophies1"Sports Trophies"Find a great selection of Archery Trophies at TrophyCentral. Each Archery Trophy and Award includes free engraving. Archery medals include a ribbon.Archery Trophies & Awards for Every Achievement Level

TrophyCentral offers a wide selection of archery trophies, medals, and awards designed to recognize competitors and celebrate achievement at every level. From participation awards for beginner youth programs to impressive trophies for tournament champions, our collection ensures you will find the right award for every archer and every event.

Shop Archery Awards with Confidence at TrophyCentral

With over 2,300 five-star reviews and trusted by leagues and clubs since 1999, TrophyCentral delivers quality awards at guaranteed lowest prices. Every trophy includes free personalized engraving and most orders ship in just 1-2 business days. Free economy shipping is available on orders over $99. Explore our full collection of trophies and awards for even more designs and styles.

Frequently Asked Questions About Archery Trophies

What archery competitions and programs are these trophies suitable for?

Our archery trophies and awards are suitable for a wide range of events including indoor and outdoor archery tournaments, 3D archery competitions, youth league programs, archery club championships, recurve and compound bow competitions, and school and community archery programs at all skill levels.

Does engraving come included with archery trophies?

Yes, every archery trophy includes free personalized engraving at no extra cost. You can add the archer's name, club or team, competition name, and event details to create a meaningful award they will be proud to display.

Do you offer archery medals in addition to trophies?

Yes, we carry archery medals that make an excellent and affordable alternative to trophies, ideal for recognizing all participants in a tournament or league. Every archery medal includes a free neck ribbon, and optional engraving is also available.

How quickly will archery trophy orders ship?

Most archery trophy orders are processed and shipped within 1-2 business days, with same-day processing available on many orders placed early in the day. Free economy shipping is available on qualifying orders over $99, and expedited shipping options are available at checkout for time-sensitive events.
]]>
trophiesArchery
custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality Army Aviation Inserts at TrophyCentral. Each Army Aviation Insert can be used to create a unique plaque, medal or trophy.515410Military, Hero, Army
custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality Army Chaplin Corps Inserts at TrophyCentral. Each Army Chaplin Corps Insert can be used to create a unique plaque, medal or trophy.51754512-20-2020Military, Hero, Army
custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality Army Chemical Corps Inserts at TrophyCentral. Each Army Chemical Corps Insert can be used to create a unique plaque, medal or trophy.516025Military, Hero, Army
custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality Army Drill Sergeant Inserts at TrophyCentral. Each Army Drill Sergeant Insert can be used to create a unique plaque, medal or trophy.515207Military, Hero, Army
custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality Army Ordnance Corps Inserts (Etched, 515049) at TrophyCentral. Each Army Ordnance Corps Inserts (Etched, 515049) can be used to create a unique plaque, medal or trophy.515049Military, Hero, Army
custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality Army Ordnance Corps Inserts (Etched, 517523) at TrophyCentral. Each Army Ordnance Corps Inserts (Etched, 517523) can be used to create a unique plaque, medal or trophy.517523Military, Hero, Army
custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality Army Quarter Master Corps Inserts at TrophyCentral. Each Army Quarter Master Corps Insert can be used to create a unique plaque, medal or trophy.515038Military, Hero, Army
custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality Army Recruiting Service Inserts at TrophyCentral. Each Army Recruiting Service Insert can be used to create a unique plaque, medal or trophy.512761Military, Hero, Army
custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality Army ROTC Inserts at TrophyCentral. Each Army ROTC Insert can be used to create a unique plaque, medal or trophy.515643Military, Hero, Army
custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality Army Signal Corps Inserts at TrophyCentral. Each Army Signal Corps Insert can be used to create a unique plaque, medal or trophy.513771Military, Hero, Army
custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality Army Wide Air Defense Inserts at TrophyCentral. Each Army Wide Air Defense Insert can be used to create a unique plaque, medal or trophy.515412Military, Hero, Army
custom-pagemascot-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoName Badges1Find These Custom Arrowhead Badges Discounted At TrophyCentral.mascotbadges-arrowheadcustom-pageart-trophies1trophies498551-310.452429Trophies1Find this popular Art place trim insert trophy discounted at TrophyCentral. Features a real marble base, stylish 4-inch gold cup, free engraving and fast shipping.art-cup-place-trophy-icustom-pageart-medals1medals498551-30.5100021TrophyCentralInsertsSports, Hobby, Org, Livestock1Find this colorful Art 2" epoxy-covered insert sticker discounted at TrophyCentral. Fast 1-2 day shipping.Art, Academiccustom-pageinserts150740850499150124149767350286148980051606651819650739950313150312150446149766450660550739450447150495151298148976850494151782650261111Browse our large selection of Art and Music Inserts from TrophyCentral. Each 2" insert fits in a medal frame, plaque or trophy.1custom-pagefree-school-certificate-templates1"Download Only"certificates49855011TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"See this Art Certificate designed exclusively for TrophyCentral! Art Certificates can be downloaded for free! Each art certificate measures 11 x 8 1/2 inches.artistfrArt, Academiccustom-pageart-trophies1medals498551-31.520033TrophyCentralMedalsSports, Hobby, Org, Livestock1Find these Art epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Art, Academiccustom-pageawardcertificates11artistfr15artistfr 930 br279"1-3 business days" "Columbia, South Carolina; Marquette, Michigan" "UPS (FedEx available on request)"certificates290631-21 2 3 230.45100020.45Certificate SourceCertificatesAward Certificates1:22%,50:36%,100:40%Find these Art certificates discounted at TrophyCentral. Each Art certificate measures 8 1/2 x 11 inches and typically ships in 1-2 days.artawceArt, Academiccustom-pageart-trophies1trophies498551-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Art insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Art, Academiccustom-pageart-trophies1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Art single column insert trophy features a choice of column color, a marble base and free trophy engraving.Art, Academiccustom-pageart-trophies1trophies498551-311821.06TrophyCentralTrophies1Art, Academiccustom-pageart-trophies1trophies498551-310.71217.38Trophies1Art, Academiccustom-pageart-trophies1medals498551-31.520033TrophyCentralMedalsSports, Hobby, Org, Livestock1Find these Art epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Art, Academiccustom-pageart-trophies1medals498551-30.525035.5TrophyCentralMedalsSports, Hobby, Org, Livestock1Find this colorful Art insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Art, Academiccustom-pageart-trophies1medals498551-30.525035.5TrophyCentralMedalsSports, Hobby, Org, Livestock1Find this Art insert medal with a personalized front rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Art, Academiccustom-pageart-trophies1plaques498551-311.1Plaques1Find these Art insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Art, Academiccustom-pageart-medalsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:30%,50:32%,100:35%,500:39%"Art Lapel Pins" "Art Pins" "Art Awards"Find this Art lapel pin discounted at TrophyCentral. Each Art Lapel pin features a beautiful design and finish. Fast 1-2 day shipping.br475Art, Academicacademic-general-medals1creative-arts-medals1Find art medals in a variety of sizes and styles at TrophyCentral Each art medal features a free ribbon. Fast 1-2 day shipping. Recognize your art show winner, art student or artist now!Shop for Art Award Medals with Ease Our art medal awards are a perfect way to recognize art contest winners, art students or any budding artist. We have gold, silver and bronze medal frames for contests involve multiple place winners.]]>Artcustom-pagemedallion-inserts-arts-and-music-medallions12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-31130025Classic MedallicsInsertsMusic, Drama, Art, Dance1:22%"Award Medals" "Art / Dance / Drama Medals" "Award Medals - All Subjects" "Art Awards"Buy these quality Art Painting Sculpture Inserts (Litho) at TrophyCentral. Each Art Painting Sculpture Insert can be used to create a unique plaque, medal or trophy.507408Art, Academic
custom-pageart-trophies1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our art insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Art, Academiccustom-pageartawceplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsMusic, Drama, Art, Dance1:22%,50:32%,100:39%,500:46%"Art Lapel Pins" "Art Pins" "Art Awards"Find these Art Pins discounted at TrophyCentral. Each art lapel pin features a beautiful finish and clutch back for safe attachment to clothing.br27906-12-2010Art, Academiccustom-pageart-trophies1plaques498552-41JDSPlaques1Find this art plaque discounted at TrophyCentral. Our art plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Art, Academiccustom-pageart-trophies1medals498551-31.520033TrophyCentralMedalsSports, Hobby, Org, Livestock1Find these Art epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Art, Academiccustom-pageaward-medalsschooltrophies1351-819651-7826art-award-plaqueart-part-iart-single-iart-champ-iart-e-part-iart-e-single-iart-plaque-icup-art-scb-icup-art-inart-jigfart-jisfart-jibfart-mcart-mc-prartist-medal-tm9953ge9926art-cup-place-trophy-iart-cup-place-column-trophy-i1trophies1Stunning art trophies for students, schools, and competitions. Each art trophy and award includes free engraving. Art medals include a ribbon. Fast shipping!

Shop for Art Trophies and Awards with Confidence at TrophyCentral

We offer a huge selection, discounted prices and great customer service. Do you need help with some ideas or with ordering? Yes, we sell online, but we have real people who would love to help you! Feel free to call our customer service experts in Michigan, New York and online. TrophyCentral - delivering smiles since 1999!


]]>
art-trophiesArt
custom-pagemedallion-inserts-arts-and-music-medallions12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-31130025Classic MedallicsInsertsMusic, Drama, Art, Dance1:22%"Award Medals" "Art / Dance / Drama Medals" "Award Medals - All Subjects"504991Art, Academic
custom-pageask-trophy-expert11Medals, ribbons, certificates, pins, and small trophies make perfect budget-friendly awards for elementary students. Learn cost-effective recognition options.custom-pagetrophies-golf1"10 business days" "Aliquippa, PA" "UPS"trophies1500110-1410.45824.45Glass AmericaCrystal AwardsSports, Hobby, Org, Livestock1:22%,10:25%Ashford Golf Tower Award. Ideal for leagues, schools, and tournaments. Fast shipping.Golf, Sportscustom-pagetrophy-award-guidesexpert-resin-vs-crystal-trophiesexpert-trophy-delivery-timeexpert-add-perpetual-plaque-platesexpert-how-many-trophies-youth-teamexpert-trophy-engraving-wordingexpert-inexpensive-awards-young-childrenexpert-trophy-size-championship-vs-participationexpert-when-to-order-trophiesexpert-trophy-engraving-cost11Practical buying guidance from TrophyCentral's recognition specialists - trophy selection, sizing, timing, display cases, ribbons, pennants, and more. 25+ years of experience.custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality Association of The Army Inserts at TrophyCentral. Each Association of The Army Insert can be used to create a unique plaque, medal or trophy.517023Military, Hero
custom-pagetrophy-award-guides11Find great wording suggestions and ideas for your plaques. These are actual wording samples from our customer's orders.art-medals11Worksheet template for coaches writing athlete recommendations and award nominations. Turn your worksheet into powerful recommendation letters.custom-pagesporcer1certificates290631-31 2 3 230.45100020.45Certificate SourceCertificatesAward Certificates1:22%,25:24%,100:40%,500:50%Find These Printed Athletic Award At TrophyCentral. Each Athletic Award Measures 8 1/2 x 11.919Sportscustom-pageawardcertificates115"1-3 business days" "Columbia, South Carolina; Marquette, Michigan" "UPS (FedEx and Post Office Priority Mail may be available on request)"certificates290631-21 2 3 230.45100020.45Certificate SourceCertificatesAward Certificates1:22%,50:38%,100:42%Find these Attendance certificates discounted at TrophyCentral. Each Attendance certificate measures 8 1/2 x 11 inches and typically ships in 1-2 days.7002Attendance, Academiccustom-pageperfect-attendance-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:22%,50:30%,100:33%,500:42%"School Pins" "School Lapel Pins"Find Attendance pins at TrophyCentral. Each Attendance lapel pin includes a clutch back.ap71Academiccustom-pageperfect-attendance-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:22%,50:30%,100:33%,500:47%"School Pins" "School Lapel Pins"ATTENDANCE Letter Pins: EC Series ATTENDANCE Lapel Pins feature a high-quality enameled finish and ship in just 1-2 business days!ec73Academiccustom-pagekeychains21"1-3 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"105502-40.39125035.39Classic MedallicsGiftsGeneral Gifts1:22%,10:25%,25:32%,50:39%,100:47%Find these popular Pewter Attitude Is Everything Key Chains at TrophyCentral; discounted prices!pk62-cm12-19-2008Keychainscustom-pageaward-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic MedallicsMedalsGeneral1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "School Medals" "General Award Medals"These inexpensive 1 1/4 inch Attitude Medals offer a high quality, but low price for those on a tight budget.e918512-20-2020General, Business, Academic
custom-pagemedallion-inserts-general-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-31130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these quality Auto Antique Inserts (Litho) at TrophyCentral. Each Auto Antique Insert can be used to create a unique plaque, medal or trophy.505711
custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-31130025Classic MedallicsInsertsBusiness1:22%Buy these quality Auto Sales Inserts (Litho) at TrophyCentral. Each Auto Sales Insert can be used to create a unique plaque, medal or trophy.507156Occupations
custom-pagemedallion-inserts-general-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-31130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these quality Auto Victory GENERAL Inserts (Litho) at TrophyCentral. Each Auto Victory GENERAL Insert can be used to create a unique plaque, medal or trophy.495836
custom-pageglass-crystal-awards1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"general410187-1010.45636.45JcharlesCrystal Awards1:22%,25:25%Avante Awards from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.12-05-2014Generalcustom-pagelapel-award-pinsart-trophiescertificate-diploma-coverscitizenship-awardscuscerforembossed-sealsfreeawardcertificateshonor-roll-certificatestrophies-mathmotivational-stickersmusic-award-certificatesreading-certificatesawardcertificates1science-award-certificatessporcer10331034103510361038103910411042919700770037010703570507036909913907918920929932921926933928931940943961964941962942963969971984cefrfantasy-sports-certificatesgift-certificate-templatesdramafr1index1Find award certificates discounted at TrophyCentral. Each award certificate measures 8 1/2" x 11". Browse our huge selection now!certificates

Award Certificates - Recognize Every Achievement, Big and Small

Award certificates are one of the most versatile and cost-effective recognition tools available, making it affordable to honor every participant, student, athlete, and contributor at any scale without straining a program budget. From classroom teachers ordering photo-series school certificates in bulk to recognize every student who hit a reading milestone or earned honor roll, to league coordinators purchasing sports certificates for end-of-season banquets that celebrate every player and coach, from volunteer program directors presenting appreciation certificates at annual recognition events, to principals awarding student of the month and citizenship certificates at morning assemblies, quality award certificates give recipients a tangible, displayable record of their achievement that carries real meaning at home and at school. Our selection covers the full range of recognition needs: colorful school subject certificates printed on 60 lb. paper in standard 8.5 by 11 inch size ready to fill in by hand or printer, sports award certificates for individual and team recognition across dozens of sports and activities, diploma certificates for preschool, kindergarten, and school-year completion milestones, embossed gold and silver certificate seals that give any certificate an official and polished appearance, diploma covers for protecting and presenting graduation documents, free downloadable certificate templates for programs that prefer to print their own, and custom certificate options for organizations with specific branding or design requirements. Most certificate orders ship in 1 to 2 business days, making it easy to order close to your event date.

Frequently Asked Questions About Award Certificates

What is the difference between the certificate series and which should I choose?

Our standard school certificates feature colorful designs with illustrated borders and are printed on quality 60 lb. paper, making them an excellent value for classroom and school-wide recognition programs where you need to recognize large numbers of students affordably. Our photo-series certificates feature full-color photographic images that give them a more premium, eye-catching appearance suited to special recognition events and award ceremonies. Free printable templates are the right choice when you want to print your own certificates in unlimited quantities at no cost. Custom certificates are available for organizations that need their own logo, colors, or unique design. For most school and sports programs the standard or photo series certificates offer the best combination of quality, variety, and value.

Can I fill in certificates with a printer or do they need to be filled in by hand?

Most of our award certificates are designed to be filled in either by inkjet or laser printer or by hand, giving you flexibility based on how many certificates you need to complete and your available equipment. Printing with a laser or inkjet printer produces the cleanest, most consistent results and is especially practical when personalizing large batches with individual student or recipient names. Hand-filling works well for smaller quantities or when a printer is not available. The certificate product pages note whether printer compatibility applies to specific designs.

Do you offer bulk discounts on certificates for schools and organizations?

Yes, certificate pricing drops significantly with quantity, making it very affordable to recognize entire classrooms, grade levels, or program rosters. Teachers ordering certificates for a full class, league coordinators purchasing sports certificates for all participants across multiple teams, and schools buying end-of-year recognition certificates for all students all benefit from quantity pricing. Orders over $99 qualify for free economy shipping. Browse our free certificate templates if you need unlimited quantities at no cost.

If you need more information before deciding, see our expert resource section:
]]>
custom-pagelapel-award-pinsachievement-trophies-awardstrophies-archerytrophies-badmintontrophies-billiardstrophies-bmxtrophies-bocce-balltrophies-boxingtrophies-coachtrophies-crickettrophies-curlingtrophies-dartstrophies-disc-golftrophies-equestrian-horsetrophies-figure-skatingtrophies-hockey-goalietrophies-ice-hockeytrophies-lacrossetrophies-marksman-shooting-rifletrophies-motocrossracing-trophies-awardstrophies-racquetballtrophies-roller-hockeyrunning-trophiestrophies-sailing-boattrophies-skateboardingtrophies-snowboardingtrophies-snowmobiletorch-trophiestrophies-trap-skeet-shootingquickshiptrophies-goatresin-trophiestr-resin-trophiestrophies-funny-horses-reartrophies-livestock-farm-animalsreligioustrophiestrophies-volunteerteacher-appreciationtrophies-military-heroart-trophiescitizenship-awardsdebate-trophiestrophies-mascotperfect-attendance-awardsschooltrophies14schooltrophies18trophies-beauty-queeninsert-trophies-awardstrophies-generalstar-trophiesplace-trophiestrophies-victoryall-star-trophiesmvp-trophiestrophies-family-reunionhorseshoescounty-fair-awardstrophies-cards-pokertrophies-paintballtrophies-pinewood-derby-scoutsacademic-general-medalsachievement-medalsblank-medalscustommedalseagle-medalsfishing-medalsinserts1mascot-medalsattendance-medals-pinsracing-medalsskiingmedalsvolunteer-medalsmedals-generale9196e9163e9292e9858e9988e9211e9993e9020j9075e9082e9208e9301e9185e90811index1award-medals

Award Medals - Meaningful Recognition for Every Achievement

Award medals represent centuries of tradition in honoring exceptional performance, transforming individual accomplishments into tangible symbols of success that recipients display with pride. From youth sports leagues and academic competitions to corporate recognition programs and volunteer appreciation ceremonies, quality medals combine affordable pricing with lasting impact through durable metal construction, vibrant finishes, and personalized engraving. Each medal includes complimentary neck ribbons available in traditional red, white, and blue or customizable colors matching organizational branding, plus free engraving accommodating participant names, achievement details, dates, and event information. Choose from economical 1.25-inch budget medals perfect for large participation programs to prestigious 2.75-inch premium medallions befitting championship achievements, with gold, silver, and bronze finishes instantly communicating placement hierarchy. Whether recognizing first place finalists, academic excellence, volunteer dedication, employee milestones, or team participation, award medals deliver powerful motivation while honoring the dedication behind every success story across schools, businesses, nonprofits, athletic organizations, and community groups nationwide.

Engraved Medals - Personalize the Back with Names, Dates, and More

Optional engraving on the back of any medal transforms a quality award into a personalized keepsake that connects the recipient directly to their achievement. Add a recipient name, event title, placement, date, or any combination of details that captures the moment, from a simple First Place, Metro Soccer League, 2025 to a more complete record of the accomplishment. Back engraving works alongside the medal's front design rather than replacing it, pairing sport-specific or achievement imagery on the front with personal details on the back for a complete, meaningful award. For organizations that want their own logo, artwork, or event name on the front of the medal itself, see our fully customizable medals where the entire medal face can be designed around your brand or event.

Expand your recognition program: Explore Achievement Medals and Explore Academic Medals for specialized recognition options. Learn more: History and Tradition of Award Medals.

Frequently Asked Questions About Award Medals

How do I select the right medal size and style for different event types?

Medal selection depends on event scale, participant age, and recognition significance. For youth participation events, recreational leagues, and large-scale programs needing cost efficiency, 1.25-inch economy medals deliver maximum value while still providing meaningful recognition children eagerly anticipate receiving. Mid-range 2-inch insert medals featuring sport-specific or achievement-themed designs work beautifully for competitive tournaments, academic competitions, and volunteer recognition where participants expect substantial awards reflecting their effort investment. Premium 2.5-inch to 2.75-inch medallions with detailed relief designs, substantial weight, and elegant presentations suit championship events, year-end awards, employee milestone recognition, and distinguished achievement programs where recipients treasure medals as career highlights. Consider implementing medal hierarchies using gold for first place or highest achievement, silver for second place or honor roll, and bronze for third place or participant recognition, creating clear visual distinction while accommodating diverse achievement levels within single ceremonies.

What engraving information creates the most meaningful personalized medals?

Strategic engraving transforms generic awards into cherished personal achievements. Essential elements include recipient name, specific achievement or placement, organization or event name, and date. Effective examples include: Marcus Rivera, First Place, District Science Fair, April 2025 or Jennifer Walsh, Employee of the Year, TechCorp Solutions, 2025. Sports medals benefit from including division or age group like Under-12 Soccer Champion or Varsity Track MVP. Academic medals gain impact through specificity such as Mathematics Excellence or Principal's List Scholar. Corporate recognition medals should note milestone details like 10 Years of Dedicated Service or Sales Leader Q4. Volunteer medals become more meaningful with context like 500 Hours Community Service or Habitat for Humanity Build Champion. Premium medals accommodate extended engraving including motivational phrases, organizational mottos, or multiple achievement years, while budget medals work best with concise essential information maximizing readability within limited engraving space constraints.

When should organizations use medals versus trophies, plaques, or certificates?

Strategic award selection maximizes impact while respecting budget realities. Medals excel for immediate presentation ceremonies where recipients want wearable recognition, multi-tier recognition systems acknowledging numerous participants, traveling competitions requiring portable awards, and youth programs where tangible rewards create lasting excitement. Their affordability enables recognizing entire teams, large student groups, or volunteer cohorts without prohibitive costs. Certificates complement medals perfectly for acknowledging all participants in mass recognition scenarios like honor roll assemblies, field day events, or workshop completions while reserving medals for standout achievements. Trophies suit individual or small team championship recognition, perpetual awards remaining with organizations, and display-focused recognition like employee of the month or academic department awards where desk or shelf presentation matters. Plaques work best for wall-mounted permanent recognition, corporate milestone acknowledgments, retirement tributes, and prestigious individual honors emphasizing gravitas over portability. Combining awards strategically certificates for all participants, medals for competitive placings, trophies for champions delivers comprehensive recognition across achievement levels while maintaining financial sustainability.

Be sure to see our expert medal and award guides: ]]>
custom-pagefreeawardcertificates1"Download Only"certificates49855011TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Certificate of Completion template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Certificate-of-Completion-Certificatecertificate-of-completion-freeCompletion, Achievementcustom-pagefreeawardcertificates1"Download Only"free-certificates49855011TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Certificate of Completion Award template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Certificate-of-Completioncompletion-freeCompletion, Achievementcustom-pagecorporatepinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsBusiness1:30%,50:32%,100:35%,500:39%Find this Award Of Excellence Pin at TrophyCentral. Award Of Excellence and other pins ship in just 1-2 business days!br309Businesscustom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsGeneral1:22%Buy these high-quality Award Of Excellence Inserts at TrophyCentral. Each Award Of Excellence Insert can be used to create a unique plaque, medal or trophy.518185General, Excellence
custom-pagewalnut-insert-plaques1"3-6 business days with engraving, Without engraving: 1-3 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"plaques105503-610.4511219.65Classic MedallicsPlaquesInsert1:22%,3:24%,5:27%Genuine Walnut Award Of Excellence Plaque with 2 Inch Insert and Free Engraving.51-8185Academiccustom-pagefreeawardcertificates1"Download Only"certificates4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Certificate of Recognition template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Certificate-of-Recognition-Certificatecertificate-of-recognition-freeRecognition, Academic, Achievementcustom-pagefree-school-certificate-templates1"Download Only"free-academic4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Free Certificate of Scholarship template from TrophyCentral. Measures 11 x 8 1/2 inches - download and print instantly.certificate-of-scholarshipcertificate-of-scholarshipRecognition, Academic, Achievementgoldstarpinsschool-pinsgold-pins-lapelsports-pinscustomlapelmascotpinsflaglapelpinscorporatepinsmusicartpins1star-pinsengraveablepinvelcovhinpinfucocushpivolunteerpinshonorrollpinsmath-lapel-pinsreadingpinsscience-lapel-pinsspelling-pins-medalsbaseballpinsbasketballlapelpinscheerleadingpinsfootballpinsgolfpinssoccerpinsswimmingpinstrackpinsvolleyballpinscomingsoon12cpxhp03br642flower-pinsteacher-pinsfire-department-pinsperfect-attendance-awardsband-pins-awards11Find Award Pins Discounted at TrophyCentral. Each Award Pin and Lapel Pin Features a Clutch-Back. Pins Ship in Just 1-2 Days!custom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.454024.45Certificate SourceSealsEmbosser Seals1:22%,3:28%,5:31%Award Ribbon Blue Embossed Certificate Seals From TrophyCentral.Generalcustom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.454024.45Certificate SourceSealsEmbosser Seals1:22%,3:28%,5:31%Award Ribbon Blue/Silver Embossed Certificate Seals .Generalcustom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.454024.45Certificate SourceSealsEmbosser Seals1:22%,3:28%,5:31%Award Ribbon Gold Embossed Certificate Seals From TrophyCentral.Generalcustom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.454024.45Certificate SourceSealsEmbosser Seals1:22%,3:28%,5:31%Award Ribbon Silver Embossed Certificate Seals From TrophyCentral.Generalcustom-pageacademic-general-medalsaward-ribbons-printedfirst-place-ribbonsrosetteribbonsbadgeribbonsholdersribbons1ribbons-neck-drapecustompennantsarmbandhoawricaawriaidsribbonsblmoriabawriovcariritoliriordoawrireawrianabuawarecusflatribcusflatrib1conribcomsoocusrossinstrcusminwfunbucustomrosettecucorirosetteconribcomsoo11index1Shop award and prize ribbons for schools and events. Bulk pricing, fast shipping and a wide selection from TrophyCentral.award-ribbons-rosettesStock and Printed Award Ribbons in Multiple Colors and Styles

Trophy Central has a huge choice of discounted award ribbons to meet all of your needs. From Prize Ribbons to Place Ribbons to Blue Ribbons, we have it all. Printed ribbons ship in just 1-2 days.

Shop for Custom Ribbons with Ease at TrophyCentral

We offer discounted and bulk pricing, fast turnaround, and great customer service.

Frequently Asked Questions

What's the difference between rosette ribbons and flat ribbons?

Rosette ribbons feature pleated fabric arranged in a circular pattern with streamers, creating a more elaborate and traditional look. Flat ribbons are simpler, single-layer ribbons that lie flat against surfaces. Rosettes are often used for more formal competitions, such as blue ribbons for first place, while flat ribbons work well for participation awards.

Can award ribbons be washed or cleaned if they get dirty?

Most award ribbons should be spot-cleaned only with a damp cloth. Avoid submerging them in water or using harsh cleaners, as this can cause the fabric to fray. For valuable or sentimental award ribbons, consider professional cleaning or protective display cases.

How should I store award ribbons to prevent damage?

Store ribbons flat in acid-free boxes or hanging on ribbon display racks away from direct sunlight. Avoid folding them, as this can create permanent creases. Keep them in a cool, dry place to prevent moisture damage and fading.

Are award ribbons appropriate for adult competitions and events?

Absolutely! There are ribbons for many adult contexts, including soccer ribbons and basketball ribbons with numbers. Whether celebrating achievements in events like art shows, county fairs, wine competitions, dog shows, or corporate recognition programs, ribbons mark important accomplishments. The key is selecting appropriate designs and avoiding overly juvenile graphics.

]]>
custom-pagestar-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:30%,50:34%,100:39%,500:43%"Star Pins" "Star Lapel Pins" "Star Award Pins"Find these gold Award Winner pins discounted at TrophyCentral. Award winner pins feature a gold finish and ship in 1-2 days.br5501trophy-award-guides1Master the art of selecting the perfect awards with our comprehensive guide. Learn when to use trophies vs medals vs plaques, material choices, sizing, and budget-friendly options for every type of recognition.11Find awareness ribbons discounted at TrophyCentral. We have a great selection of colors to help you support your cause. Each awareness ribbon may be imprinted and features a choice of pin or tape backing.awriShop for Find Awareness Ribbons with Ease at TrophyCentral TrophyCentral has a wonderful selection of awareness ribbons at discounted prices and in a variety of colors and styles to help you support your cause. Each awareness ribbon comes with a tape or pin back and is available with optional imprinting. Have a question? Our top-rated customer service representatives would be happy to assist you. Our experts in Michigan, New York and online have been providing suggestions and guidance since 1999!]]>1"5-7 business days" "Topeka, Indiana" "UPS (Priority Mail also available)"465715-720016.4611:22%,50:36%Our Awareness Ribbons are available in multiple colors or aids, cancer, mourning, abuse and other styles. Awareness ribbons may also be imprinted.awareness-allRibbons for Awareness: Stock and Custom Imprinted TrophyCentral has a wonderful selection of quality awareness ribbons in a variety of styles. Whether you are looking Breast Cancer Ribbons, Mourning Ribbons, or Hope Ribbons, you have come to the right place. Each awareness ribbon comes with a tape or pin back and is available with option imprinting. All awareness ribbon orders over $100 are eligible for FREE SHIPPING!

]]>
custom-pagehonorrollpinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:30%,50:34%,100:39%,500:43%"Honor Roll" "Honor Roll Pins" "Honor Roll Trophies" "School Pins"Find these B Honor Roll Pins discounted at TrophyCentral. Each B Honor Roll pin features a high-quality finish and clutch-pin back.br590Honor Roll, Academiccustom-pageletter-shaped-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoName Badges1Find these popular B-shaped custom mascot badges at TrophyCentral. Great for fundraising! TrophyCentral is a top-rated Yahoo merchant.letterbadges-bcustom-pagebottles-st80"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14142013.4Glass AmericaPromotional ProductsSports / Water Bottles1:14%,640:31%Find these White Backpack Collection Custom Water Bottles Discounted at TrophyCentral. Add your own logo or artwork!41070Sports / Water Bottlescustom-pagebottles-st80"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14142013.4Glass AmericaPromotional ProductsSports / Water Bottles1:14%,640:31%Find these Green Backpack Collection Custom Water Bottles at Discounted TrophyCentral. Add your own logo or artwork!41079Sports / Water Bottlescustom-pagefirst-place-ribbonsbadgeribbbonscucorinw-3633blknw-3633grynw-3633khknw-3633nblnw-3633yelnw-3613blknw-3613irblnw-3613lmgrnw-3613rdplasbadhol1award-ribbons-rosettes1

Custom Badge Ribbons and Holders - Professional Event Identity Made Easy

Badge ribbons are one of the simplest and most effective tools for organizing any event where roles, responsibilities, and access levels need to be visible at a glance. From annual corporate conferences where board members, keynote speakers, and general attendees all move through the same spaces and need immediate visual distinction, to professional association meetings where presenter credentials matter during Q&A, from trade shows where buyer and exhibitor identification streamlines every conversation, to school competitions, science fairs, and academic bowls where judges need to be recognizable on the floor, quality badge ribbons eliminate confusion and give every event a polished, organized appearance. Our stock badge ribbons ship immediately in over 20 standard titles covering the most common event roles, while our custom badge ribbons allow you to specify your own title, color combination, and logo for a fully branded credential system. Badge holders and neck wallets in black, navy, grey, khaki, red, yellow, lime green, and iron blue complete the package, keeping credentials visible, protected, and easy to access throughout single-day and multi-day events alike.

Frequently Asked Questions About Badge Ribbons

When should I use stock badge ribbons versus custom badge ribbons?

Stock badge ribbons are the right choice when your event uses standard role titles like Speaker, Presenter, Judge, Staff, Volunteer, or Board Member and you need ribbons quickly without a minimum order quantity. They ship fast and work perfectly for recurring events that reuse the same titles year after year. Custom badge ribbons are worth the additional lead time when your event has unique role titles not covered by stock options, when you want your organization's logo or event name printed on each ribbon for a branded look, or when you are ordering in larger quantities and want a fully coordinated credential system. Custom ribbons also make excellent keepsakes for multi-day conventions and conferences where attendees collect them as event mementos.

How do badge ribbons attach to name badges and holders?

Badge ribbons attach at the top of a plastic badge holder or lanyard clip, hanging vertically below the name badge to display the role title clearly. Most badge ribbons feature an adhesive strip or clip attachment at the top that connects directly to standard badge holders. Multiple ribbons can be stacked, with each additional ribbon attaching below the previous one, allowing attendees with multiple roles to display all of them. For multi-day events where participants accumulate ribbons as their involvement expands, neck wallet badge holders with a secure closure keep the full credential package neat and protected throughout the event.

Do you offer bulk discounts on badge ribbons and holders for large events?

Yes, pricing on both stock and custom badge ribbons drops significantly with quantity, making it cost-effective to outfit every attendee, staff member, and speaker at events of any size. Conference organizers ordering ribbons across multiple role categories, trade show coordinators outfitting exhibitors and staff, and schools purchasing judge and staff ribbons for large competitions all benefit from quantity pricing. Orders over $99 qualify for free economy shipping.

If you need more information before deciding, see our expert resource section:
]]>
award-ribbons-printed rosetteribbons
custom-pagetrophies-badminton1trophies498551-310.452429Trophies1Find this popular Badminton trophy discounted at TrophyCentral. Features a real marble base, stylish 4-inch gold cup, free engraving and fast shipping.badminton-cup-place-trophycustom-pagetrophies-badminton1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular badminton figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!qtbadmplBadminton, 1st / 2nd / 3rd / Etc., Sportscustom-pagetrophies-badminton1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find these popular Badminton year trim trophies discounted at TrophyCentral. Available in multiple sizes and includes free personalization.qtbadmyrBadminton, Sportscustom-pagetrophies-badminton1trophies498852-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with badminton figure discounted at TrophyCentral. Includes free text engraving!cup-badm-pBadminton, Sportscustom-pagetrophies-badminton1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these badminton budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtbadmscbBadminton, Sportscustom-pagetrophies-badminton1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous two-tier Badminton Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtbadmttBadminton, Sportscustom-pagetrophies-badminton1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.2115Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%See this championship trophy with a Badminton figure at TrophyCentral. Be sure to see all of our Badminton figure awards.qtbadmttwBadminton, Sportscustom-pagetrophies-badminton1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%This popular Badminton Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtbadmscBadminton, Sportscustom-pagetrophies-badminton1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451623.65Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%Find Our Badminton Player Deluxe Platform Series Trophies Discounted at TrophyCentral. Real Marble Base; Free Personalization!qtbadmdmBadminton, Sportscustom-pagetrophies-badminton1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Badminton figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-badm-scbBadminton, Sportscustom-pagetrophies-badminton1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.4118Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous Badminton Three-Column Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtbadm3cBadminton, Sportscustom-pagetrophies-badminton1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%,25:23%,50:29%,100:34%Our popular Badminton participation trophies feature a real slant-front marble base and free engraving.qtbadmncBadminton, Sportscustom-pagetrophies-badminton1trophies498551-310.452429Trophies1Find our Badminton star column trophy discounted at TrophyCentral. Features a real marble base, 6 inch gold star-shaped column, free engraving and fast shipping.badminton-star-column-trophycustom-pageaward-medalsqtbadmncqtbadmscqtbadmdmqtbadmyrqtbadmplqtbadmttqtbadmttwqtbadm3cmqtbadmscbcup-badm-scbcup-badm-pbadminton-cup-place-trophybadminton-cup-place-column-trophybadminton-star-column-trophy1trophies1Find Badminton Trophies Discounted at TrophyCentral. Each Badminton Trophy Includes Free Engraving! Fast 1-2 Day Shipping!Custom Badminton Trophies & Awards for Every Achievement Level

TrophyCentral offers a wide selection of badminton trophies and awards designed to recognize players and celebrate achievement at every level. From economy participation trophies for youth recreational programs to impressive champion's trophies for tournament winners, our collection ensures you will find the right award for every player and every event.

Shop Badminton Awards with Confidence at TrophyCentral

With over 2,300 five-star reviews and trusted by leagues and clubs since 1999, TrophyCentral delivers quality awards at guaranteed lowest prices. Every trophy includes free personalized engraving and most orders ship in just 1-2 business days. Explore our full collection of trophies and awards for even more designs and styles.

Frequently Asked Questions About Badminton Trophies

What types of badminton events are these trophies suitable for?

Our badminton trophies and awards are suitable for a wide range of events including singles and doubles club tournaments, recreational league play, school and college badminton competitions, community recreation programs, and youth and adult championship events at all skill levels.

Does engraving come included with badminton trophies?

Yes, every badminton trophy includes free personalized engraving at no extra cost. You can add the player's name, team or club, tournament name, and event details to create a meaningful award they will be proud to display.

How quickly will badminton trophy orders ship?

Most badminton trophy orders are processed and shipped within 1-2 business days, with same-day processing available on many orders placed early in the day. Expedited shipping options are available at checkout for time-sensitive events.
]]>
Badminton
custom-pagefreeawardcertificates1"Download Only"free-cooking4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our bake-off template is free and designed exclusively for TrophyCentral. Bake-off templates and award certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.bake-off-templatebake-off-521Cooking / Culinarycustom-pagetrophies-cooking-culinary20498551-30.5100021TrophyCentralInsertsSports, Hobby, Org, Livestock1Find this colorful Baking 2" Epoxy-covered insert discounted at TrophyCentral. Fast 1-2 day shipping.Cooking / Culinarycustom-pagefreeawardcertificates1"Download Only"free-cooking4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Baking Certificate template is a great way to recognize a talented pastry chef! It's free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches.baking-certificatebaking-2-freeCooking / Culinarycustom-pagefreeawardcertificates1"Download Only"free-cooking4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our baking template is free and designed exclusively for TrophyCentral. Baking templates and award certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.baking-templatebaking-521Cooking / Culinarycustom-pagetrophies-cooking-culinary1trophies498551-31.520033TrophyCentralMedalsSports, Hobby, Org, Livestock1Find these Baking Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Cooking / Culinarycustom-pagetrophies-cooking-culinary1trophies498551-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Baking insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Cooking / Culinarycustom-pagetrophies-cooking-culinary1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Baking single column insert trophy features a choice of column color, a marble base and free trophy engraving.Cooking / Culinarycustom-pagetrophies-cooking-culinary1trophies498551-311821.06TrophyCentralTrophies1Cooking / Culinarycustom-pagetrophies-cooking-culinary1trophies498551-310.71217.38Trophies1Cooking / Culinarycustom-pagetrophies-cooking-culinary1trophies498551-31.520033TrophyCentralMedalsSports, Hobby, Org, Livestock1Find these Baking Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Cooking / Culinarycustom-pagetrophies-cooking-culinary1trophies498551-30.525035.5TrophyCentralMedalsSports, Hobby, Org, Livestock1Find this colorful Baking insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Bakingcustom-pagetrophies-cooking-culinary1trophies498551-30.525035.5TrophyCentralMedalsSports, Hobby, Org, Livestock1Find this Baking insert medal with a personalized front rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Bakingcustom-pagetrophies-cooking-culinary1plaques498551-311.11623.5TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these baking insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Cooking / Culinary1award-medals1Find baking trophies and baking medals discounted at TrophyCentral. Trophies include 3 lines of personalization. Medals include a free ribbon1Bakingcustom-pagetrophies-cooking-culinary1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our baking insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Cooking / Culinarycustom-pagetrophies-cooking-culinary1trophies498551-31.520033TrophyCentralMedalsSports, Hobby, Org, Livestock1Find these Baking Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Cooking / Culinarydance-pinsqtballencqtballescqtballedmqtballeyrqtballeplqtballettqtballettwqtballe3cqtballtrmqtballescbcup-balle-scbcup-balle-pbdg-ballet1trophies-dance1"Dance Trophies""Dance Awards" "Dance Trophy" "Trophies, Dance" "Dancing Trophies" "Trophies, Dancing"Find a great selection of Ballet Trophies at TrophyCentral. Each Ballet Trophy and Award includes free engraving.Ballet Recognition Trophies Do you have your own Baryshnikov or star ballerina to recognize? TrophyCentral has a huge online selection, low prices and great customer service. Be sure to see our Ballet participation trophies, popular with younger children. Our Single Column Trophy with a ballet figure is also a customer favorite. Also be sure to see our complete selection of Dance Trophies section.]]>Balletcustom-pagetrophies-dance1trophies498551-310.452429Trophies1Find this popular Ballet trophy discounted at TrophyCentral. Features a real marble base, stylish 4-inch gold cup, free engraving and fast shipping.ballet-cup-place-trophycustom-pagetrophies-dance1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesMusic, Drama, Art, Dance1:14%,10:18%,50:22%,100:25%"Ballet Trophies" "Ballet Trophy"Find this popular ballet figure trophy with 1st, 2nd or 3rd place trim , marble base and free personalization, discounted at trophyCentral. Ships in a fast 1-2 days!qtballeplDance, 1st / 2nd / 3rd / Etc.custom-pagetrophies-dance1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesMusic, Drama, Art, Dance1:14%,10:18%,50:22%,100:25%"Ballet Trophies" "Ballet Trophy"This popular Ballet trophy features a real marble base, column, figure and trim indicating year of award. Includes free engraving!qtballeyrDancecustom-pagetrophies-dance1trophies498552-311821.06TrophiesMusic, Drama, Art, Dance1Find this achievement cup trophy with ballet figure discounted at TrophyCentral. Includes free text engraving!cup-balle-pDancecustom-pagefreeawardcertificates1"Download Only"free-dance4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Ballet template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Ballet-Certificateballet-freeDance, Balletcustom-pagetrophies-dance1trophies498552-312421.33TrophiesMusic, Drama, Art, Dance1Find these ballet budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtballescbDancecustom-pagetrophies-dance1498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Find this budget ballet award trophy discounted at Trophy Central. Features a real marble base and plastic female ballet figure. Engraving is free. Fast 1-2 day shipping.bdg-balletDancecustom-pagetrophies-dance1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75219Quick TrophyTrophiesMusic, Drama, Art, Dance1:14%,3:19%,10:27%"Ballet Trophies" "Ballet Trophy"Find these fabulous two-tier Ballet Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtballettDancecustom-pagetrophies-dance1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.2115Quick TrophyTrophiesMusic, Drama, Art, Dance1:14%,3:19%,10:28%"Ballet Trophies" "Ballet Trophy"See this championship trophy with a Ballet figure at TrophyCentral. Be sure to see all of our Ballet figure awards.qtballettwDancecustom-pagetrophies-dance1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesMusic, Drama, Art, Dance1:14%,10:18%,50:24%,100:28%"Ballet Trophies" "Ballet Trophy"This popular Ballet Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtballescDancecustom-pagetrophies-dance1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451623.65Quick TrophyTrophiesMusic, Drama, Art, Dance1:14%,10:18%,50:24%,100:28%"Ballet Trophies" "Ballet Trophy"Find Our Ballerina Deluxe Platform Series Trophies Discounted at TrophyCentral. Real Marble Base. Free Personalization!qtballedmDancecustom-pagetrophies-dance1trophies498552-311218.84TrophiesMusic, Drama, Art, Dance1Find this unique cup trophy with Ballet figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-balle-scbDancecustom-pagetrophies-dance1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.4118Quick TrophyTrophiesMusic, Drama, Art, Dance1:14%,3:19%,10:24%"Ballet Trophies" "Ballet Trophy"Find these fabulous two-tier, 3-column champion Ballet Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtballe3cDancee9084501241ep8411Shop for Ballet Medals and Lapel Pins at TrophyCentral. Ballet Medals and Pins Ship in Just 1-2 Days!trophies-balletcustom-pagetrophies-dance1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453633.4Quick TrophyTrophiesMusic, Drama, Art, Dance1:14%,10:17%,25:23%,50:29%,100:34%"Ballet Trophies" "Ballet Trophy"Our popular Ballet participation trophies feature a real slant-front marble base and free engraving.qtballencDancecustom-pagetrophies-dance1trophies498551-310.452429Trophies1Find our Ballet star column trophy discounted at TrophyCentral. Features a real marble base, 6 inch gold star-shaped column, free engraving and fast shipping.ballet-star-column-trophycustom-pagesoccerwaterbottles72"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14144016.8Glass AmericaPromotional ProductsWater Bottles1:22%,1980:51%Baltic Awards from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.Sports / Water Bottlescustom-pagee9008plasticpinboxvelapinbox10cl46 ep81 e9008 comsoonecsch"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsMusic, Drama, Art, Dance1:22%,50:28%,100:32%,500:42%"Music Lapel Pins" "Band Lapel Pins" "Band Awards" "School Pins"Find these popular Lyre - Band AP Series Lapel Pins discounted at TrophyCentral. Fast 1-2 day shipping!ap2207-05-2012Music / Band / Choruscustom-pagetrophies-music20medals498552-40.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful Band 2" Epoxy-covered insert decal discounted at TrophyCentral. Fast 1-2 day shipping.Music / Band / Choruscustom-pagemusicartpins1plastic-pinbox-t5498551-20.550040.5TrophyCentralLapel Pins11:22%,25:24%,100,27%,500:30%Find our 3D Series gold band pin discounted at TrophyCentral. Each outstanding volunteer pin features a clutch back so it can be easily and safely attached to clothing. Fast 1-2 day shipping.Music / Band / Choruscustom-pagefreeawardcertificates1"Download Only"free-music4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our band template is free and designed exclusively for TrophyCentral. Templates measure 11 x 8 1/2 inches and can be easily downloaded and printed.band-achievement-templateachievement-band-521Music / Band / Chorus, Music, Achievementcustom-pagefreeawardcertificates1"Download Only"free-music4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our band award template is free and designed exclusively for TrophyCentral. Band templates and award certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.band-award-templateband-award-521Music / Band / Chorus, Musiccustom-pagetrophies-music1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Band Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Music / Band / Choruscustom-pagefreeawardcertificates1band-pins-awards"Download Only"free-music49855011TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Band template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Band-Certificateband-freeMusic / Band / Chorus, Musiccustom-pagetrophies-music1trophies498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Band insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-Band-InsertMusic / Band / Choruscustom-pagetrophies-music1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Band single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - BandMusic / Band / Choruscustom-pagetrophies-music1trophies498551-311821.06TrophyCentralTrophies1Music / Band / Choruscustom-pagetrophies-music1trophies498551-310.71217.38Trophies1Music / Band / Choruscustom-pagemusicartpins1plastic-pinbox-t10lapel pins498551-30.5200040.5TrophyCentralLapel Pins11:22%,25:24%,100,27%,500:30%Find this Band Gold Enamel lapel pin discounted at TrophyCentral. Features a clutch-pin back for easy attachment to clothing.. Fast 1-2 day shipping.Music / Band / Choruscustom-pagetrophies-music1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Band Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Music / Band / Choruscustom-pagetrophies-music1medals498552-30.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this Colorful Band insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Music / Band / Choruscustom-pagetrophies-music1medals498552-40.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this Band insert medal With A Personalized Front Rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Music / Band / Choruscustom-pageplaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these band insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Music / Band / Choruscustom-pagegold-pins-lapelplasticpinboxvelapinbox15cl46 ap22 ep81 e9008 comsoonecsch noname61-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
lapel pins105502-30.31150030.3Classic MedallicsLapel PinsMusic, Drama, Art, Dance1:30%,50:36%,100:39%,500:42%,1000:48%"Music Lapel Pins" "Band Lapel Pins" "Band Awards" "School Pins"Find this fabulous Band letter pin at TrophyCentralcl29Music / Band / Chorus
academic-general-medals1musicmedals1Band Medals in a variety of styles, sizes and finishes to recognize any musician. Each Band Medal Includes a free neck ribbon! Fast 1-2 day shipping.musicmedals

Fabulous Band Medals and Awards

If you are looking for a budget-friendly alternative to trophies, our band medals are the perfect solution. Many come in gold, silver and bronze finishes and offer optional engraving to keep the price as low as possible. All of our medals include a neck ribbon, and many offer a choice of ribbon color. Without engraving, your order will typically ship in just 1-2 business days.

Shop Online with Ease at TrophyCentral!

TrophyCentral has an industry-leading selection that will fit any budget, all at discounted prices. Our experts in New York, Michigan and online have been providing suggestions and guidance since 1999! To find the perfect band medal, use our keyword search above, or for personal service, call us toll-free at 1-888-809-8800.
]]>
band-pins-awardsBand
custom-pagetrophies-music1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our band insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - BandMusic / Band / Chorusmusic-award-certificates11Find band pins discounted at Trophy Central. Each band pin features a clutch-back for safe attachment to clothing.Shop with Ease at TrophyCentral! Band subject pins come in a wide variety of styles. Each band lapel pin features a clutch-pin back for easy and safe attachment to clothing. Band lapel pins typically ship in 1-2 business days. If you are looking to buy online, look no further! TrophyCentral has a great selection that will fit any budget. Our experts in New York and Michigan have been providing help and guidance since 1999!]]>custom-pagetrophies-music1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Band Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Music / Band / Choruscustom-pagemusicartpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsMusic, Drama, Art, Dance1:22%,50:30%,100:33%,500:45%"Music Lapel Pins" "Band Lapel Pins" "Music Pins"Find These Baritone Lapel Pins Discounted at TrophyCentral. Features a Clutch-Pin Back and Fast 1-2 Day Shipping!mp7Music / Band / Choruscustom-pagebaseballdisplay11"7-10 business days w/Logo, 4-6 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 23 24 2511833Perfect CaseDisplay Cases1:14%,5:17%basedisplay-bcBaseball / T-Ball, Sportscustom-pageplaques1ps5864 ps5866 8xwalplaqwsu"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498852-310.45811.6Quick TrophyPlaquesInsert1:14%,3:14%"Baseball Awards"qsinplaqbaseballBaseball / T-Ball, Coach, Golden Glovecustom-pageplace-trophies1trophies498551-310.452429Trophies1Find this popular Baseball trophy discounted at TrophyCentral. Features a real marble base, stylish 4-inch gold cup, free engraving and fast shipping.baseball-cup-place-trophycustom-pageplace-trophies1trophies498552-310.451622.85Trophy CentralTrophiesSports, Hobby, Org, Livestock1"Baseball Trophies and Medals" "Baseball Medals and Trophies" "Baseball Trophies" "Cheap Baseball Trophies" "Buy Baseball Trophies" "Purchase Baseball Trophies" "Discount Baseball Trophies" "Baseball Trophies" "Baseball Trophy"Baseball 1st, 2nd and 3rd Place Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.1Baseball / T-Ball, 1st / 2nd / 3rd / Etc., Sportscustom-pagetrophies-baseball20498552-40.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Baseball Epoxy Decal (2 Inch). Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Baseball / T-Ball, Sportscustom-pagetrophies-baseball1trophies498552-310.451020.45Trophy CentralTrophiesSports, Hobby, Org, Livestock1"Baseball Trophies" "Cheap Baseball Trophies" "Buy Baseball Trophies" "Purchase Baseball Trophies" "Discount Baseball Trophies" "Baseball Trophies" "Baseball Trophy"Year Indicator Baseball Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Baseball / T-Ball, Sportscustom-pagetrophies-baseball1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Achievement Cup Baseball Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.cup-baseb-pBaseball / T-Ball, Sportscustom-pagenoname11basedisplay-bcbatdisplaycapdisplaycarddisplaybaseballdisplaybasedisplay-dbasedisplay-8basedisplay-5basedisplay-4softballdisplaywallmountbaseballbasbatholdisbasedisplay-sbasedisplay-3basedisplay-6wallmountdoublebaseballwallmountsoftballwallmounttriplebaseballacsofholwwoobasedisplay-7basedisplay-2bcwallmountbatbasedisplay-12glovedisplaywallmountcaphelmetbattingrhelmetbattingowallmountgloveglovedisplayrbabatcu11Baseball and Softball Display Cases. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.

Baseball & Softball Displays

This section includes a great selection of glass and acrylic display cases to hold baseballs or softballs. We have baseball display cases to hold one, two or multiple balls. We also have a selection of displays for baseball caps and bats. Add engraving to your display case for a special touch! Whether you are looking for a display case for your favorite baseball or one that holds your entire softball collection, we can help. The experts at TrophyCentral have been serving customers since 1999!

]]>
baseball-medals trophies-baseball
custom-pagetrophies-baseball1medals498552-30.525033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this Baseball Batter 2 1/4" Antique Gold Medal Discounted at TrophyCentral. Each medal features a free ribbon. Fast shipping!Baseball / T-Ball, Sportscustom-pagefree-sports-templates1"Download Only"free-sports49855011TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Baseball Free Template (Free!). Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.baseballfrBaseball / T Ball, Sportscoaching-teaching-guides1trophies-baseball115 creative baseball award ideas for your team banquet. From Golden Glove to Dirt Magnet Award, find the perfect trophy for every player on your roster.custom-pagetrophies-baseball1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%2 3/4" T-Series Medal with Bronze Frame: Baseball. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Baseball / T-Ball, Sportscustom-pagetrophies-baseball1trophies498552-311011.45TrophiesSports, Hobby, Org, Livestock1Single Column Budget Baseball Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.mqtbasebscbBaseball / T-Ball, Sportscustom-pagetrophies-baseball1budget-trophies498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Budget baseball trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.bdg-baseballBaseball / T-Ball, Sportscustom-pagetrophies-baseball1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511230.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,6:23%,12:24%,24:26%Baseball Cast Stone Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.tr9918Baseball / T-Ball, Sportscustom-pagetrophies-baseball1trophies498552-411229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Champion's Cup Baseball Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Champion's Cup - BaseballBaseball / T-Ball, Sportscustom-pagetrophies-baseball1trophies498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Champion's Trophy with Baseball Insert. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Champion's-Trophy-with-Baseball-InsertBaseball / T-Ball, Sportscustom-pagetrophies-baseball1trophies498552-310.75219Trophy CentralTrophiesSports, Hobby, Org, Livestock1"Baseball Trophies and Medals" "Baseball Medals and Trophies" "Baseball Trophies" "Cheap Baseball Trophies" "Buy Baseball Trophies" "Purchase Baseball Trophies" "Discount Baseball Trophies" "Baseball Trophies" "Baseball Trophy"Quick-Ship Two-Tier Trophy with Baseball Figure. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Baseball / T-Ball, Sportscustom-pagetrophies-baseball1trophies498552-311.2115Trophy CentralTrophiesSports, Hobby, Org, Livestock1"Baseball Trophies" "Cheap Baseball Trophies" "Buy Baseball Trophies" "Purchase Baseball Trophies" "Baseball Trophies" "Baseball Trophy"27" Baseball Two Tier Championship Trophy W/ Wood Base. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Baseball / T-Ball, Sportscustom-pagetrophies-baseball1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Single Column Insert Baseball Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Single Column Insert Trophy - BaseballBaseball / T-Ball, Sportscustom-pagetrophies-baseball1trophies498552-310.451011.45Trophy CentralTrophiesSports, Hobby, Org, Livestock1"Most Popular Items" "Baseball Trophies" "Cheap Baseball Trophies" "Buy Baseball Trophies" "Purchase Baseball Trophies"Single Column Baseball Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Baseball / T-Ball, Sportscustom-pagetrophies-baseball1trophies498551-311821.06TrophyCentralTrophies1Baseball / T-Ball, Sportscustom-pagetrophies-baseball150"Standard Service: 8 Business Days from Receipt of Artwork, Rush Service (Extra Charge): 3 Business Days from Receipt of Artwork" "Oxnard, CA" "UPS (FedEx available on request)"medals930335-1010.630033.6Simba CalMedalsSports, Hobby, Org, Livestock1:22%,300:40%,500:51%,1000:54%"Baseball Medals"bamewriBaseball / T-Ball, Sportscustom-pagetrophies-baseball1trophies498552-310.451015.95Trophy CentralTrophiesSports, Hobby, Org, Livestock1"Baseball Trophies" "Cheap Baseball Trophies" "Buy Baseball Trophies" "Purchase Baseball Trophies"Double Platform Trophy in 3 Sizes- Baseball. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Baseball / T-Ball, Sportscustom-pagebaseballdisplay11"7-10 business days w/Logo, 4-6 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 23 24 251413Perfect CaseDisplay Cases1:14%,10:21%Baseball Display Cases (Glass). Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.basedisplay-s10-16-2017Baseball / T-Ball, Sportscustom-pagetrophies-baseball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"498852-30.38150030Quick TrophyDog TagsSports, Hobby, Org, Livestock1:14%,10:15%Baseball Dog Tag. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Shop for Sports Dog Tags at TrophyCentral. Each Sports Tag Can Be Engraved.qtdogbaseBaseball / T-Ball, Sportscustom-pagetrophies-baseball1trophies498551-310.452429Trophies1Find this popular Baseball Glove trophy discounted at TrophyCentral. Features a real marble base, stylish 4-inch gold cup, free engraving and fast shipping.baseball-glove-cup-place-trophycustom-pagetrophies-baseball1trophies498552-310.451622.85Trophy CentralTrophiesSports, Hobby, Org, Livestock1"Baseball Trophies" "Cheap Baseball Trophies" "Buy Baseball Trophies" "Purchase Baseball Trophies" "Discount Baseball Trophies" "Baseball Trophies" "Baseball Trophy"Place Trim Baseball Glove trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Baseball / T-Ball, 1st / 2nd / 3rd / Etc., Golden Glovecustom-pagetrophies-baseball1trophies498552-310.451622.85Trophy CentralTrophiesSports, Hobby, Org, Livestock1"Baseball Trophies" "Cheap Baseball Trophies" "Buy Baseball Trophies" "Purchase Baseball Trophies" "Discount Baseball Trophies"Year Indicator Baseball Glove Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Baseball / T-Ball, Golden Glovecustom-pagetrophies-baseball1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Achievement Cup Trophy - Baseball Glove. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.cup-basebgl-pBaseball / T-Ball, Golden Glovecustom-pagetrophies-baseball12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Baseball Glove and Helmet (489678) Mylar Decal Medal Insert. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.489678Baseball / T-Ball, Sports
custom-pagetrophies-baseball1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Single Column Budget Trophy - Baseball Glove. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.mqtbasebglscbBaseball / T-Ball, Golden Glovecustom-pagetrophies-baseball1498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Budget Baseball Glove Award Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.bdg-baseball-gloveBaseball / T-Ball, Golden Glovecustom-pagetrophies-baseball1trophies498552-310.75219Trophy CentralTrophiesSports, Hobby, Org, Livestock1Quick-Ship Two-Tier Trophy with Baseball Glove Figure. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Baseball / T-Ball, Golden Glovecustom-pagetrophies-baseball1trophies498552-311.2115Trophy CentralTrophiesSports, Hobby, Org, Livestock1Baseball Glove Two Tier Championship Trophy with Wood Base. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Baseball / T-Ball, Golden Glovecustom-pagetrophies-baseball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%"Baseball Trophies" "Cheap Baseball Trophies" "Buy Baseball Trophies" "Purchase Baseball Trophies" "Discount Baseball Trophies" "Baseball Trophies" "Baseball Trophy"Single Column Trophy - Baseball Glove. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.qtbasebglscBaseball / T-Ball, Golden Glovecustom-pagetrophies-baseball1trophies498552-310.451623.65Trophy CentralTrophiesSports, Hobby, Org, Livestock1Double Platform Trophy in 3 Sizes- Baseball Glove Figure. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Baseball / T-Ball, Golden Glovecustom-pagetrophies-baseball1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Single Column Cup Trophy - Baseball Glove. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.cup-basebgl-scbBaseball / T-Ball, Golden Glovecustom-pagetrophies-baseball1trophies498552-311.4118Trophy CentralTrophiesSports, Hobby, Org, Livestock1Quick-Ship Two-Tier 3-Column Trophy - Baseball Glove. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Baseball / T-Ball, Golden Glovecustom-pagetrophies-baseball1trophies498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1"Baseball Trophies" "Cheap Baseball Trophies" "Buy Baseball Trophies" "Purchase Baseball Trophies" "Discount Baseball Trophies" "Baseball Trophies" "Baseball Trophy"Participation Baseball Trophy with Marble Platform - Baseball Glove. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Baseball / T-Ball, Golden Glovecustom-pagekeychains21105502-40.39125035.39Classic MedallicsGiftsKeychains1:22%,10:25%,25:32%,50:39%,100:47%"Baseball Awards"Baseball Glove Pewter Key Chains. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.pk51-cmKeychainscustom-pagetrophies-baseballplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsSports, Hobby, Org, Livestock1:22%,50:30%,100:33%,500:47%"Baseball Awards" "Baseball Pins" "Baseball Lapel Pins"Baseball Glove Pin. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.ec7712-01-2018Baseball / T-Ball, Sportscustom-pagetrophies-baseball1trophies498551-310.452429Trophies1Find our Baseball Glove star column trophy discounted at TrophyCentral. Features a real marble base, 6 inch gold star-shaped column, free engraving and fast shipping.baseball-glove-star-column-trophycustom-pagetrophies-baseball1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Single Column Cup Baseball Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.cup-baseb-scbBaseball / T-Ball, Sportscustom-pagetrophies-baseball1trophies498551-310.71217.38Trophies1Baseball / T-Ball, Sportscustom-pagetrophies-baseballplastic-pinbox-t10498551-30.5200040.5TrophyCentralLapel Pins11:22%,25:24%,100,27%,500:30%Baseball Gold Enamel lapel pin. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.baseball-u-pbBaseball / T-Ball, Sportscustom-pagetrophies-baseball1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%2 3/4" T-Series Medal with Gold Frame: Baseball. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Baseball / T-Ball, Sportscustom-pagetrophies-baseball1trophies498552-311.411824 16 12Trophy CentralTrophiesSports, Hobby, Org, Livestock1"Baseball Trophies and Medals" "Baseball Medals and Trophies" "Baseball Awards" "Baseball Trophies" "Cheap Baseball Trophies" "Buy Baseball Trophies" "Purchase Baseball Trophies"Quick-Ship Two-Tier 3-Column Baseball Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Baseball / T-Ball, Sportscustom-pagetrophies-baseball1medals498552-30.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Baseball Insert Medal. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Baseball / T-Ball, Sportscustom-pagetrophies-baseball1medals498552-40.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Baseball Insert Medal with Personalized Rim. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Baseball / T-Ball, Sportscustom-pageplaques1cherry-insert-plaquesplaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Baseball Insert Plaque (Multiple Styles). Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Baseball / T-Ball, Sportscustom-pagetrophies-baseball12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-31130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Baseball Litho Medal Insert. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.506621Baseball / T-Ball, Sports
custom-pagetrophies-baseball1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Participation Insert Baseball Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Participation Insert Trophy - BaseballBaseball / T-Ball, Sportscustom-pagetrophies-baseball1trophies498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1"Baseball Trophies" "Cheap Baseball Trophies" "Buy Baseball Trophies" "Purchase Baseball Trophies" "Discount Baseball Trophies" "Baseball Trophies" "Baseball Trophy" "Baseball Trophies and Medals" "Baseball Medals and Trophies"Participation Baseball Trophy with Marble Platform. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Baseball / T-Ball, Sportscustom-pagekeychains21105502-40.39125035.39Classic MedallicsGiftsKeychains1:22%,10:25%,25:32%,50:39%,100:47%"Baseball Awards"Baseball Pewter Keychain. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.pk69-cmKeychainsbaseball-awards1sports-pins1Find baseball pins discounted at TrophyCentral. Each baseball pin includes a clutch-pin back. Also find custom baseball trading pins.Shop for Stock & Custom Baseball Pins with Ease at TrophyCentral Baseball pins come in a wide variety of shapes, styles and subjects, including: captain, MVP, glove and bat designs. We can also create a custom baseball pins and trading pins just for you. TrophyCentral has a great selection, low prices and bulk discounts. Our top-rated customer service representatives would be happy to assist you with all of your needs. Our experts in New York and Michigan have been providing suggestions and guidance since 1999 and they would be happy to help you, too!

Frequently Asked Questions (FAQ)

🎨 Can I customize my baseball lapel pins?

Yes! We offer custom baseball pins for teams, leagues, and tournaments. You can personalize them with team logos, colors, player numbers, and special messages. You can also create collectible trading pins that teams exchange at baseball tournaments and championships.

📦 Do you offer bulk discounts for teams and leagues?

Absolutely! We provide bulk discounts on for baseball teams, schools, and leagues. The more you order, the more you save!

🚚 How fast can I get my pins?

Most in-stock lapel pins ship within 1-2 business days. Custom trading pins may take longer, so we recommend ordering early for tournaments and events.

]]>
custom-pagetrophies-baseball1baseball-awardsplaques498552-41.45818.45JDSPlaques1Baseball Plaque. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Baseball / T-Ball, Sportscustom-pagetrophies-baseballplastic-pinbox-t5lapel pins498551-20.525040.5TrophyCentralLapel Pins11:22%,25:24%,100,27%,500:30%Baseball Design Lapel Pin. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.baseball-u-pbBaseball / T-Ball, Sportscustom-pagetrophies-baseball1award-ribbons-printed"1-2 business days" "Topeka, Indiana" "UPS (Post Office Priority Mail may also be available)"ribbons465711-21 26120030.36Tower RibbonRibbons11:22%,50:46%Baseball Award Ribbons. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.custom-pagetrophies-baseball1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%2 3/4" Silver Frame Medal: Baseball. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Baseball / T-Ball, Sportscustom-pagetrophies-baseball1trophies498551-310.452429Trophies1Find our Baseball star column trophy discounted at TrophyCentral. Features a real marble base, 6 inch gold star-shaped column, free engraving and fast shipping.baseball-star-column-trophycustom-pagetrophies-basketballbdg-baseballparticipation-baseballspinner-participation-trophies-baseballwrj651wvl451tr6096tr9918mqtbasebscbbaseball-part-ibaseball-e-part-imale-baseball-burst-trophiesbaseball-single-ibaseball-e-single-ibabohecup-baseball-scb-icup-baseball-inat-award-baseballbaseball-placebaseball-cup-place-trophybaseball-cup-place-column-trophybaseball-glove-cup-place-trophybaseball-glove-cup-place-column-trophybaseball-spinner-columnbaseball-ttw-trophydp-baseballm-700-trophies-female-batterm-700-trophies-male-batterperpetual-series-fantasy-baseballsingle-column-trophy-baseballyear-indicator-baseball-figurett3-trophies-baseballtt-baseball-figurebaseball-champ-icup-baseb-scbcup-baseb-pchamp-cup-baseball-tcqtbasebglscmqtbasebglscbcup-basebgl-scbcup-basebgl-pbdg-baseball-glovebaseball-glove-ttw-trophydp-baseball-glove-figureparticipation-baseball-glove1st-place-trim-baseball-gloveyear-indicator-baseball-glovett3-baseball-glovett-baseball-glove-figurebaseball-mcbaseball-mc-prbaseball-mgir13tm9971gqushbamebamewriz9011z9411qtdogbasej9011baseball-jigfbaseball-jibfbaseball-jisf1033baseball-ribbonsbaseball-award-plaquebaseball-plaque-iqsinplaq3dbaseballqsinplaqbaseballgiftwhistlefantasy-baseball-almostfantasy-baseball-asleepfantasy-baseball-champfantasy-baseball-commissionerfantasy-baseball-loserfantasy-baseball-upfantasy-sports-couchloser-award-plaquebaseball-ei1063507192502074502811507523489678506621baseball-glove-star-column-trophybaseball-star-column-trophycl03ec77ec09cl02ec06baseball-pbbaseball-u-pb1trophies1Shop baseball trophies, medals and plaques for every level of play. Hundreds of styles for Little League, recreation and fantasy teams. Free engraving.

Custom Baseball Trophies - Honor Every Level of the Game

Baseball runs deeper than almost any other sport in American life, and the recognition programs that serve it span every level of play. Youth recreational and Little League programs rely on participation trophies that make every player feel valued alongside tiered placement awards for all-star teams, division champions, and tournament winners, with column trophies featuring batter figurines in gold or silver finish the classic choice for boys and girls leagues alike. T-ball programs serving players ages 4 to 7 depend on small, affordable participation pieces that fit young hands and mean everything to a child displaying their first sports award at home. Travel ball and select programs call for premium resin sculptures - detailed batter, pitching, and fielding figures - and double-platform column trophies in the 14 to 18 inch range that reflect the year-round commitment players and families invest.

High school programs generate a full slate of individual honors at the end-of-season banquet: Most Valuable Player, Best Pitcher, Best Catcher, Golden Glove for fielding excellence, Silver Slugger for top hitters, Most Strikeouts, Lowest ERA, Most RBIs, and Most Improved Player, each deserving an award that stands apart from a standard participation piece. Tournament and championship recognition demands two-tier and three-column trophies in the 20 to 24 inch range with engraving plates large enough to accommodate full team rosters. Fantasy baseball commissioners order perpetual trophies with multiple engraving plates to record each year's champion alongside loser trophies, last-place certificates, and consolation awards that add personality to the end-of-season presentation. Every baseball trophy includes free engraving personalized with player names, team names, award titles, and season details.

Baseball Award Ideas for Your End-of-Season Banquet

End-of-season baseball awards shouldn't feel like watching paint dry in the dugout. Whether you're coaching Little League legends or high school heroes, these award ideas will help you recognize every player on your roster.

The Heavy Hitters

  • Golden Glove Award - For the defensive wizard who turns double plays in their sleep and makes diving catches look like a casual Tuesday.
  • Slugger Supreme - For the power hitter who makes outfielders very, very nervous.
  • Captain Clutch - Bottom of the ninth, bases loaded, two outs - this player thrives when the pressure is on and the game is on the line.

The Heart of the Team

  • Rally Cap Champion - First to flip their cap inside out and last to stop cheering. Team morale runs through their veins.
  • Iron Man Award - Rain or shine, early morning or late evening - this player hasn't missed a practice, game, or team pizza party all season.
  • Best Baseball IQ - They know when to steal, when to hold, and somehow always end up in the right spot.

The Fun Ones

  • Dirt Magnet Award - Looks like they've been mud wrestling by the third inning. Slides into first base on a walk.
  • Walk-Up Music MVP - Their song choice gets the whole team pumped every single time.
  • Snack Bar Supporter - Single-handedly keeping the concession stand in business. Strong opinions about the nachos.

Growth and Specialty Awards

  • Most Improved Swing - From whiffing at butterflies to making solid contact. This player's transformation deserves recognition.
  • Rookie of the Year - First year on the team but playing like a veteran.
  • Comeback Kid - Whether bouncing back from injury or a rough start, this player's resilience inspires the whole squad.
  • Speed Demon - Turns singles into doubles. The opposing catcher gets nervous just seeing them on base.
  • Ace of the Staff - Your go-to pitcher who makes batters question their life choices.
  • Utility Player Excellence - Catcher on Monday, shortstop on Wednesday, center field on Saturday. Does it all.

Mix serious awards with fun ones to keep your banquet entertaining. Every player should leave feeling recognized. These kids will forget the scores but remember how you made them feel.

Frequently Asked Questions About Baseball Trophies

What trophy sizes work best for different baseball award categories?

T-ball and recreational leagues for players ages 4 to 7 benefit from 6-inch participation trophies that every player receives, sized right for young hands and bedroom shelves. Youth rec leagues ages 8 to 12 step up to 8-inch to 12-inch trophies for placement finishers, with the size difference signaling achievement without a significant cost increase across large rosters. Travel ball and select programs call for 14-inch to 18-inch trophies or premium resin designs for tournament champions and finalists. High school individual honors like MVP, Golden Glove, and Best Pitcher warrant 12-inch to 16-inch column trophies or plaques that stand apart from standard participation pieces. League and tournament grand champions deserve 20-inch to 24-inch multi-column championship trophies with engraving plates large enough for full team rosters.

What details should baseball trophy engraving include?

The most meaningful trophies are engraved with more than just a name. For team awards, include the league or tournament name, team name, finishing position, and season year - for example: River Valley Little League, Division Champions, Spring 2025. For individual player awards, add the player name, award title, and season - for example: Marcus Thompson, Most Valuable Player, Lincoln High School Varsity Baseball, Fall 2025. Position-specific awards gain clarity through specific titles like Golden Glove Award, Silver Slugger, or Lowest ERA rather than generic terms. Statistical achievements gain impact through specific numbers like 14 Home Runs or .415 Batting Average when space permits. Team championships benefit from final records such as League Champions 22-4 or Tournament Champions, 3-0 in Bracket Play. Coach awards should include years of service and program name when space allows.

Should youth baseball programs give trophies to every player or only award winners?

Youth programs serving players under 12 benefit significantly from universal participation trophies acknowledging every athlete who completed the season, building confidence and encouraging return the following year. Even participation-focused programs should maintain competitive recognition with larger trophies for MVP, Most Improved, Best Sportsmanship, and Coach awards, teaching young athletes that exceptional effort earns special recognition. Middle school and high school programs appropriately shift toward merit-based awards recognizing championships, individual statistical achievement, and all-star honors, preparing athletes for increasingly competitive environments.

How far in advance should I order baseball trophies for an end of season banquet?

Most baseball trophies and medals ship within one to two business days after your order is placed, so ordering five to seven days before your banquet date gives comfortable margin for standard delivery. For larger orders involving 30 or more trophies, championship pieces requiring multiple engraving plates, or perpetual trophies, allowing 10 to 14 days is a safer timeline. If your banquet date is approaching quickly, contact us by phone and our team can advise on the fastest available options for your order size.

Planning a baseball banquet or tournament and need guidance beyond just the awards? Our expert resources cover trophy presentation tips and engraving ideas to make every award memorable.

Be sure to also browse our complete trophies and awards collection to explore additional designs for every sport and occasion.

]]>
Baseball
custom-pagefree-sports-templates1"Download Only"free-fantasy4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Baseball: Almost Doesn't Count. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.fantasy-baseball-almost-Mainfantasy-baseball-almostBaseball / T-Ballcustom-pagefree-sports-templates1"Download Only"free-fantasy4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Baseball: Asleep at the Wheel Free Template. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.fantasy-baseball-asleep-Mainfantasy-baseball-asleepBaseball / T-Ballcustom-pagefree-sports-templates1"Download Only"free-fantasy4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Baseball: Comeback of the Year. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.fantasy-baseball-comeback-Mainfantasy-baseball-comebackBaseball / T-Ballcustom-pagefree-sports-templates1"Download Only"free-fantasy4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Baseball: No Place To Go But Up Free Template. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.fantasy-baseball-up-Mainfantasy-baseball-upBaseball / T-Ball11custom-pageyswtest111custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-31130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Basketball (492841) Litho Medal Insert. Ideal for leagues, schools, and tournaments. Fast shipping.492841Basketball, Sports
custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-31130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Basketball (507519) Litho Medal Insert. Ideal for leagues, schools, and tournaments. Fast shipping.507519Basketball, Sports
custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-31130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Basketball (Female) Litho Medal Insert. Ideal for leagues, schools, and tournaments. Fast shipping.502110Basketball, Sports
custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Basketball (Male) - 535 Litho Medal Insert. Ideal for leagues, schools, and tournaments. Fast shipping.507535Basketball, Sports
custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-31130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Basketball (Male) Litho Medal Insert - Style 1. Ideal for leagues, schools, and tournaments. Fast shipping.501971Basketball, Sports
custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-31130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Basketball (Male) Litho Medal Insert - Style 2. Ideal for leagues, schools, and tournaments. Fast shipping.507201Basketball, Sports
custom-pagebasketballdispay11"3-4 business days" "Marquette, Michigan" "UPS"498552-410.45119.35Display Cases11:14%"Sports Display Case" "Sports Displays" "Sports Display" "Sports Display Cases" "Sport Display Cases" "Acrylic Sports Display" "Acrylics Displays" "Acrylic Display Cases" "Sports Ball Holder" "Sports Ball Holders" "Baseball Holder" "Baseball Holders" "Baseball Display" "Baseball Cases" "Baseball Display Cases" "Baseball Display Case" "Baseball Card Cases" "Baseball Card Case" "Baseball Card Display" "Basketball Holder" "Basketball Holders" "Basketball Display" "Basketball Displays" "Basketball Display Case" "Basketball Display Cases"Basketball / Soccer Ball / Volleyball Display Case (Acrylic). Ideal for leagues, schools, and tournaments. Fast shipping.Volleyball, Sportscustom-pageplace-trophies1trophies498551-310.452429Trophies1Find this popular Basketball trophy discounted at TrophyCentral. Features a real marble base, stylish 4-inch gold cup, free engraving and fast shipping.basketball-cup-place-trophycustom-pageplace-trophies1cl143 1034 cl118 cogi24kgowh qushbame1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)""PT1=Trophies" "PC12=498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Popular Basketball trophy with 1st, 2nd, or 3rd place trim. Ideal for leagues, schools, and tournaments. Fast shipping.qtbaskplSee moretrophies-basketballBasketball, 1st / 2nd / 3rd / Etc., Sportscustom-pagetrophies-basketball20498552-40.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Basketball Epoxy Decal (2"). Ideal for leagues, schools, and tournaments. Fast shipping.Basketball, Sportscustom-pagetrophies-basketball1"2-4 business days" "Marquette, MI" "UPS"medals498552-40.530012.37PDU-SMedalsSports, Hobby, Org, Livestock1:22%,100:35%2 1/2" Color TC Series Medal - Basketball. Ideal for leagues, schools, and tournaments. Fast shipping.basketballmedal08-10-2013Basketball, Sportscustom-pagetrophies-basketball1cl143 1034 cl118 cogi24kgowh qushbame1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular basketball trophy with Year Indicator discounted at trophyCentral. Ideal for leagues, schools, and tournaments. Fast shipping.qtbaskyrBasketball, Sportscustom-pagetrophies-basketball1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Achievement Cup Trophy - Basketball. Ideal for leagues, schools, and tournaments. Fast shipping.cup-bask-pBasketball, Sportscustom-pagetrophies-basketball1medals498552-30.525033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this Basketball Player 2 1/4" Antique Gold Medal Discounted at TrophyCentral. Each medal features a free ribbon. Fast shipping!Basketball, Sportscustom-pagefree-sports-templates1"Download Only"free-sports4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Basketball template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Basketball-Certificatebasketball-freeBasketball, Sportscoaching-teaching-guides11Creative basketball award ideas with engraving examples for your end-of-season banquet. From Downtown Sniper to Sixth Man Supreme, discover 15+ unique ways to recognize every player with actual trophy wording templates.custom-pageaward-ribbons-printed1award-ribbons-printed"1-2 business days" "Topeka, Indiana" "UPS (Post Office Priority Mail may also be available)"ribbons465711-21 26120030.36Tower RibbonRibbons11:22%,50:46%Basketball Award Ribbons. Ideal for leagues, schools, and tournaments. Fast shipping.custom-pagetrophies-basketball1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%2 3/4" T-Series Medal with Bronze Frame: Basketball. Ideal for leagues, schools, and tournaments. Fast shipping.Basketball, Sportscustom-pagetrophies-basketball1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Single Column Budget Trophy - Basketball. Ideal for leagues, schools, and tournaments. Fast shipping.mqtbaskscbBasketball, Sportscustom-pagetrophies-basketball1498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Budget Award Trophy with Basketball Figure. Ideal for leagues, schools, and tournaments. Fast shipping.bdg-basketballBasketball, Sportscustom-pagetrophies-basketball1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511230.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,6:23%,12:24%,24:26%"Basketball Awards"Basketball Cast Stone Series Trophy. Ideal for leagues, schools, and tournaments. Fast shipping.tr9919Basketball, Sportscustom-pagesporcer1certificates290631-31 2 3 230.45100020.45Certificate SourceCertificatesAward Certificates1:22%,25:27%,100:40%,500:50%Basketball Certificates. Ideal for leagues, schools, and tournaments. Fast shipping.1034Basketball, Sportscustom-pagefree-sports-templates11034"Download Only"free-sports49855011TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"See this Basketball Certificate designed exclusively for TrophyCentral! Basketball Certificates can be downloaded for free! Each basketball award certificate measures 11 x 8 1/2 inches.basketballfrBasketball, Sportscustom-pagetrophies-basketball1trophies498552-411229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Champion's Cup - Basketball. Ideal for leagues, schools, and tournaments. Fast shipping.Champion's Cup - BasketballBasketball, Sportscustom-pagetrophies-basketball1trophies498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Champion's Trophy with Basketball Insert. Ideal for leagues, schools, and tournaments. Fast shipping.Champion's-Trophy-with-Basketball-InsertBasketball, Sportscustom-pagetrophies-basketball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Quick-Ship Two-Tier Trophy - Basketball Shooter. Ideal for leagues, schools, and tournaments. Fast shipping.qtbaskttBe sure to see our other populartrophies-basketballBasketball, Sportscustom-pagetrophies-basketball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.2115Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%Two-Tier Championship Trophy w/ Wood Base - Basketball. Ideal for leagues, schools, and tournaments. Fast shipping.qtbaskttwSee all:trophies-basketballBasketball, Sportscustom-pagetrophies-basketball1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Single Column Insert Trophy - Basketball. Ideal for leagues, schools, and tournaments. Fast shipping.Single Column Insert Trophy - BasketballBasketball, Sportscustom-pagetrophies-basketball1cl143 1034 cogi24kgowh sports qushbame1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%Single Column Trophy - Basketball. Ideal for leagues, schools, and tournaments. Fast shipping.qtbaskscIn addition to our single column style, be sure to see all of ourtrophies-basketballBasketball, Sportscustom-pagetrophies-basketball1trophies498551-311821.06TrophyCentralTrophies1Basketball, Sportscustom-pagetrophies-basketball50"Standard Service: 8 Business Days from Receipt of Artwork, Rush Service (Extra Charge): 3 Business Days from Receipt of Artwork" "Oxnard, CA" "UPS (FedEx available on request)"medals930335-1010.630033.6Simba CalMedalsSports, Hobby, Org, Livestock1:22%,300:40%,500:51%,1000:54%"Basketball Awards" "Basketball Medals"Basketball Medal with Personalized School, Team or Event Name. Ideal for leagues, schools, and tournaments. Fast shipping.qcm-3Basketball, Sportscustom-pagetrophies-basketball1qcm-3 sporcer cogi24kgowh"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451623.65Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%Deluxe Platform Basketball Trophy (3 sizes). Ideal for leagues, schools, and tournaments. Fast shipping.qtbaskdmSee our othertrophies-basketballBasketball, Sportscustom-pagebasketballdispay1"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 23 24 251.5116.5Perfect CaseDisplay Cases11:14%,5:15%Basketball Display Case (Glass). Ideal for leagues, schools, and tournaments. Fast shipping.10-16-2017Basketball, Sportscustom-pagebasketballdispay1"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"327765-101 3 22 23 24 251.5118.5Perfect CaseDisplay Cases11:14%,5:15%Basketball Display Case (Glass, Rectangle). Ideal for leagues, schools, and tournaments. Fast shipping.10-16-2017Basketball, Sportscustom-pagebasketballdispay1"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 23 24 251.5129.5Perfect CaseDisplay Cases11:14%,5:16%Basketball Display Case (Glass, Wall-Mounted). Ideal for leagues, schools, and tournaments. Fast shipping.Basketball, Sportscustom-pagenoname11bassocbalholbasketballdisplaywallmountbasketballbasketballdisplay2capdisplay11Basketball Display Cases. Ideal for leagues, schools, and tournaments. Fast shipping.

Shop for Basketball & Sports Display Cases with Confidence at TrophyCentral

We offer a huge selection, discounted prices and fabulous customer service. Do you need help with some ideas or with ordering? Yes, we sell online, but we have real people who would love to help you! Feel free to call our experts in Michigan, New York and online. TrophyCentral - delivering smiles since 1999!


]]>
trophies-basketball
custom-pagebasketball-awards1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"498852-30.38150030Quick TrophyDog TagsSports, Hobby, Org, Livestock1:14%,10:15%"Basketball Awards"Basketball Dog Tag. Ideal for leagues, schools, and tournaments. Fast shipping.qtdogbaskBasketball, Sportscustom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-31130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Basketball GENERAL (502108) Litho Medal Insert. Ideal for leagues, schools, and tournaments. Fast shipping.502108Basketball, Sports
custom-pagetrophies-basketball1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Single Column Cup Trophy - Basketball. Ideal for leagues, schools, and tournaments. Fast shipping.cup-bask-scbBasketball, Sportscustom-pagetrophies-basketball1trophies498551-310.71217.38Trophies1Basketball, Sportscustom-pagetrophies-basketball1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%2 3/4" T-Series Medal with Gold Frame: Basketball. Ideal for leagues, schools, and tournaments. Fast shipping.Basketball, Sportscustom-pagetrophies-basketball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.4118Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Quick-Ship Two-Tier 3-Column Trophy - Basketball. Ideal for leagues, schools, and tournaments. Fast shipping.qtbask3cBasketball, Sportscustom-pageplaques1ps5864 ps5866 8xwalplaqwsu"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498852-310.45811.6Quick TrophyPlaquesInsert1:14%,3:14%"Basketball Awards"Basketball Holographic Plaque. Ideal for leagues, schools, and tournaments. Fast shipping.qsinplaqbasketballBasketball, Sportscustom-pageplaques1"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498852-310.45811.6Quick TrophyPlaquesInsert1:14%,3:14%"Basketball Awards"Basketball Holographic Decal Plaque. Ideal for leagues, schools, and tournaments. Fast shipping.qsinplaq3dbasketballBasketball, Coach, Sportscustom-pagetrophies-basketball1medals498552-30.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Basketball Insert Medal. Ideal for leagues, schools, and tournaments. Fast shipping.Basketball, Sportscustom-pagetrophies-basketball1medals498552-40.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Basketball Insert Medal with Personalized Rim. Ideal for leagues, schools, and tournaments. Fast shipping.Basketball, Sportscustom-pageplaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Basketball Insert Plaque (Multiple Styles). Ideal for leagues, schools, and tournaments. Fast shipping.Basketball, Sportscustom-pagetrophies-basketball1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511218.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,24:41%"Basketball Awards""Little Buddy" Series - Kid's Resin Basketball Trophy. Ideal for leagues, schools, and tournaments. Fast shipping.tr7224Basketball, Sportscustom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-31130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Basketball Male Litho Medal Insert. Ideal for leagues, schools, and tournaments. Fast shipping.501711Basketball, Sports
custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Basketball Medal Insert (497661). Ideal for leagues, schools, and tournaments. Fast shipping.497661Basketball, Sports
basketball-awards1sports-medals1Shop for Basketball Award Medals with Ease at TrophyCentral! We offer a large selection, low prices and great customer service. Our experts in New York and Michigan have been providing suggestions and guidance since 1999! They would be happy to help you, too! Add personalization to the back of your medal for a special touch. Here you can include your school, league or event name, date and even player's names.]]>trophies-basketballBasketballcustom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Basketball Mylar Decal Medal Insert. Ideal for leagues, schools, and tournaments. Fast shipping.489689Basketball, Sports
custom-pagetrophies-basketball1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Participation Insert Trophy - Basketball. Ideal for leagues, schools, and tournaments. Fast shipping.Participation Insert Trophy - BasketballBasketball, Sportscustom-pagetrophies-basketball11034 qushbame1 tr7224 wvl457 cl143"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)""PT1=Trophies" "PC12=498552-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%,25:23%,50:29%,100:34%Find this classic basketball participation trophy with a slant-front marble base at TrophyCentral. Free engraving. Fast 1-2 day shipping.qtbaskncReturn to oursection for more fabulous choices.trophies-basketballBasketball, Sportscustom-pagetrophies-basketball1fantasy-basketball-trophies"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.41234Quick TrophyTrophiesPerpetual Trophies11:14%,3:15%,10:16%"Basketball Awards" "Basketball Trophies"Find this Perpetual Basketball Trophy Discounted at TrophyCentral. Each Trophy has enough room for 32 names. Ships in just 1-2 days.qtbasketperpBasketball, Sportscustom-pagekeychains21105502-40.39125035.39Classic MedallicsGiftsKeychains1:22%,10:25%,25:32%,50:39%,100:47%"Basketball Awards"Basketball Pewter Key Chains. Ideal for leagues, schools, and tournaments. Fast shipping.pk70-cmKeychainsbasketball-awards1sports-pins1Basketball Pins. Ideal for leagues, schools, and tournaments. Fast shipping.Shop with Confidence at TrophyCentral! If you are looking to buy basketball lapel pins online, look no further! TrophyCentral has a great selection that will fit any budget. Our top-rated representatives are happy to assist you with all of your basketball pin needs. Our experts in New York and Michigan have been providing suggestions and guidance since 1999! To find the perfect basketball lapel pin, click on an image above, or for personal service, call us toll-free at 1-888-809-8800.
]]>
basketballmedals
custom-pagename-badges-tagswoyoulipr100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoName Badges1Basketball Player Custom Badge. Ideal for leagues, schools, and tournaments. Fast shipping.namebadges-basketballcustom-pagetrophies-basketball1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%2 3/4" Silver Frame Medal: Basketball. Ideal for leagues, schools, and tournaments. Fast shipping.Basketball, Sportscustom-pagetrophies-basketball1trophies498551-310.452429Trophies1Find our Basketball star column trophy discounted at TrophyCentral. Features a real marble base, 6 inch gold star-shaped column, free engraving and fast shipping.basketball-star-column-trophycustom-pagetrophies-cheerleading-spiritbdg-basketballqtbaskncqtbaskspncqtbaskbencmqtbaskscbbasketball-part-ibasketball-e-part-ibasketball-e-single-iqtbaskspscbabohe1qtbaskbesctr7224qtbask3cqtbaskdmqtbaskplqtbaskttqtbaskscqtbaskttwqtbaskyrqtbasktrmetbasktrophytrimqtbasketperptr7000tr7001tr9919champ-cup-basketball-tcbasketball-single-ibasketball-champ-icup-basketball-scb-icup-basketball-incup-bask-scbcup-bask-pbasketball-cup-place-trophybasketball-cup-place-column-trophybasketball-mcbasketball-mc-prbasketball-mge9396e9015e9402tm9970gir12qushbame1qcm-3loser-award-plaquebasketballmedalme102gj9531basketball-jigfbasketball-jibfbasketball-jisffantasy-basketball-almostfantasy-basketball-asleepfantasy-basketball-champfantasy-basketball-comebackfantasy-basketball-commissionerfantasy-basketball-loserfantasy-basketball-upfantasy-sports-couchbasketball-plaque-icl04ec02basketball-eibasketball-star-column-trophy1trophies1Shop basketball trophies, medals and plaques for every level of play. Hundreds of styles for leagues, schools and fantasy teams. Free engraving. Fast shipping.

Custom Basketball Trophies - Recognize Every Basket, Every Season

Basketball moves faster than almost any other team sport, and the recognition that comes at the end of a season should feel as significant as the game itself. Youth recreational and house leagues depend on participation trophies that make every player feel valued alongside tiered placement awards for division champions and tournament finalists, with column trophies featuring basketball figurines in shooting, dribbling, and jump ball poses the standard choice for boys and girls programs alike. AAU and travel teams competing across regional tournaments call for premium resin sculptures and double-platform trophies in the 14 to 18 inch range that match the year-round commitment players and families invest. High school programs generate the richest variety of individual recognition categories: Most Valuable Player, Leading Scorer, Best Defender, Most Assists, Best Rebounder, Sixth Man of the Year, Most Improved Player, and Academic Athlete, with position-specific honors recognizing the point guard who ran the offense, the shooting guard who hit the big shots, the small forward who played multiple roles, the power forward who controlled the paint, and the center who anchored the defense. Middle school and JV programs find medals in gold, silver, and bronze finishes a practical and popular solution - easy to ship, easy to store, and meaningful to players in the 11 to 15 age range. Fantasy basketball commissioners order perpetual trophies with engraved nameplates for each year's champion alongside consolation trophies and last-place awards that add personality to the end-of-season presentation. Every basketball trophy includes free engraving personalized with player names, team names, award titles, and season details.

Basketball Award Ideas for Your End-of-Season Banquet

From the sharpshooter draining threes to the defensive anchor protecting the paint, every basketball player brings something unique to the court. Here are award ideas that celebrate every contribution - plus engraving examples for each.

Offensive Firepower Awards

  • Downtown Sniper - Lives beyond the arc and makes it rain threes. Their shooting range extends to the parking lot.
  • Ankle Breaker Award - Their crossover sends defenders to the chiropractor. Handles so smooth they should come with a warning label.
  • Paint Beast - Dominates the post like they own real estate down there. Rebounds and putbacks are their specialty.

Defensive Excellence Awards

  • Lockdown Defender - Their opponent's scoring average drops by half. Defense so tight it needs its own zip code.
  • Block Party Host - Sends more shots back than anyone in the gym. The rim protector every team needs.
  • Steal Machine - Quick hands and quicker feet. Opponents never feel safe with the ball.

Team Impact and Character Awards

  • Floor General - The point guard who runs the offense like a maestro. Sees passes others don't even dream about.
  • Sixth Man Supreme - First off the bench, instant offense. Changes the game's momentum every time they check in.
  • Glue Guy/Girl Award - Does all the little things that don't show up in the stats. Makes everyone better.
  • Most Improved Shooter - From bricks to buckets. Their shooting percentage climbed all season long.
  • Hustle Award - Dives for every loose ball, takes every charge. Leaves everything on the court every game.
  • Team Spirit Award - Loudest cheerleader from the bench, first to help teammates up. The heart of the team.

The Fun Ones

  • Air Ball Artist - Their shots need flight attendants. But they keep shooting with confidence, and that's what matters.
  • Human Highlight Reel - Every play is a potential SportsCenter moment. Makes the spectacular look routine.
  • Trash Talk Champion - Keeps everyone entertained with their running commentary. Could do play-by-play while playing.

Engraving Examples

  • MVP Trophy: MOST VALUABLE PLAYER / [Player Name] / 2024-25 Season
  • Scoring Champion: LEADING SCORER / [Player Name] / 18.5 PPG - 2025
  • Team Award: CONFERENCE CHAMPIONS / [Team Name] / Record: 22-3

Basketball is about more than buckets and boards. Recognize the player who sets the best screens, the one who always makes the extra pass, and the bench player who keeps morale high. These contributions matter just as much as points scored.

Frequently Asked Questions About Basketball Trophies

What trophy sizes work best for different basketball award categories?

Recreational leagues for players ages 6 to 9 benefit from 6-inch to 8-inch participation trophies that every player receives, meaningful to a young athlete and easy to display at home. Youth leagues ages 10 to 14 step up to 8-inch to 12-inch trophies for placement finishers, with the size difference signaling achievement without a significant cost increase. AAU and travel program tournaments call for 14-inch to 20-inch trophies for champions and finalists, with premium resin sculptures popular for their detail and display value. High school individual honors like MVP, Leading Scorer, and Best Defender warrant 12-inch to 16-inch column trophies or plaques that stand apart from standard participation pieces. League and tournament grand champions deserve 20-inch to 24-inch multi-column championship trophies that make an impression at the awards table.

What details should basketball trophy engraving include?

The most meaningful trophies are engraved with more than just a name. For team awards, include the league or program name, team name, finishing position, and season year - for example: Metro Recreation Basketball, Division 1 Champions, Winter 2025. For individual player awards, add the player name, award title, and season - for example: Jordan Williams, Most Valuable Player, Lincoln High School Varsity Basketball, 2024-2025. Position-specific language makes individual trophies feel personal rather than generic - titles like Point Guard of the Year, Defensive Player of the Year, or Sixth Man Award convey something a simple MVP label does not. Statistical achievements gain impact through specific numbers like 24.5 Points Per Game or 312 Season Rebounds when space permits. Keep text concise and readable, prioritizing the most meaningful details when space is limited.

Should youth basketball programs give trophies to every player or only award winners?

Youth programs serving players under 12 benefit significantly from universal participation trophies acknowledging every athlete who completed the season, building confidence and encouraging return the following year. Even participation-focused programs should maintain competitive recognition with larger trophies for MVP, Most Improved, Best Sportsmanship, and Coach awards, teaching young athletes that exceptional effort earns special recognition. Middle school and high school programs appropriately shift toward merit-based awards recognizing championships, all-conference selections, and individual statistical leaders, preparing athletes for increasingly competitive environments.

If you need more information before deciding, see our expert resource section:

Be sure to also browse our complete trophies and awards collection to explore additional designs for every sport and occasion.

]]>
trophiesBasketball
custom-pagefree-sports-templates1"Download Only"free-fantasy4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Basketball: Almost Doesn't Count. Ideal for leagues, schools, and tournaments. Instant download.fantasy-basketball-almost-Mainfantasy-basketball-almostBasketball, Fantasy Basketball, Losercustom-pagefree-sports-templates1"Download Only"free-fantasy4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Basketball: Asleep at the Wheel. Ideal for leagues, schools, and tournaments. Instant download.fantasy-basketball-asleep-Mainfantasy-basketball-asleepBasketball, Fantasy Basketball, Losercustom-pagefree-sports-templates1"Download Only"free-fantasy4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Basketball: Comeback of the Year Free Template. Ideal for leagues, schools, and tournaments. Instant download.fantasy-basketball-comeback-Mainfantasy-basketball-comebackBasketball, Fantasy Basketballcustom-pagefree-sports-templates1"Download Only"free-fantasy4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Basketball: No Place To Go But Up. Ideal for leagues, schools, and tournaments. Instant download.fantasy-basketball-up-Mainfantasy-basketball-upBasketball, Fantasy Basketball, Losercustom-pagetrophies-bass-fishing1trophies498551-310.452429Trophies1Find this popular Bass Fish trophy discounted at TrophyCentral. Features a real marble base, stylish 4-inch gold cup, free engraving and fast shipping.bass-fish-cup-place-trophycustom-pageplaques1"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498852-310.45811.6Quick TrophyPlaquesInsert1:14%,3:14%"Fishing Awards"See this stunning Bass Fish plaque and other Holographic Plaques at TrophyCentral.qsinplaqbassfishFishing, Sportscustom-pagetrophies-bass-fishing1trophies498551-310.452429Trophies1Find our Bass Fish star column trophy discounted at TrophyCentral. Features a real marble base, 6 inch gold star-shaped column, free engraving and fast shipping.bass-fish-star-column-trophycustom-pagequickshiptrophies-bass1trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular fishing bass figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at trophyCentral. Ships in a fast 1-2 days!qtbassplFishing, 1st / 2nd / 3rd / Etc., Sportscustom-pagequickshiptrophies-bass1"1-4 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%This popular Bass Fish Figure trophy features a real marble base, column, figure and trim indicating year of award. Includes up to three lines of free engraving!qtbassyrFishing, Sportscustom-pagetrophies-bass-fishing1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with bass figure discounted at TrophyCentral. Includes free text engraving!cup-bass-pFishing, Sportscustom-pagetrophies-bass-fishing1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these bass budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtbassscbFishing, Sportscustom-pagequickshiptrophies-bass1"1-4 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:27%Find these fabulous two-tier Bass Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtbassttFishing, Sportscustom-pagequickshiptrophies-bass1"1-4 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-411.2115Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%See this championship trophy with a Bass Fish figure at TrophyCentral. Be sure to see all of our Bass Fish figure awards.qtbassttwFishing, Sportscustom-pagequickshiptrophies-bass1"1-4 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%This popular Bass Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtbassscFishing, Sportscustom-pagequickshiptrophies-bass1"1-4 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451623.65Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%These quick-ship trophies from TrophyCentral feature a Bass Fish figure, real marble base and marble trophy figure platform, choice of column size and color.qtbassdmFishing, Sportscustom-pagetrophies-bass-fishing1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Bass figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-bass-scbFishing, Sportscustom-pagequickshiptrophies-bass1"1-4 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-411.4118Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find These Fabulous Bass Fishing Three Column Champions Line Trophies Discounted Online at TrophyCentral. Fast 1-2 Day Shipping!qtbass3cFishing, Sportscustom-pagequickshiptrophies-bass1"1-4 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%,25:23%,50:29%,100:34%Our Bass Fishing Participation Trophies feature a real slant-front white marble base and free personalization. Significant quantity discounts available.qtbassncFishing, Sportscustom-pagequickshiptrophies-bass1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.41234Quick TrophyTrophiesPerpetual Trophies1:14%,3:15%,10:16%"Fishing Trophies" "Fishing Awards"Find this Perpetual Bass Fishing Trophy Discounted at TrophyCentral. Each Trophy has enough room for 32 names. Ships in just 1-2 days.qtbassperpSee our completesection.trophies-bass-fishingFishing, Sportscustom-pagetrophies-marlin-fishingqtbassncqtbassscqtbassdmqtbassyrqtbassplqtbassttqtbassttwqtbass3cwbt790qtbassperpmqtbassscbcup-bass-pcup-bass-scbfishing-champ-ifishing-plaque-ifishing-e-part-ifishing-e-single-icup-fishing-scb-icup-fishing-inbass-fish-cup-place-trophybass-fish-cup-place-column-trophybass-fish-star-column-trophy1trophies1"Fishing Awards" "Sports Trophies"Find a great selection of Bass Trophies discounted at TrophyCentral. Each Bass Trophy includes free personalization. Be sure to see all of our fishing trophies and awards.Find Custom Fishing Trophies with Ease! TrophyCentral has a great selection of bass and marlin fishing trophies, low prices, bulk discounts and top-rated customer service. Be sure to see our popular single column fishing trophies, available in several sizes and with several different color columns, and our place trophies with a choice of 1st, 2nd or 3rd place trim. If you need help, feel free to contact our customer service reps online or toll-free in Michigan, New York and online.]]>fishing-medals trophiesFishing (Bass)custom-pagemusicartpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsMusic, Drama, Art, Dance1:22%,50:30%,100:33%,500:45%"Music Lapel Pins" "Band Lapel Pins" "Music Pins"Find These Bassoon Lapel Pins Discounted at TrophyCentral. Features a Clutch-Pin Back and Fast 1-2 Day Shipping!mp4Music / Band / Choruscustom-pagetrophies-baseball12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-31130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Batter and Catcher Baseball Litho Medal Insert. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.502074Baseball / T-Ball, Sports
custom-pagefreeawardcertificates1"Download Only"free-cooking4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our BBQ template is free and designed exclusively for TrophyCentral. BBQ templates and award certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.BBQ-cook-off-templatebbq-cook-off-521Cooking / Culinarycustom-pagemascotpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:30%,50:36%,100:46%,500:52%"Mascot Awards"Find These Bear Lapel Pin with Antique Finish Discounted at TrophyCentral! Also See Our Other Fabulous School Mascot Pins. Fast 1-2 Day Shipping!pm11Mascotcustom-pageplaques1plaques498552-41JDSPlaques1Find this bear plaque discounted at TrophyCentral. Our bear mascot plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Mascotcustom-pagemascottrophies1"4-6 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511016.25Classic MedallicsTrophiesAcademic1:22%,5:24%,10:28%,50:32%"Mascot Awards"Buy this Bear mascot trophy and other mascot awards at TrophyCentral.mt200904-01-2018Mascotcustom-pagemascot-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoName Badges1Find These Custom Bear Shaped Mascot Badges Discounted At TrophyCentral.mascotbadges-bearcustom-pagemascotinserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsMascots1Buy these quality Bears Mascot Medal Inserts at TrophyCentral. Each Bears Insert can be used to create a unique plaque, medal or trophy.489929Mascot
11Find these beautiful Cherry and Black insert plaques discounted at TrophyCentral. Each plaque features free engraving.custom-pagetagsbadges1sechfornaba1240169-1210.45502.45RoanokeName Badges1Find custom uniform badges discounted at TrophyCentral. Each uniform badge features your text and logo (optional). Fast shipping!custom-pagemedallion-inserts-general-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Homecoming Sashes" "Sashes" "Homecoming Sash" "School Sashes" "Pageant Sashes" "Custom Sashes" "Beauty Pageant Sashes" "Graduation Sashes" "Pageant Sash" "Promo Sashes" "Prom Sash" "Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these high-quality Beauty Pageant Inserts at TrophyCentral. Each Beauty Pageant Insert can be used to create a unique plaque, medal or trophy.518402Beauty Queen
custom-pagetrophies-beauty-queen1trophies498551-310.452429Trophies1Find this popular Beauty Queen trophy discounted at TrophyCentral. Features a real marble base, stylish 4-inch gold cup, free engraving and fast shipping.beauty-queen-cup-place-trophycustom-pagetrophies-beauty-queen1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Fabulous Beauty Queen Figure trophy with choice of 1st, 2nd or 3rd place trim.qtbeautplBeauty Queen, 1st / 2nd / 3rd / Etc.custom-pagetrophies-beauty-queen1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%This popular Beauty Queen Figure trophy features a real marble base, column, figure and trim indicating year of award. Includes up to three lines of free engraving!qtbeautyrBeauty Queencustom-pagetrophies-beauty-queen1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with beauty queen figure discounted at TrophyCentral. Includes free text engraving!cup-beaut-pBeauty Queencustom-pagetrophies-beauty-queen1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these beauty queen budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtbeautscbBeauty Queencustom-pagetrophies-beauty-queen1498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Find this budget beauty queen award trophy discounted at Trophy Central. Features a real marble base and plastic beauty queen figure. Engraving is free. Fast 1-2 day shipping.bdg-beauty-queenBeauty Queencustom-pagetrophies-beauty-queen1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous Beauty Queen Two-Tier Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qtbeautttBeauty Queencustom-pagetrophies-beauty-queen1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.2115Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%See this championship trophy with a Beauty Queen figure at TrophyCentral. Be sure to see all of our Beauty Queen figure awards.qtbeautttwBeauty Queencustom-pagetrophies-beauty-queen1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:28%This popular Beauty Queen Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtbeautscBeauty Queencustom-pagetrophies-beauty-queen1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.05Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:15%Find This Popular Beauty Queen Deluxe Platform Series Trophy Discounted at TrophyCentral. Real Marble Base; Free Personalization!qtbeautdmBeauty Queencustom-pagetrophies-beauty-queen1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Beauty Queen figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-beaut-scbBeauty Queencustom-pagetrophies-beauty-queen1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.4118Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous two-tier, 3-column champion Beauty Queen Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtbeaut3cBeauty Queencustom-pagemedallion-inserts-general-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-31130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these quality Beauty Queen Inserts (Litho) at TrophyCentral. Each Beauty Queen Insert can be used to create a unique plaque, medal or trophy.502441Beauty Queen
custom-pagetrophies-beauty-queen1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:27%Our popular Beauty Queen participation trophies feature a real slant-front marble base and free engraving.qtbeautncBeauty Queencustom-pagetrophies-beauty-queen1trophies498551-310.452429Trophies1Find our Beauty Queen star column trophy discounted at TrophyCentral. Features a real marble base, 6 inch gold star-shaped column, free engraving and fast shipping.beauty-queen-star-column-trophycustom-pageaward-medalsqtbeautncqtbeautscqtbeautyrqtbeautplqtbeautttqtbeautttwqtbeaut3cqtbeautdmmqtbeautscbcup-beaut-scbcup-beaut-pbdg-beauty-queenbeauty-queen-cup-place-column-trophybeauty-queen-cup-place-trophybeauty-queen-star-column-trophy1trophies1"Homecoming Sashes" "Sashes" "Homecoming Sash" "School Sashes" "Pageant Sashes" "Custom Sashes" "Beauty Pageant Sashes" "Graduation Sashes" "Pageant Sash" "Promo Sashes" "Prom Sash"Find beauty queen trophies discounted at TrophyCentral. Each beauty queen trophy includes free engraving. Fast 1-2 day shipping!TrophyCentral has been supplying pageants, schools, and organizations with quality awards since 1999. All beauty queen trophies include up to three lines of free engraving. Need awards in a hurry? Orders typically ship in just 1–2 business days. Browse our complete trophies collection for additional styles and designs.

]]>
Beauty Queen
custom-pagemascotpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:22%,50:30%,100:33%,500:47%"Mascot Awards"Find these Bee Lapel Pins and other colorful mascot pins at TrophyCentral. Fast 1-2 day shipping!em17General, Academiccustom-pagetrophies-beer-pong1trophies498551-310.452429Trophies1Find this popular Beer Pong place trim insert trophy discounted at TrophyCentral. Features a real marble base, stylish 4-inch gold cup, free engraving and fast shipping.beer-pong-cup-place-trophy-icustom-pagebeer-pong-medals20medals498551-30.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful Beer Pong 2" Epoxy-covered insert decal discounted at TrophyCentral. Fast 1-2 day shipping.Beer Pongcustom-pagefreeawardcertificates1"Download Only"free-sports4985501Trophy CentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Honorable Mention Place Beer Pong template is free and designed exclusively for Trophy Central. Beer Pong certificate templates measure 11" x 8 1/2" and can be easily downloaded and printed.beer-pong-certificatebeer-pong-frBeer Pongcustom-pagetrophies-beer-pong1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Beer Pong Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Beer Pongcustom-pagetrophies-beer-pong1trophies498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Beer Pong insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-Beer Pong-InsertBeer Pongcustom-pagetrophies-beer-pong1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Beer Pong single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - Beer PongBeer Pongcustom-pagetrophies-beer-pong1trophies498551-311821.06TrophyCentralTrophies1Beer Pongcustom-pagetrophies-beer-pong1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Beer Pong Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Beer Pongcustom-pagetrophies-beer-pong1medals498551-30.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this Colorful Beer Pong Insert Medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Beer Pongcustom-pagetrophies-beer-pong1medals498551-30.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this Beer Pong insert medal With A Personalized Front Rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Beer Pongcustom-pageplaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these beer pong insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Beer Pong11Find beer pong medals discounted at TrophyCentral. Each beer pong medals features a free neck ribbon. Fast 1-2 day shipping.Beer Pongcustom-pagetrophies-beer-pong1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Beer Pong insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - Beer PongBeer Pongcustom-pagetrophies-beer-pong1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Beer Pong Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Beer Pongcustom-pagehorseshoesbeer-pong-part-ibeer-pong-single-ibeer-pong-champ-ibeer-pong-e-part-ibeer-pong-e-single-icup-beer-pong-inbeer-pong-mcbeer-pong-mc-prbeer-pong-jigfbeer-pong-jibfbeer-pong-jisfbeer-pong-cup-place-trophy-ibeer-pong-cup-place-column-trophy-i1trophies1Find beer pong trophies discounted at TrophyCentral. Each beer pong trophy includes up to 3 lines of engraving. Beer pong medals feature a free ribbon.TrophyCentral has been supplying leagues, organizations, and events with quality awards since 1999. All beer pong trophies include up to three lines of free engraving. Need awards in a hurry? Orders without engraving typically ship in 1-2 business days and sometimes the same day, depending on time of year and when the order is placed. Browse our complete trophies collection for additional styles and designs.

]]>
trophies trophies-funny-horses-rearBeer Pong
custom-pagetrophies-basketball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451614.05Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,50:30%Bendable Basketball Award with Column. Ideal for leagues, schools, and tournaments. Fast shipping.qtbaskbescBasketball, Sportscustom-pagetrophies-basketball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.452417.25Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,50:31%Bendable Basketball Award. Ideal for leagues, schools, and tournaments. Fast shipping.qtbaskbencBasketball, Sports11Shop for Bendable Trophies at TrophyCentral. Bendable trophies feature popular sports figures and free engraving.1custom-pagegeneral-corporate-awards1"14 business days" "Erlanger, KY" "UPS"general410187-1010.451 2 3 4 5 6 7 8 9414.45JcharlesTrophies1:22%,25:24%Find these fabulous Bent Glass Corporate Awards with free engraving at TrophyCentral.custom-pagefreeawardcertificates1"Download Only"free-camp4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Best Camper Award template (male) is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.best-boy-camperbest-camper-mCampingcustom-pagefreeawardcertificates1"Download Only"free-camp4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Best Camper Award template (female) is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.best-girl-camperbest-camper-fCampingcustom-pagefree-sports-templates1"Download Only"free-sports49855011TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"See this Coach Certificate designed exclusively for TrophyCentral! Coach Certificates can be downloaded for free!coachfrCoach, Sports11Discover top golf destinations for multi-day trips including Pinehurst, Bandon Dunes, Scottsdale, and Myrtle Beach. Complete travel planning with course recommendations, resort amenities, and seasonal tips.custom-pagefreeawardcertificates1"Download Only"certificates49855011TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Best husband template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Best-husband-Certificatebest-husband-freeBest Husbandstandout-awardsshare-moment-submission11Submit one photograph to the TrophyCentral Standout Awards. Any subject, any style. The community votes, a panel of judges scores, and the winner receives an engraved trophy shipped to their door. Round One open now through March 18.11Find the perfect trophy for 9-10 year old soccer players. Expert recommendations on trophy sizes, styles, and budget options for U10 youth teams.11Shop for Bicycle Medals and Lapel Pins at TrophyCentral. Bicycle Medals and Pins Ship in Just 1-2 Days!bicycle medals, bicycle medal,bike medalstrophies-bicycle-cyclingBicycle / Cyclingcustom-pagesports-inserts11-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Bicycle Inserts (Litho) at TrophyCentral. Each Bicycle Insert can be used to create a unique plaque, medal or trophy.507398Bicycling / Cycling, Sports
custom-pagetrophies-billiards1trophies498551-310.452429Trophies1Find this popular Billiards trophy discounted at TrophyCentral. Features a real marble base, stylish 4-inch gold cup, free engraving and fast shipping.billiards-cup-place-trophycustom-pagetrophies-billiards1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular billiards figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at trophyCentral. Ships in a fast 1-2 days!qtbilliplBilliards, 1st / 2nd / 3rd / Etc.custom-pagetrophies-billiards1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%This popular Billiards trophy features a real marble base, column, figure and trim indicating year of award. Includes up to three lines of free engraving!qtbilliyrBilliardscustom-pagetrophies-billiards1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with billiards figure discounted at TrophyCentral. Includes free text engraving!cup-billi-pBilliardscustom-pagetrophies-billiards1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these billiards budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtbilliscbBilliardscustom-pagetrophies-billiards1trophies498551-310.453633.4Trophies1Find this budget billiards award trophy discounted at TrophyCentral. Features a real marble base and plastic billiards player figure. Engraving is free. Fast 1-2 day shipping.Billiardscustom-pagetrophies-billiards1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511230.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,6:23%,12:24%,24:26%Shop for Cast Stone Billiards Awards at TrophyCentral. We have a great selection of Billiards and other recognition trophies at discounted prices.tr9927Billiardscustom-pagetrophies-billiards1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous two-tier Billiards Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtbillittBilliardscustom-pagetrophies-billiards1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.2115Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%See this championship trophy with a Billiards figure at TrophyCentral. Be sure to see all of our Billiards figure awards.qtbillittwBilliardscustom-pagetrophies-billiards1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%This popular Billiards Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtbilliscBilliardscustom-pagetrophies-billiards1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451623.65Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%These quick-ship trophies from TrophyCentral feature a Billiards figure, real marble base and marble trophy figure platform, choice of column size and color.qtbillidmBilliardscustom-pagetrophies-billiards1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Billiards figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-billi-scbBilliardscustom-pagetrophies-billiards1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.4118Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous two-tier, 3-column champion Billiards Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtbilli3cBilliardscustom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Billiards Inserts (Litho) at TrophyCentral. Each Billiards Insert can be used to create a unique plaque, medal or trophy.49320112-20-2020Billiards
custom-pagetrophies-billiards1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%,25:23%,50:29%,100:34%Our popular Billiards participation trophies feature a real slant-front marble base and free engraving.qtbillincBilliardscustom-pagetrophies-billiards1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.41234Quick TrophyTrophies1:14%,3:15%,10:16%Find this Perpetual Billiards Trophy Discounted at TrophyCentral. Each Trophy has enough room for 32 names. Ships in just 1-2 days.qtbilliardperpReturn to thesection for additional styles.trophies-billiardsBilliardscustom-pagetrophies-billiards1trophies498551-310.452429Trophies1Find our Billiards star column trophy discounted at TrophyCentral. Features a real marble base, 6 inch gold star-shaped column, free engraving and fast shipping.billiards-star-column-trophycustom-pageaward-medalsqtbillincqtbilliscqtbillidmqtbilliyrqtbilliplqtbillittqtbillittwqtbilli3ctr9927qtbilliardperpmqtbilliscbcup-billi-scbcup-billi-pbdg-billiardsbilliards-cup-place-column-trophybilliards-cup-place-trophybilliards-star-column-trophy1trophies1Find billiards trophies discounted at TrophyCentral. Each billiards trophy includes 3 lines of personalization. Medals feature a free ribbon.

Custom Billiards Trophies & Awards - Honor Every Break, Run, and Champion

Billiards trophies celebrate the precision, strategy, and cool-headed competition that define the world of cue sports. From casual bar leagues where players sharpen their skills on weeknight eight-ball, to organized pool halls running structured nine-ball tournaments, from corporate charity scrambles bringing colleagues together around the table to serious snooker and three-cushion billiards competitions where every shot demands mastery, quality billiards awards recognize players and organizers across every level of the game. Our versatile trophies feature classic column designs with detailed pool table and cue ball toppers that instantly communicate the sport, sleek acrylic awards with engraved personalization suited to modern venues and corporate events, resin sculptures capturing the drama of a decisive break shot, and customizable engraving plates documenting tournament placements, season statistics, and the individual achievements every serious player works to earn.

Frequently Asked Questions About Billiards Trophies

What trophy sizes work best for different billiards award categories?

Participation and consolation awards for recreational leagues and corporate events work well as 6-inch to 9-inch economy trophies, providing affordable recognition for every player without straining an event budget. Individual category honors such as high run, best break, and most improved player deserve 10-inch to 14-inch single column trophies with billiards toppers, creating meaningful distinction within a competitive field. Division winners and tournament runner-up honors warrant 15-inch to 18-inch premium trophies with substantial presence befitting a strong performance across multiple rounds of play. League championships, tournament titles, and end-of-season series winners demand 20-inch to 24-inch multi-column championship trophies with the height and weight that reflect the achievement of outlasting an entire field of competitors. Corporate and charity events often pair engraved acrylic awards for all participants with larger traditional trophies for finalists and champions, balancing broad recognition with meaningful competitive distinction.

What details should billiards trophy engraving include?

Comprehensive engraving preserves tournament memories beyond fading bracket sheets. Essential elements include player name, award title, league or event name, and year. Examples: Ray Deluca, Tournament Champion, Westside Eight-Ball Classic, 2025 or Diane Park, Women's Division Winner, Metro Pool League, Fall 2025. Performance achievements gain impact through specific details like High Run 47 or Undefeated Round Robin when space permits. Season-long league titles benefit from noting win-loss records such as League Champion, 18-2. Corporate and charity event trophies often forgo statistics in favor of the event name and sponsor, keeping the award relevant to all participants. Keep text concise and readable, prioritizing the most meaningful details when space limitations require choices.

How should billiards leagues and tournaments structure their awards?

Recreational bar leagues and casual events benefit from broad recognition where every participant receives at minimum a small trophy or engraved award, reinforcing the social and competitive spirit that keeps players coming back each season. Even participation-focused events should maintain competitive distinction by presenting larger trophies for flight winners, most valuable player, and sportsmanship honors, rewarding the players who elevated the competition. Serious tournament and league play appropriately shifts toward merit-based awards where trophies recognize genuine achievement in championship rounds, division titles, and statistical excellence, reflecting the higher stakes that competitive players expect. Corporate and charity formats work best with a tiered approach combining modest participation keepsakes for all entrants with distinctive awards for finalists and overall winners, ensuring every guest leaves with a memorable token of the event while champions receive recognition proportional to their performance.

If you need more information before deciding, see our expert resource section:
]]>
Billiards
custom-pagefreeawardcertificatesbirthdaygirl1birthdaygirl 962"Download Only"certificates49855011TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"See this Birthday (Boy) Certificate designed exclusively for TrophyCentral! Birthday (Boy) Certificates can be downloaded for free! Each birthday certificate measures 11 x 8 1/2 inches.birthdayboyBirthday, Holidaycustom-pagebirthdayboy1"Download Only"certificates49855011TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"See this Birthday (Girl) Certificate designed exclusively for TrophyCentral! Birthday (Girl) Certificates can be downloaded for free!birthdaygirlBirthday, Holidaycustom-pagegift-certificate-templates1"Download Only"certificates4985501Trophy CentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our birthday themed template is free and designed exclusively for Trophy Central. This gift certificate measures 5" x 3" and can be easily downloaded and printed.Birthday-Gift-Certificategc-birthday-521Birthday, Gift Certificate, Holidaycustom-pagename-desk-signs1498552-411020Nameplates1:22%This Wonderful black acrylic desk wedge includes name plate and text engraving!noindexed-items111custom-pagefree-school-certificate-templates1"Download Only"certificates49855011TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Black History Month template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Black-History-Month-Certificateblack-history-month-freeBlack History, Academiccustom-pagecertificateplaques1plaques498553-4141239Plaques1Find this black marble certificate plaque with a gold frame discounted at TrophyCentral. Measures 10 1/2 x 13 and holds an 8 1/2 x 11 certificate or diploma.custom-pagecertificateplaques1plaques498553-4141239Plaques1Find this black marble certificate plaque with a silver frame discounted at TrophyCentral. Measures 10 1/2 x 13 and holds an 8 1/2 x 11 certificate or diploma.certificate-plaque-bm-gcustom-pagemascottrophies1"4-6 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511016.25Classic MedallicsTrophiesAcademic1:22%,5:24%,10:28%,50:32%"Mascot Awards"Find black panther trophies discounted at TrophyCentral. Each mascot and panther trophy includes engraving. Fast shipping!mt20024-15-2018Mascotcustom-pageclocks1"1-2 business days" "Marquette, MI" "UPS"personalized gifts498852-310.451214.85Quick TrophyGiftsClocks1:14%"New Products"Shop our high-quality black piano finish engraved clock from Trophy Central. 10"x13" clock plaque includes up to 4 lines of engraving! Shop now!10x13blackpianoclockEngraved Clocks11Find Black Plaques with custom engraving at TrophyCentral. Quantity discounts. Fast turnaround. Free shipping over $99.custom-pagestar-trophies1"4-6 business days " "Mount Vernon, NY" "UPS"trophies105503-610.4511229.25Classic MedallicsTrophiesGeneral1:22%,20:24%Shop for 7 Inch Black Star Resin Trophy from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.05-15-2017custom-pagestar-trophies1"4-6 business days " "Mount Vernon, NY" "UPS"trophies105503-610.4512420.13Classic MedallicsTrophiesGeneral1:22%Shop for Black Stone Resin Trophies from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.Generalcustom-pageplaques1"1-2 business days" "Marquette, MI" "UPS"plaques498852-310.51017.50Quick TrophyPlaquesColor Plaques1:14%,3:17%"New Products"Shop our black matte-finish plaque with choice of gold or white plate featuring sublimated black text. Option to add logo, includes up to 13 lines of engraving!10x8blackfinishBlank, Generalcustom-pageplaques1"1-2 business days" "Marquette, MI" "UPS"plaques498852-310.51034.50Quick TrophyPlaquesColor Plaques1:14%,3:17%"New Products"Find These Beautiful 12 x 9 Inch Horizontal Matte Black Finish Plaques Discounted And With Free Engraving At TrophyCentral.12x9blackfinishBlank, Generalcustom-pageplaques1"1-2 business days" "Marquette, MI" "UPS"plaques498852-310.51013.80Quick TrophyPlaquesColor Plaques1:14%,3:17%"New Products"Find These Beautiful 7 x 9 Inch Vertical Matte Black Finish Plaques Discounted And With Free Engraving At TrophyCentral.7x9blackfinishBlank, Generalcustom-pagetrophies-general1trophies498551-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with an engraveable insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-blank-Insertcustom-pageblank-medals1blank-medalsmedals498552-40.525033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%This blank engraving medal features your custom text on the front of the medal and optional engraving on the back. Ships in just 2-3 days.custom-pagecustomlapel1customlapellapel pins498551-210.361500225.36TrophyCentralLapel Pins1:14%,10:16%"Lapel Pins" "Custom Lapel Pins" "Trading Pins" "Custom Trading Pins" "Lapel Trading Pins"Find Blank Lapel Pins Discounted at TrophyCentral. Each Blank Pin Features Up to 2 Lines of Free Engraving!Return to oursection for other great choices.

Frequently Asked Questions (FAQ)

🔖 What are engraveable pins?

Engraveable pins are special lapel pins that feature a **blank area designed for custom engraving**. These are perfect for adding names, dates, titles, or short messages to recognize achievements and milestones.

🛠️ What engraving options are available?

We offer **laser engraving and diamond drag engraving** for a crisp and professional finish. You can personalize your pin with **names, dates, titles, or a short message**.

🏆 What are some common uses for engraveable pins?

Engraveable pins are widely used for **employee recognition, volunteer appreciation, years of service awards, and school achievements**. They are also great for clubs, organizations, and special events.

📏 What size and shape options are available?

Most engraveable pins come in **classic rectangular, oval, and circular designs**, with sizes typically ranging from **0.75 inches to 2 inches**.

📦 Do you offer bulk discounts for large orders?

Yes! We provide **discount pricing** for bulk orders. The more you order, the greater the savings.

⏳ How long does engraving take?

Most engraveable pins are engraved and shipped within **5-7 business days**. Rush options may be available upon request.

🎁 Are engraveable pins a good gift idea?

Absolutely! Custom-engraved pins make **thoughtful gifts** for employees, volunteers, students, and club members. They are a lasting token of appreciation and achievement.

]]>
custom-pageblank-medals1medals498552-40.525033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%This unique medal features an engravable front rim for your team or even name and a personalized front for your text.custom-page1st-place-medalsblank-front-medalblank-rim-medal1blankmedalcustom-jigflogo-rim-medallogo-star-medal1custommedals1Personalize any event or activity with our selection of blank medals for engraving. Choose from plain engraving styles, rim imprint, and logo insert options in gold and silver finishes. Each blank medal includes a free neck ribbon. Fast 1-2 day order processing.

Blank Medals for Engraving - Personalized Awards for Any Occasion

Blank medals offer maximum flexibility for leagues, schools, and organizations that need a clean award surface ready for any text, logo, or artwork. Where sport-specific medals feature a pre-set design, blank medals let your engraving or custom insert do the talking, making them practical for activities outside mainstream sports, multi-event programs recognizing diverse achievements, and organizations that want their name or logo as the centerpiece of the award. Choose from plain engraving styles for straightforward text personalization, rim-print designs that add your event name around the outer edge, and logo insert options that incorporate full color artwork into a polished medal frame. Gold and silver frame finishes with black or gold engraving plate options allow coordinators to match existing award sets or establish a consistent look across an entire recognition program.

Frequently Asked Questions About Blank Medals

What is a blank medal and when should I choose one?

A blank medal has a plain front surface personalized through engraving, imprinting, or a custom insert rather than a pre-cast sport or activity design. They are the right choice when the organization or event name should be the primary focus, when the activity does not have a dedicated sport-specific medal available, or when the same medal design needs to work across multiple activities at a single event. Schools presenting engravable medals across a wide range of subjects at one ceremony often choose blank medals for consistency, as do charity runs, corporate recognition programs, and community events where event branding matters more than activity imagery.

What are my personalization options for blank medals?

Standard engraving medals accept text directly on the front face, with gold text on a black plate or black text on a gold plate available depending on the model. Rim personalization adds your school, organization, or event name around the outer ring for a polished branded look. Logo insert styles incorporate a full color artwork disc into the center of the medal frame, and the epoxy dome insert option adds a protective raised coating for a premium finished appearance. For large events, engraving recipient names and award details on the back is an efficient way to personalize at scale while keeping the front design consistent across all recipients.

What sizes and finishes are available for blank medals?

Blank medals are available in 1-1/4 inch and larger sizes depending on the style selected. Smaller medals suit large participation events where volume and affordability are priorities, while larger medals make a stronger visual impact for featured award categories. Gold frames are the traditional choice for top achievement recognition while silver frames work well for second-place awards or programs preferring a consistent look across all levels. Engraving plate choices, gold text on black or black text on gold, allow further customization within each frame style. All blank medals include a free neck ribbon.

If you need more information before deciding, see our expert resource section:
]]>
custommedals 1blankmedal medals-generalBlank Medals
custom-pageplaques11"4-6 business days with engraving" "Mt. Vernon, NY" "UPS (FedEx available on request)"plaques105503-610.451813.25Classic MedallicsPlaquesBlank Plaques1:22%Shop for Blank Shield Plaque from TrophyCentral. Discounted Trophies, Awards and Promotional Products.07-30-2018custom-pageacrylicawards11"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"general105503-610.451515.45Classic MedallicsCrystal Awards1:30%Shop for Blue Acrylic Iceberg Awards from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.custom-pagetrophies-livestock-farm-animals10first-place-ribbonsribbons465711-21 26Tower RibbonRibbons1Shop blue ribbons for awards, schools and competitions. Wide selection, fast shipping and great pricing from TrophyCentral.custom-pagebottles-st80"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14142013.4Glass AmericaPromotional ProductsSports / Water Bottles1:14%,640:31%"Basketball Water Bottles" "Logo Sports Bottles" "Sports Bottles" "Promotional Sports Bottles" "Aluminum Sports Bottles" "Stainless Water Bottles" "Aluminum Water Bottles" "Bike Water Bottles" "Bicycle Water Bottles" "Baseball Water Bottles" "Football Water Bottles" "Promotional Water Bottles" "Soccer Water Bottles"Find these Blue Backpack Collection Custom Water Bottles at TrophyCentral. Add your own logo or artwork!41084Sports / Water Bottlescustom-pagecertificateplaques1"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"plaques105502-310.451813.25Classic MedallicsPlaquesCertificate Plaques1:14%,10:18%,50:23%,100:27%"Certificate Plaques" "Certificate Plaque" "Plaques That Hold Certificates" "Certificate Holders" "Plaques For Certificates" "Graduation Plaques"Find this Blue Certificate Plaque discounted at TrophyCentral. Each certificate plaque is gift-boxed.pn4642bl04-17-2015Certificates / Sealscustom-pagebottles-st80"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14142014.8Glass AmericaPromotional ProductsSports / Water Bottles1:14%,640:26%Find These Blue Maui Collection Water Bottles Discounted at TrophyCentral. Price Includes One-Color Custom Logo Imprint!11384Sports / Water Bottlescustom-pagemascotinserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsMascots1Buy these quality Blue Devils Medal Inserts at TrophyCentral. Each Blue Devils Medal Insert can be used to create a unique plaque, medal or trophy.489950Mascot
custom-pagecertificateplaques1"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"plaques105502-310.45158.45Classic MedallicsPlaquesCertificate Plaques1:14%,100:25%"Certificate Plaques" "Certificate Plaque" "Plaques That Hold Certificates" "Certificate Holders" "Plaques For Certificates" "Graduation Plaques"See This Popular Blue PN Series Certificate Frame Discounted at TrophyCentral. Measures 10 1/2" x 13" and Holds 8 1/2" x 11" Certificate. Large Quantity Discounts.pn4931blgCertificates / Sealscustom-pageplaques1plaques498552-41JDSPlaques1Find this blue jay plaque discounted at TrophyCentral. Our blue jay mascot plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Mascotcustom-pagemascottrophies1"4-6 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511016.25Classic MedallicsTrophiesAcademic1:22%,5:24%,10:28%,50:32%"Mascot Awards"Buy this Blue Jay mascot trophy and other mascot awards at TrophyCentral.mt2028Mascotcustom-pagemascotinserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsMascots1Buy these quality Blue Jays Mascot Medal Inserts at TrophyCentral. Each Blue Jays Insert can be used to create a unique plaque, medal or trophy.489939Mascot
custom-pageglass-crystal-awards1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"general410187-1010.45464.45JcharlesCrystal Awards1:22%,25:24%"crystal awards"Blue Majestic from TrophyCentral. See our great selection of engraved and personalized gifts!Leadershipcustom-pageblog-trophycentral11Discover why blue ribbons mean first place! Explore the fascinating 150-year history from British horse shows to modern recognition, plus the psychology of why blue wins every time.11Find Blue Ribbons Discounted at TrophyCentral. Each Blue Ribbon Features a Choice of Back. Fast 1 Day Shipping!custom-pagesports-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsGeneral1:22%,50:30%,100:33%,500:47%"Star Award" "Star Awards" "Soccer Pins" "Soccer Lapel Pins" "Football Pins" "Football Lapel Pins" "Basketball Pins" "Basketball Lapel Pins"Blue Stars Letter Pins: EC Series Blue Stars Lapel Pins feature a high-quality enameled finish and ship in just 1-2 business days!ec1212-20-2017Star, General, Academiccustom-pageglass-crystal-awards1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"general410187-1010.45460.45JcharlesCrystal Awards1:22%,25:25%custom-pageplaques1"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498852-310.45811.6Quick TrophyPlaquesInsert1:14%,3:14%See this stunning BMX plaque and other Holographic Plaques at TrophyCentral.qsinplaqbmxBMXcustom-pagetrophies-bmx1trophies498551-310.452429Trophies1Find this popular BMX trophy discounted at TrophyCentral. Features a real marble base, stylish 4-inch gold cup, free engraving and fast shipping.bmx-cup-place-trophycustom-pagetrophies-bmx1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular BMX figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!qtbmxplBMX, 1st / 2nd / 3rd / Etc.custom-pagetrophies-bmx1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%This popular BMX Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!qtbmxyrBMXcustom-pagetrophies-bmx1trophies498852-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with bmx figure discounted at TrophyCentral. Includes free text engraving!cup-bmx-pBMXcustom-pagetrophies-bmx1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these BMX budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtbmxscbBMXcustom-pagetrophies-bmx1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous BMX Champions Line 3-column Trophies discounted online at TrophyCentral. Free Engraving and Quick 1-2 day shipping!qtbmxttBMXcustom-pagetrophies-bmx1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.2115Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%See this championship trophy with a BMX figure at TrophyCentral. Be sure to see all of our BMX figure awards.qtbmxttwBMXcustom-pagetrophies-bmx1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%Find these popular BMX single column trophies discounted and with free personalization at TrophyCentral.qtbmxscBMXcustom-pagetrophies-bmx1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451623.65Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%These quick-ship trophies from TrophyCentral feature a BMX figure, real marble base and marble trophy figure platform, choice of column size and color.qtbmxdmBMXcustom-pagetrophies-bmx1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with BMX figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-bmx-scbBMXcustom-pagetrophies-bmx1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.4118Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous two-tier, 3-column champion BMX Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtbmx3cBMXcustom-pagetrophies-bmx1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%,25:23%,50:29%,100:34%Our popular BMX participation trophies feature a real slant-front marble base and free engraving.qtbmxncBMXcustom-pagetrophies-bmx1trophies498551-310.452429Trophies1Find our BMX star column trophy discounted at TrophyCentral. Features a real marble base, 6 inch gold star-shaped column, free engraving and fast shipping.bmx-star-column-trophycustom-pageaward-medalsqtbmxncqtbmxscqtbmxdmqtbmxyrqtbmxplqtbmxttqtbmxttwqtbmx3cmqtbmxscbcup-bmx-pcup-bmx-scbbmx-cup-place-column-trophybmx-cup-place-trophybmx-star-column-trophy1trophies1Find BMX Sports Trophies Discounted at TrophyCentral. Each BMX Trophy Includes Free Personalization. Fast 1-2 Day Shipping!

Custom BMX Awards and Trophies

TrophyCentral has an industry-leading selection of BMX Trophies. Our BMX bike racing trophies are available in many popular styles, including our popular BMX Participation Trophies, and our Single Column Trophies with a BMX bike figure (choose from many popular column colors). Whether you want to recognize a kid or adult for on or off-road racing, TrophyCentral can help! Each BMX trophy includes up to three lines of free personalization (larger BMX awards include additional lines).
]]>
BMX
custom-pagefree-sports-templates1"Download Only"free-sports49855011TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Boating template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Boating-Certificateboating-freeBoating / Sailing, Sportscustom-pagetrophies-baseball11"1-2 business days + shipping time" "Marquette, MI" "UPS (Post Office Priority Mail may be available on request)"trophies498552-310.453631.05JDS-STrophiesSports, Hobby, Org, Livestock1:22%,10:23%"Baseball Trophies" "Baseball Trophy" "T-Ball Trophies" "T-Ball Awards"Baseball Bobble Head Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.08-10-2013Baseball / T-Ball, Sportscustom-pagetrophies-basketball11"3-4 business days + shipping time" "Marquette, MI" "UPS (FedEx available on request)"trophies498552-310.453631.05JDS-STrophiesSports, Hobby, Org, Livestock1:22%,10:23%Basketball Bobble Head Trophy. Ideal for leagues, schools, and tournaments. Fast shipping.babohe108-30-2022Basketball, Sportscustom-pagetrophies-football11"1-3 business days + shipping time" "Marquette, MI" "UPS (FedEx available on request)"trophies498552-310.453631.05JDS-STrophiesSports, Hobby, Org, Livestock1:22%,10:23%Football Bobble Head Trophy. Ideal for leagues, schools, and tournaments. Fast shipping.fobohe08222023Football, Sports11Buy bobble head trophies at TrophyCentral. Each trophy is discounted and includes personalization.1custom-pagemascotpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:30%,50:36%,100:46%,500:52%"Mascot Awards"Find This Bobcat Lapel Pin with Antique Finish Discounted at TrophyCentral! Also See Our Other Fabulous School Mascot Pins. Fast 1-2 Day Shipping!pm14Mascotcustom-page1"4-6 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)""PT1=Trophies" "PC11=105503-610.4511016.25Classic MedallicsTrophiesAcademic1:22%,5:24%,10:28%,50:32%"Mascot Awards"Buy this Bobcat mascot trophy and other mascot awards at TrophyCentral.1mt2003Mascotcustom-pagemascotinserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsMascots1Buy these quality Bobcats Mascot Medal Inserts at TrophyCentral. Each Bobcats Insert can be used to create a unique plaque, medal or trophy.489951Mascot
noindexed-items1498551See a fabulous selection of Bocce Ball Trophies at TrophyCentral. Each Bocce Ball Trophy Includes Free Engraving!bocce ball trophies, bocce ball trophy, bocce ball awards, bocce ball trophies and awards

Custom Bocce Ball Recognition Trophies

TrophyCentral has a great selection of bocce awards and trophies. Be sure to see our Bocce Ball Place Trophies, available with 1st, 2nd or 3rd place trim, perfect for any lawn bowling or bocce tournament. All of our bocce ball awards include up to three lines of FREE ENGRAVING (larger awards include additional lines). We also offer FREE SHIPPING on award orders over $100 shipping to the continental U.S. ]]>
Bocce Ball
custom-pagetrophies-bocce-ball1trophies498551-310.452429Trophies1Find this popular Bocce Ball trophy discounted at TrophyCentral. Features a real marble base, stylish 4-inch gold cup, free engraving and fast shipping.bocce-ball-cup-place-trophycustom-pagetrophies-bocce-ball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular bocce ball figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!qtbocceplBocce, 1st / 2nd / 3rd / Etc.custom-pagetrophies-bocce-ball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%This popular Bocce Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!qtbocceyrBoccecustom-pagetrophies-bocce-ball1trophies498852-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with bocce ball figure discounted at TrophyCentral. Includes free text engraving!cup-bocce-pBoccecustom-pagetrophies-bocce-ball1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these bocce ball budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtboccescbBoccecustom-pagetrophies-bocce-ball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous Bocce Ball Figure Champions Line 3-column Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qtboccettBoccecustom-pagetrophies-bocce-ball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.751434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:28%Find this awesome Bocce Ball two tier championship trophy discounted at TrophyCentral. Add up to 3 lines of Free Personalization!qtboccettwBoccecustom-pagetrophies-bocce-ball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%Find these popular Bocce Ball Single Column Elite Series Trophies discounted and with free personalization at TrophyCentral.qtboccescBoccecustom-pagetrophies-bocce-ball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.05Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%Find Our Bocce Ball Deluxe Platform Series Trophies Discounted at TrophyCentral. Real Marble Base; Free Personalization!qtboccedmBoccecustom-pagetrophies-bocce-ball1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Bocce Ball figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-bocce-scbBoccecustom-pagetrophies-bocce-ball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.41226Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous two-tier, 3-column champion Bocce Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtbocce3cBoccecustom-pagetrophies-bocce-ball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:38%Our popular Bocce Ball participation trophies feature a real slant-front marble base and free engraving.qtboccencBoccecustom-pagetrophies-bocce-ball1trophies498551-310.452429Trophies1Find our Bocce Ball star column trophy discounted at TrophyCentral. Features a real marble base, 6 inch gold star-shaped column, free engraving and fast shipping.bocce-ball-star-column-trophycustom-pageaward-medalsqtboccencqtboccescqtboccedmqtbocceplqtbocceyrqtboccettqtboccettwqtbocce3cmqtboccescbcup-bocce-pcup-bocce-scbbocce-ball-cup-place-column-trophybocce-ball-cup-place-trophybocce-ball-star-column-trophy1trophies1Find bocce ball trophies discounted at TrophyCentral. Each bocce ball trophy includes free engraving. Browse all of our awards now!

Bocce Ball Trophies and Awards - Honor Every Player, Team, and Tournament Champion

Bocce ball trophies celebrate one of the world's oldest and most social competitive games, honoring the precision, strategy, and camaraderie that define bocce at every level from neighborhood backyard tournaments to organized club league championships. The bocce community spans Italian-American clubs with decades of league tradition, municipal parks and recreation departments running summer bocce programs, retirement communities with active weekly competitive leagues, country clubs hosting member bocce tournaments, and a growing number of organized bocce associations presenting formal championship events with serious competitive stakes. Our bocce ball trophy collection features bocce-specific figurine designs and insert styles in a range of sizes from affordable individual player and participation awards to impressive championship pieces appropriate for the season-ending tournament that every competitive bocce league builds toward. Every trophy includes free engraving personalized with player or team name, award title, league or event name, and season year, and bocce ball medals with free neck ribbons offer an affordable alternative for large tournaments recognizing multiple bracket levels simultaneously.

Frequently Asked Questions About Bocce Ball Trophies

What bocce ball leagues and events use trophies and awards?

Bocce ball trophies are used across a wide range of competitive and social bocce contexts, from formal club leagues with decades of competitive history to casual community events where the trophy is as much about tradition and fun as it is about competitive recognition. Italian-American club leagues running weekly round-robin schedules and end of season playoffs are among the most consistent users of bocce trophies, with champions and runners-up receiving trophies at annual banquets that honor both the competitive results and the community bonds that bocce leagues build over years and decades. Municipal parks and recreation bocce programs present trophies at season-ending tournaments to recognize the competitive achievements of registered league participants, with trophy presentation serving as the ceremonial close of the seasonal program. Retirement community bocce leagues use trophies to bring genuine competitive stakes to a regularly scheduled social activity, and the presentation of a trophy at season's end gives the league's competitive dimension the formal recognition it deserves. Country club bocce tournaments present trophies as part of member event programming alongside other club sports, with the bocce trophy carrying the same status within the bocce community as the golf cup carries among golfers. Backyard and charity bocce tournaments increasingly present trophies and awards to add structure and memorable recognition to what might otherwise be a purely social gathering, giving every participant a reason to remember and talk about the event.

What trophy sizes work best for bocce ball award programs?

Bocce ball trophy sizing should reflect the structure and culture of the specific league or event, with the right size communicating the relative prestige of each award within the overall recognition program. For casual backyard tournaments and social bocce events, mid-size trophies in the 10-inch to 14-inch range strike the right balance between impressive and appropriately lighthearted, giving the winner something genuinely worth displaying without making the award feel out of proportion to the event's social nature. Recreational league season champions and organized club league playoff winners deserve 14-inch to 20-inch trophies that reflect the sustained competition behind the title and serve as a meaningful keepsake from a full season of league play. Formal bocce association championship events and prestigious club tournaments warrant 20-inch to 24-inch multi-column championship pieces that match the competitive investment of the participants and the ceremonial weight of the presentation. For leagues that have run for many years and want to honor their history, perpetual trophies that add a new engraving plate for each year's champion create an award with growing significance that becomes a centerpiece of the league's identity over time. Runner-up and third place awards should be noticeably smaller than the champion trophy to create clear visual hierarchy, with 10-inch to 14-inch trophies for runners-up and medals or 8-inch trophies for third place working well in most league structures.

What details should bocce ball trophy engraving include?

Bocce ball trophy engraving should document the specific competitive achievement and league context so the award remains meaningful as a keepsake long after the season ends. Essential elements include player or team name, award title, league or event name, and year. For individual player trophies: Tony Ferrara, League Champion, Eastside Bocce Club, 2025, or Maria Russo, Most Valuable Player, Riverside Italian-American Bocce League, Summer 2025. For team trophies, listing all team members on the engraving plate adds a communal dimension that individual player trophies cannot provide and makes the award a shared keepsake for the entire winning team: The Ferraras, League Champions, Northside Bocce Association, 2025, Tony Ferrara, Maria Ferrara, Anthony Ferrara. Special category awards such as most points in a season, best single game performance, or most improved player add recognition dimensions that go beyond the championship result and allow leagues to honor multiple players at the awards ceremony. For perpetual trophies tracking league champions year over year, establishing a consistent engraving format from the first year ensures the growing list of champions reads as an organized historical record rather than a collection of different styles. When space on the engraving plate requires choices between elements, player or team name, award title, league name, and year are the four essential pieces that make any bocce trophy a meaningful record of the achievement rather than a generic figurine.

If you need more information before deciding, see our expert resource section:
]]>
Bocce Ball
custom-pageribbons1-tiaras1"1-3 business days" "Topeka, Indiana" "UPS (Post Office Priority Mail also available)"465711-21 260.8244.4Tower RibbonSpiritTiaras1:22%Make a statement with this bold 3 1/4" pageant tiara. All pageant tiaras are discounted and most ship in just 1-2 days.rtp66191-20-2022custom-pageclocks11"7-10 business days w/engraving" "Chicago, Illinois" "UPS (FedEx available on request)"personalized gifts498557-101 3 230.451613.25RSGiftsEngraved Gifts1:22%Find this beautiful book clock discounted at TrophyCentral. Add engraving for a special touch your gift recipient will love.Engraved Giftscustom-pagename-badges-tagswoyoulipr100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoName Badges1Find These Custom Book Shaped Badges Discounted At TrophyCentral.namebadges-bookcustom-pageschool-pins1"1-2 business days" "Columbia, SC"lapel pins292121-31 2 3 230.4150030.4Certificate SourceLapel PinsAcademic1:22%,50:28%,100:32%,500:36%"School Pins"Find book-shaped school subject lapel pins discounted at TrophyCentral. Choose from a wide selection of subjects. Buy In bulk for significant discounts.111x08-06-2014Readingcustom-pagemotivational-stickers1"1 - 2 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-21 2 3 230.451224.45Certificate SourceStickersStickers1:22%,3:24%Find these colorful Books are Big Fun motivational stickers discounted online at TrophyCentral. Fast 1-2 day shipping!bstick2Readingcustom-pagetrophies-bowling12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-31130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Bowling "Strike" (507397) Medal Inserts (Litho) at TrophyCentral. Each Bowling "Strike" (507397) Medal Insert can be used to create a unique plaque, medal or trophy.507397Bowling
custom-pagetrophies-bowling12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-31130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Bowling (482871) Inserts (Litho) at TrophyCentral. Each Bowling (482871) Insert can be used to create a unique plaque, medal or trophy.492871Bowling
custom-pagetrophies-bowling1trophies498551-310.452429Trophies1Find this popular Bowling trophy discounted at TrophyCentral. Features a real marble base, stylish 4-inch gold cup, free engraving and fast shipping.bowling-cup-place-trophycustom-pagetrophies-bowling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%"Bowling Trophies" "Trophies, Bowling" "Bowling Trophy"Find this popular bowling figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at trophyCentral. Ships in a fast 1-2 days!1qtbowlplBowling, 1st / 2nd / 3rd / Etc.custom-pagetrophies-bowling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%"Bowling Trophies" "Trophies, Bowling" "Bowling Trophy"This popular Bowling trophy features a real marble base, column, figure and trim indicating year of award. Includes up to three lines of free engraving!qtbowlyrBowlingcustom-pagetrophies-bowling1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with bowling figure discounted at TrophyCentral. Includes free text engraving!cup-bowl-pBowlingcustom-pagetrophies-bowling1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these bowler budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtbowlscbBowlingcustom-pagetrophies-bowling1498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Find this budget bowling award trophy discounted at Trophy Central. Features a real marble base and plastic bowling figure. Engraving is free. Fast 1-2 day shipping.bdg-bowlingBowlingcustom-pagetrophies-bowling1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511230.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,6:23%,12:24%,24:26%"Bowling Awards"Shop for Cast Stone Bowling Awards at TrophyCentral. We have a great selection of Bowling and other recognition trophies at discounted prices.tr9924Return to the section.trophies-bowlingBowlingcustom-pagetrophies-bowling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%"Bowling Trophies" "Trophies, Bowling" "Bowling Trophy" "Bowling Awards"Find these fabulous Bowling Figure Two Tier Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qtbowlttBowlingcustom-pagetrophies-bowling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.2115Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%"Bowling Trophies" "Trophies, Bowling" "Bowling Trophy"See this championship trophy with a Bowling figure at TrophyCentral. Be sure to see all of our Bowling figure awards.qtbowlttwBowlingcustom-pagetrophies-bowling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%"Bowling Trophies" "Trophies, Bowling" "Bowling Trophy"This popular Bowler Figure Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtbowlscSee more:trophies-bowlingBowlingcustom-pagetrophies-bowling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451030.45Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%"Bowling Trophies" "Trophies, Bowling" "Bowling Trophy"Find These Popular Bowling Deluxe Platform Series Trophies Discounted at TrophyCentral. Features Real Marble Base; Free Personalization!qtbowldmBowlingcustom-pagetrophies-bowling12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-31130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%PBuy these high-quality Bowling GENERAL 10 Pin Inserts at TrophyCentral. Each Bowling GENERAL 10 Pin Insert can be used to create a unique plaque, medal or trophy.50142Bowling
custom-pagetrophies-bowling1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Bowler figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-bowl-scbBowlingcustom-pagetrophies-bowling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.4118Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%"Bowling Trophies" "Trophies, Bowling" "Bowling Trophy" "Bowling Awards"Find these fabulous two-tier, 3-column champion Bowling Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtbowl3cSee other championshipin many different styles.trophies-bowlingBowlingcustom-pageplaques1"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498852-310.45811.6Quick TrophyPlaquesInsert1:14%,3:14%"Bowling Awards"See this stunning Bowling plaque and other Holographic Plaques at TrophyCentral.qsinplaq3dbowlingBowling11Find bowling medals discounted at TrophyCentral. Each bowling medal includes a neck ribbon and most ship in just 1-2 days!Shop with Ease for Bowling Award Medals If you are buying bowling medals online, you have come to the right place! Medals come in gold, silver and bronze finishes and offer optional engraving to keep the price as low as possible. . All of our bowling medals include a neck ribbon, and many offer a choice of ribbon color. Without engraving, your order will typically ship in just 1-2 business days, so no need to worry if you have waited for the last minute.]]>trophies-bowlingBowlingcustom-pagetrophies-bowling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%,25:23%,50:29%,100:34%"Bowling Trophies" "Trophies, Bowling" "Bowling Trophy" "Bowling Awards"Our popular Bowling Participation Trophies feature a real slant-front white marble base and free personalization. Significant quantity discounts available.qtbowlncBe sure to see our other popular trophies-bowlingBowlingcustom-pagetrophies-bowling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.41234Quick TrophyTrophiesPerpetual Trophies1:14%,3:15%,10:16%"Bowling Awards" "Bowling Trophies"Find this Perpetual Bowling Trophy Discounted at TrophyCentral. Each Trophy has enough room for 32 names. Ships in just 1-2 days.qtbowlperpReturn to our section for more great choices!trophies-bowlingBowlingcustom-pagetrophies-bowling1trophies498551-310.452429Trophies1Find our Bowling star column trophy discounted at TrophyCentral. Features a real marble base, 6 inch gold star-shaped column, free engraving and fast shipping.bowling-star-column-trophycustom-pagetrophies-billiardsqtbowlncqtbowlscwge463bdg-bowlingqtbowldmqtbowlyrqtbowlplqtbowlttqtbowlttwqtbowl3cqtbowltrtr9924qtbowlperpmqtbowlscbcup-bowl-scbcup-bowl-pbowling-cup-place-trophybowling-cup-place-column-trophye9136tm9973gqushbomeqsinplaqbowlingcl05bowling-star-column-trophy1trophies1"Bowling Awards" "Sports Trophies"Find bowling trophies discounted at TrophyCentral. Each bowling trophy includes up to three lines of engraving.

Custom Bowling Trophies & Awards - Honor Every Strike, Spare, and Champion

Bowling trophies celebrate the consistency, focus, and competitive spirit that define one of America's most popular recreational sports. From youth bumper leagues introducing young bowlers to the basics of the game, to adult recreational leagues competing for bragging rights on weeknight lanes, from high school and college programs contesting conference titles to serious tournament bowlers chasing perfect games and high series records, quality bowling awards recognize players, teams, and leagues across every level of the sport. Our versatile trophies feature classic column designs with detailed bowling ball and pin toppers, dynamic resin sculptures capturing the follow-through of a powerful delivery, traditional cup and champion's trophies suited to end-of-season banquet presentations, and customizable engraving plates documenting high games, season averages, tournament placements, and the individual achievements every bowler works to earn.

Frequently Asked Questions About Bowling Trophies

What types of bowling events are these trophies suitable for?

Our bowling trophies and awards are suitable for a wide range of events including youth and adult recreational leagues, bowling club tournaments, high school and college bowling competitions, corporate bowling events, perfect game recognition, and end-of-season banquet awards at all skill levels.

Does engraving come included with bowling trophies?

Yes, every bowling trophy includes free personalized engraving at no extra cost. You can add the bowler's name, team or league, tournament name, and season details to create a meaningful award they will be proud to display.

Do you offer bowling medals in addition to trophies?

Yes, we carry bowling medals that make an excellent and affordable alternative to trophies, ideal for recognizing all participants in a league or tournament. Every bowling medal includes a free neck ribbon, and optional engraving is also available.

How quickly will bowling trophy orders ship?

Most bowling trophy orders are processed and shipped within 1-2 business days, with same-day processing available on many orders placed early in the day. Expedited shipping options are available at checkout for time-sensitive events.

If you need more information before deciding, see our expert resource section:
]]>
trophiesBowling
custom-pagetrophies-boxing1trophies498551-310.452429Trophies1Find this popular Boxing trophy discounted at TrophyCentral. Features a real marble base, stylish 4-inch gold cup, free engraving and fast shipping.boxing-cup-place-trophycustom-pagetrophies-boxing1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular boxing figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!qtboxplBoxing, 1st / 2nd / 3rd / Etc.custom-pagetrophies-boxing1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find these popular Boxing year trim trophies discounted at TrophyCentral. Available in multiple sizes and includes free personalization.qtboxyrBoxingcustom-pagetrophies-boxing1trophies498852-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with boxing figure discounted at TrophyCentral. Includes free text engraving!cup-box-pBoxingcustom-pagefree-sports-templates1trophies-boxing"Download Only"sports4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Boxing template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Boxing-Certificateboxing-freeBoxingcustom-pagetrophies-boxing1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these boxing budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtboxscbBoxingcustom-pagetrophies-boxing1trophies498551-310.453633.4Trophies1Find this budget boxing award trophy discounted at TrophyCentral. Features a real marble base and plastic boxer figure. Engraving is free. Fast 1-2 day shipping.Boxingcustom-pagetrophies-boxing1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous two-tier Boxing Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtboxttBoxingcustom-pagetrophies-boxing1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.2115Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%See this championship trophy with a Boxing figure at TrophyCentral. Be sure to see all of our Boxing figure awards.qtboxttwBoxingcustom-pagetrophies-boxing1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%This popular Boxing Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtboxscBoxingcustom-pagetrophies-boxing1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451623.65Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%Find Our Boxing Deluxe Platform Series Trophies Discounted at TrophyCentral. Real Marble Base; Free Personalization!qtboxdmBoxingcustom-pagetrophies-boxing1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Boxing figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-box-scbBoxingcustom-pagetrophies-boxing1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.4118Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous Boxing Champions Line 3-column Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qtbox3cBoxingcustom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-31130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Boxing Medals"Buy these quality Boxing Inserts (Litho) at TrophyCentral. Each Boxing Insert can be used to create a unique plaque, medal or trophy.5015112-20-2040Boxing
custom-pagetrophies-boxing1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%,25:23%,50:29%,100:34%Our popular Boxing participation trophies feature a real slant-front marble base and free engraving.qtboxncBoxingcustom-pagetrophies-boxing1trophies498551-310.452429Trophies1Find our Boxing star column trophy discounted at TrophyCentral. Features a real marble base, 6 inch gold star-shaped column, free engraving and fast shipping.boxing-star-column-trophycustom-pageaward-medalsqtboxncqtboxscqtboxdmqtboxyrqtboxplqtboxttqtboxttwqtbox3cqtboxtrmqtboxscbcup-box-scbcup-box-pbdg-boxingboxing-cup-place-column-trophyboxing-cup-place-trophyboxing-star-column-trophy1trophies1"Sports Trophies"Find boxing trophies at discounted at TrophyCentral. Each boxing trophy includes up to three lines of free personalization.Shop with Ease at TrophyCentral

TrophyCentral has been supplying boxing gyms, tournaments, and programs with quality awards since 1999. All boxing trophies include up to three lines of free engraving. Orders typically ship in 1-2 business days and sometimes the same day, depending on time of year and when the order is placed. Browse our complete trophies collection for additional styles and designs.

Boxing Trophy FAQ

What types of boxing events are these trophies used for?

Our boxing trophies are used for a wide range of events including youth and amateur boxing tournaments, gym-level competitions, Golden Gloves events, corporate charity boxing nights, and end-of-season program awards. Popular individual awards include champion, runner-up, most improved fighter, best technique, and coach of the year.

Can I personalize a boxing trophy with fighter and event information?

Yes. Every boxing trophy includes up to three lines of free engraving. Popular examples include "2026 Amateur Boxing Champion - Marcus Rivera, 147 lbs" or "Southside Boxing Club - Most Improved Fighter." Including the weight class and event name makes each award feel specific and meaningful to the recipient.

How quickly will my boxing trophies ship?

All orders, including engraved orders, typically ship in 1-2 business days and sometimes the same day, depending on time of year and when the order is placed.

Do you offer bulk pricing for boxing tournaments and gyms?

Yes. TrophyCentral offers quantity discounts on trophy orders. The more you order, the lower the per-unit price, which works well for tournament organizers recognizing multiple weight classes and divisions. Discounted pricing is shown on each product page.

]]>
Boxing
custom-pagetrophies-basketball12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,100:28%,500:34%,1000:45%"Basketball Awards" "Award Medals - All Subjects" "Sports Medals" "Basketball Medals"Basketball Medal, Male (1 1/4"). Ideal for leagues, schools, and tournaments. Fast shipping.e9402Not what you are looking for? See additionin other great styles.basketballmedalsBasketball, Sports
custom-pagecustommedalswhitcarboarbvelourbox50"5-7 business days" "Mt. Vernon, NY" "UPS"medals105503-610.45115024.45Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,100:33%,300:41%"New Products" "Track Medals"Find these fabulous Personalized Boys Track Medals (Bronze) at TrophyCentral. Price includes the name of your school or organization imprinted on the front of the medal!m156bcustom-pagewalnut-insert-plaques1"3-6 business days with engraving, Without engraving: 1-3 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"plaques105503-610.4511219.65Classic MedallicsPlaquesInsert1:22%,3:24%,5:27%"School Awards" "School Products"51-7764custom-pagetrophies-baseball1trophies465713-410.7169.14Tower RibbonTrophiesSports, Hobby, Org, Livestock1"Baseball Trophy" "Baseball Trophies" "Sports Trophies" "T-Ball Trophies" "T-Ball Trophy"Baseball (Male) - Burst-Thru Series Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.male-baseball-burst-thru-series-trophiesBaseball / T-Ball, Sportscustom-pagetrophies-golf1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.7169.14Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,10:25%,25:27%"Golf Trophies" "Golf Trophy"Golf (Male) - Burst Thru Series Trophy. Ideal for leagues, schools, and tournaments. Fast shipping.wbt65309-30-24Golf, Sportscustom-pagetrophies-lacrosse1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.7169.14Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,5:26%,50:30%"Lacrosse Trophies" "Lacrosse Awards"This fun Lacrosse (Boys) 'Burst Thru' trophy has an exciting and captivating design that your athletes and kids will love. Lacrosse (Boys) trophies include free engraving.wbt788Lacrosse, Sportscustom-pagetrophies-soccer1trophies465711-210.7169.14Tower RibbonTrophiesSports, Hobby, Org, Livestock1"Soccer Trophy" "Soccer Trophies" "Soccer Awards" "Soccer Medals and Trophies" "Soccer Trophies and Medals"Male Soccer Burst-Thru Series Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagetrophies-tennis1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.7169.14Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,10:25%,25:27%"Tennis Trophies" "Tennis Trophy"This fun Tennis (Male) 'Burst Thru' trophy has an exciting and captivating design that your athletes and kids will love. Tennis (Male) trophies include free engraving.wbt671See morein a large variety of styles and sizes.trophies-tennisTennis, Sportscustom-pagetrophies-track-field1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.7169.14Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,5:26%,50:30%"Track Trophy" "Track Trophies"This fun Boys Track trophy has an exciting and captivating design that your athletes and kids will love. Track (Boys) trophies include free engraving.wbt773custom-pagecustommedalswhitcarboarbvelourbox50"5-7 business days" "Mt. Vernon, NY" "UPS"medals105503-610.45115024.45Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,100:33%,300:41%"New Products" "Track Medals"Find these fabulous Personalized Boys Track Medals (Gold) at TrophyCentral. Price includes the name of your school or organization imprinted on the front of the medal!m156gcustom-pagemedals-diamond-cut-edge12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
"PT1=Medals" "PC12=105503-60.3715021.37Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:29%,100:38%"Gymnastics Awards" "Gymnastics Medals"See Our Gymnastics Medals With A Diamond-Cut Edge. Also See Our Other High-Quality Gymnastics Awards At TrophyCentral!z9031Gymnastics, Sports
custom-pagetrophies-soccer1trophies465713-410.451810.3Tower RibbonTrophiesSports, Hobby, Org, Livestock1"Soccer Trophies"Motion Xtreme 5" (500 Series) Boy's Soccer Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagetrophies-swimming-diving11"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.451810.3Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,10:28%,25:34%moxtmaswtr09-30-2024Swimming / Diving, Sportscustom-pagetrophies-tennis11"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.451810.3Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,10:28%,25:34%Find These Popular Motion Xtreme 500 Boy's Tennis Trophies At TrophyCentral. The Price Of Each Motion Xtreme 500 Boy's Tennis Trophy Includes Free Personalization.moxtmatetrTennis, Sportscustom-pagetrophies-track-field11"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.451810.3Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,10:28%,25:34%Find This Popular Motion Xtreme 500 Track (Boys) Trophy At TrophyCentral. The Price Of Each Motion Xtreme 500 Track (Boys) Trophy Includes Engraving.motionSee our completesection for more choices.trophies-track-fieldcustom-pagetrophies-baseball1trophies465713-410.451613.1Tower RibbonTrophiesSports, Hobby, Org, Livestock1Motion Xtreme (700 Series Trophy) - Male Baseball Batter. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.motion-700-trophies-male-baseball-batterBaseball / T-Ball, Sportscustom-pagetrophies-golf1"2-3 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.451613.1Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,100:29%"Golf Trophies"Motion Xtreme Series Trophy - Golf (Male). Ideal for leagues, schools, and tournaments. Fast shipping.mxx0304-20-2021Golf, Sportscustom-pagetrophies-lacrosse11"2-3 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-4141613.1Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,100:29%"Lacrosse Awards"These Unique Motion Xtreme 700 Lacrosse (Male) Ship In Just 1-2 Business Days And Include Engraving.malatr9-12-2009Lacrosse, Sportscustom-pagetrophies-soccer1trophies465713-410.451613.1Tower RibbonTrophiesSports, Hobby, Org, Livestock1Motion Xtreme (700 Series) Boy's Soccer Figure Trophies. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagetrophies-swimming-diving11"2-3 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.451616.5Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,25:30%These Unique Motion Xtreme 700 Boys Swimming Trophies Ship In Just 1-2 Business Days And Include Engraving! Significant Quantity Discounts Available!maswtrSee our complete selection of boy's and girl'sin a large variety of styles for all of your individual, team and swim meet needs.trophies-swimming-divingSwimming / Diving, Sportscustom-pagetrophies-volleyball11"2-3 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)""PT1=Trophies" "PC12=465713-410.451613.1Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,100:29%These Unique Motion Xtreme 700 Volleyball (Male) Ship In Just 1-2 Business Days And Include Engraving.1mavotrVolleyball, Sportscustom-pagetrophies-baseball1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511224.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,6:24%,12:26%,24:29%,48:31%Resin Award (Male Baseball Batter). Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.tr6096Baseball / T-Ball, Sportscustom-pagetrophies-basketball1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511224.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,6:24%,12:26%,24:29%,48:31%"Basketball Awards"Resin Basketball Trophy (Male). Ideal for leagues, schools, and tournaments. Fast shipping.tr7000Basketball, Sportscustom-pagequickshiptrophies-graduate1trophies105503-610.4513028.65Classic MedallicsTrophiesAcademic1:22%,10:25%,50:29%,100:34%"Graduation Award" "Graduation Awards"This sculptured resin Graduation Award (Boy) Trophy Includes Engraving. Be sure to see other section for additional Boy's Graduation Awards.schooltrophies21Graduation, Academiccustom-pagetrophies-lacrosse1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511224.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,6:24%,12:26%,24:29%,48:31%"Lacrosse Awards"Star Series male lacrosse trophies have been meticulously sculptured and hand painted in an antique gold finish with a star shape base.tr7004See other fabulousin a variety of sizes.trophies-lacrosseLacrosse, Sportscustom-pagetrophies-soccer1trophies105503-610.4511224.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1"Soccer Awards"Male Soccer Resin Trophy - Style 1. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagetrophies-softball1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.451 2 3 4 5 6 7 8 911224.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,6:24%,12:26%,24:29%,48:31%Star Series male softball trophies have been meticulously sculptured and hand painted in an antique gold finish with a star shape base.tr6097Softball, Sportscustom-pagetrophies-swimming-diving1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.451 2 3 4 5 6 7 8 911224.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,6:24%,12:26%,24:29%,48:31%"Swimming Awards"tr7011Swimming / Diving, Sportscustom-pagetrophies-tennis1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.451 2 3 4 5 6 7 8 911224.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,6:24%,12:26%,24:29%,48:31%"Tennis Awards"Star Series male tennis trophies have been meticulously sculptured and hand painted in an antique gold finish with a star shape base.tr7009Tennis, Sportscustom-pagetrophies-track-field1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.451 2 3 4 5 6 7 8 911224.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,6:24%,12:26%,24:29%,48:31%"Track Awards"Star Series male track trophies have been meticulously sculptured and hand painted in an antique gold finish with a star shape base.tr7013custom-pagetrophies-volleyball1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.451 2 3 4 5 6 7 8 911224.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,6:24%,12:26%,24:29%,48:31%"Volleyball Awards"Star Series male volleyball trophies have been meticulously sculptured and hand painted in an antique gold finish with a star shape base.tr7007Volleyball, Sportscustom-pagetrophies-soccer1trophies465713-410.45169.5Tower RibbonTrophies1Male Rock N Jox Soccer Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagetrophies-soccer12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,100:28%,500:34%,1000:45%"Soccer Medals" "Soccer Awards" "Award Medals - All Subjects" "Sports Medals" "Soccer Medals and Trophies" "Soccer Trophies and Medals"Boys Soccer 1 1/4 Inch E-Series Medals. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.e9022Return to oursection for more great choices!soccermedals12-20-2020Soccer, Sports
custom-pagetrophies-track-field50"4-6 business days" "Mount Vernon, NY" "UPS"medals105502-50.75130033.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,100:33%,300:41%"Track Medals"Find these fabulous Personalized Boys Track Medals at TrophyCentral. Price includes the name of your school or organization imprinted on the front of the medal!m156custom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic MedallicsMedalsSports, Hobby, Org, Livestock Bottles1:22%,100:28%,500:34%,1000:45%"Track Medals"These inexpensive 1 1/4 inch Triple Jump (Male) Medals offer a high quality, but low price for those on a tight budget.e5541
custom-pagetrophies-wrestling12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,100:28%,500:34%,1000:45%"Wrestling Awards"These inexpensive 1 1/4 inch Wrestling Medals offer a high quality, but low price for those on a tight budget.e9049Wrestling, Sports
custom-pagebottles-al80"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14142013Glass AmericaPromotional ProductsSports / Water Bottles1:14%,640:32%BPA Free Torpedo Collection Aluminum Water Bottles - Red .99076Sports / Water Bottlescustom-pagebottles-al80"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14142013Glass AmericaPromotional ProductsSports / Water Bottles1:14%,640:32%"Basketball Water Bottles" "Logo Sports Bottles" "Sports Bottles" "Promotional Sports Bottles" "Aluminum Sports Bottles" "Stainless Water Bottles" "Aluminum Water Bottles" "Bike Water Bottles" "Bicycle Water Bottles" "Baseball Water Bottles" "Football Water Bottles" "Promotional Water Bottles" "Soccer Water Bottles"BPA Free Torpedo Collection Aluminum Water Bottles - Blue99084Sports / Water Bottlescustom-pagebottles-al80"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14142013Glass AmericaPromotional ProductsSports / Water Bottles1:14%,640:32%BPA Free Torpedo Collection Aluminum Water Bottles - Silver99070Sports / Water Bottlescustom-pagebottles-al80"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14142013Glass AmericaPromotional ProductsSports / Water Bottles1:14%,640:32%"Basketball Water Bottles" "Logo Sports Bottles" "Sports Bottles" "Promotional Sports Bottles" "Aluminum Sports Bottles" "Stainless Water Bottles" "Aluminum Water Bottles" "Bike Water Bottles" "Bicycle Water Bottles" "Baseball Water Bottles" "Football Water Bottles" "Promotional Water Bottles" "Soccer Water Bottles"BPA Free Torpedo Collection Aluminum Water Bottles - White99060Sports / Water Bottlescustom-pagebottles-al80"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14142013Glass AmericaPromotional ProductsSports / Water Bottles1BPA Free Aluminum Venice Collection Bottles - Silver .72670Sports / Water Bottles1"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"105501-2150030lapel-award-pins1Find these high-quality BR Series Lapel and Award Pins discounted at TrophyCentral. We have a huge selection and fast 1-2 day shipping!br-lapel-pins-allBusiness (General), Academic, Flags, Honor Roll, Apple, Academic, Art, Sports, Attitude, Music / Band / Chorus, Cheerleading, Cooking / Culinary, Star, Chess, Citizenship, Debate, Drama, EMS, Employee of the Month, Volunteer, Fire Department, Reading, Heart, Community Service, Perfect Attendance, Teamwork, Writing, Thank You, Spelling, Military, Herocustom-pagevolunteerpins1plasticpinboxvelapinbox5lapel pins105502-30.31150030.3Classic MedallicsLapel PinsGeneral1:30%,50:34%,100:39%,500:43%"Custom Lapel Pins" "Lapel Pins, Custom" "Custom Trading Pins" "Baseball Pins" "Soccer Pins" "Basketball Pins" "Volleyball Pins" "Wrestling Pins" "Football Pins"Find these Outstanding Volunteer Pins at TrophyCentral. Fast 1-2 day shipping!volapin04-26-2010Volunteer, Thank You, Generalcustom-pagetrophy-award-guides1trophies1Join the TrophyCentral Ambassador Program! Free trophies and awards for non-profits, schools, and charities. Brand ambassador opportunities with rewards available.custom-pagetagsbadges1"10-14 business days w/engraving" "Chicago, Illinois" "UPS (FedEx available on request)"6063010-141 3 230.45RS OwensName Badges1:22%,10:25%custom-pageaward-ribbons-rosettes11"5-7 business days" "Topeka, Indiana" "UPS (Priority Mail also available)"medals465712-141 260.4620016.46Tower RibbonRibbonsAwareness Ribbons1:22%,50:36%"Customized Ribbons" "Pink Ribbons"Pink awareness ribboncaawriBreast Cancercustom-pageglass-crystal-awards1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"general410187-1010.45861JcharlesCrystal Awards1:22%,25:24%Find These Breeze Bent Glass Awards Discounted At TrophyCentral. Price Includes Etching And Gift Box!Click here for more greatchoices in many styles.glass-crystal-awards09-20-2021Leadershipcustom-pagemedallion-inserts-general-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these high-quality Bridge Hand Inserts at TrophyCentral. Each Bridge Hand Insert can be used to create a unique plaque, medal or trophy.517598
custom-pagecospwabo50"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745315125016.5PepcoPromotional ProductsSports / Water Bottles1:14%,250:21%,500:31%,1000:45%,2500:49%Bright Gold Custom Sports Bottles from TrophyCentral.sportsbottles-goldSports / Water Bottlescustom-pagegeneral-corporate-awards11"8-12 business days w/engraving" "Chicago, Illinois" "UPS (FedEx available on request)"606308-121 3 230.45840.45RS OwensTrophies1Leadershipcustom-pagegold-starsplastic-pinbox-t10star-pinslapel pins498552-30.3102300031TCLapel Pins11:22%,100:38%,250:42%,500:52%,1000:59%Find These Bronze Stars Discounted At TrophyCentral! Each Silver Star Includes A Clutch-Back For Easy Attachment to Clothing. Large Quantity Discounts.Bronze Stars | Bronze Star Pins | TrophyCentralBronze Stars | TrophyCentralNot what you are looking for? Be sure to also see our gold and silverin a variety of styles.star-pinscustom-pagestar-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsGeneral1:22%,50:30%,100:40%,500:46%"Star Pins" "Star Lapel Pins" "Star Award Pins"Find these Bronze Stars with a wreath design discounted at TrophyCentral. Each bronze star pin features a clutch back and measures 7/8".br476bStar, Generalcustom-pagestar-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsGeneral1:22%,50:25%,100:29%,500:32%"Star Pins" "Star Lapel Pins" "Star Award Pins"Find this Bronze Stars - 3/4 Inch Pin at TrophyCentral. Bronze Stars - 3/4 Inch and other pins ship in just 1-2 business days!br199b11-15-2011Star, Generalcustom-page1st-place-medals11-2 business days
With engraving:
1-3 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals498552-30.371 3 4 5 6 7 8 930042.37Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%Find these bronze torch medals discounted at Trophy Central. Optional engraving. Fast 1-2 day shipping.Torch, 1st / 2nd / 3rd / Etc.
custom-pagecustommedalswhitcarboarbvelourbox50"5-7 business days" "Mt. Vernon, NY" "UPS"medals105503-610.45120032.45Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,100:33%,300:41%"Wrestling Medals"Find these fabulous Bronze Wrestling Medals discounted at TrophyCentral. Price includes the name of your school or organization imprinted on the front of the medal!m162bWrestling, Sportscustom-pagetrophies-broomball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)""PT1=Trophies" "PC12=498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular broomball figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!qtbroomplBroomball, 1st / 2nd / 3rd Place1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)""PT1=Trophies" "PC12=498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%This popular Broomball Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!qtbroomyr12-20-2040Broomballcustom-pageshop-by-categoryqtbroomncqtbroomscqtbroomdmqtbroomplqtbroomttqtbroomttwqtbroom3c1trophies1Find a great selection of Broomball Trophies at TrophyCentral. Each Broomball Trophy Includes Free Engraving and Many Ship in Just 1-2 Days!Broomball Recognition Trophies TrophyCentral has a great selection of broomball awards to meet all of your award recognition needs. Be sure to see our Single Column Broomball Trophies, available with your choice of column color and size, and our 1st through 3rd Place Trophies with Broomball figures to recognize multiple levels of achievement. Our Champion Trophies are also popular for broomball tournament and team winners alike. Each broomball award includes up to three lines of FREE ENGRAVING.]]>Broomballcustom-pagetrophies-broomball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)""PT1=Trophies" "PC12=498552-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous Broomball Figure Two Tier Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qtbroomttBroomballcustom-pagetrophies-broomball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)""PT1=Trophies" "PC12=498552-311.2115Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%See this championship trophy with a Broomball figure at TrophyCentral. Be sure to see all of our Broomball figure awards.qtbroomttwBroomballcustom-pagetrophies-broomball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)""PT1=Trophies" "PC12=498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:28%Find these popular Broomball Single Column Elite Series trophies discounted and with free personalization at TrophyCentral.qtbroomscBroomballcustom-pagetrophies-broomball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)""PT1=Trophies" "PC12=498552-310.451622.05Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%These quick-ship trophies from TrophyCentral feature a Broomball figure, real marble base and marble trophy figure platform, choice of column size and color.qtbroomdmBroomballcustom-pagetrophies-broomball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)""PT1=Trophies" "PC12=498552-311.4118Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous two-tier, 3-column champion Broomball Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtbroom3cBroomballcustom-pagetrophies-broomball1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)""PT1=Trophies" "PC12=498552-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:28%Our popular Broomball participation trophies feature a real slant-front marble base and free engraving.qtbroomncBroomballcustom-pageindexachievement-trophies-awardstrophies-archerytrophies-badmintontrophies-baseballtrophies-basketballtrophies-bicycle-cyclingtrophies-billiardstrophies-bmxtrophies-bocce-balltrophies-bowlingtrophies-boxingtrophies-broomballtrophies-cheerleading-spirittrophies-coachtrophies-crickettrophies-curlingtrophies-dartstrophies-disc-golftrophies-equestrian-horsetrophies-figure-skatingtrophies-bass-fishingtrophies-marlin-fishingtrophies-footballtrophies-hockey-goalietrophies-golftrophies-gymnasticstrophies-ice-hockeytrophies-karate-martial-artstrophies-lacrossetrophies-marksman-shooting-rifletrophies-motocrossracing-trophies-awardstrophies-racquetballtrophies-roller-hockeyrunning-trophiestrophies-sailing-boattrophies-skateboardingtrophies-cross-country-skiingtrophies-downhill-skiingtrophies-snowboardingtrophies-snowmobiletrophies-soccertrophies-softballtrophies-swimming-divingtrophies-t-balltrophies-tennistorch-trophiestrophies-track-fieldtrophies-trap-skeet-shootingtrophies-volleyballtrophies-weightlifting-powertrophies-wrestlingquickshiptrophies-goatresin-trophiespickleball-trophiestr-resin-trophiestrophies-academictrophies-funny-horses-reartrophies-livestock-farm-animalsgeneral-corporate-awardsreligioustrophiestrophies-volunteerquickshiptrophies-firemanteacher-appreciationtrophies-military-heroart-trophiestrophies-chesscitizenship-awardsdebate-trophiestrophies-mascotquickshiptrophies-graduatetrophies-honor-roll-societytrophies-mathreadingawardsscienceawardsquickshiptrophies-spellingperfect-attendance-awardsschooltrophies14schooltrophies18trophies-cooking-culinarytrophies-dancetrophies-dramatrophies-musicphotography-trophies-and-awardstrophies-beauty-queeninsert-trophies-awardstrophies-generalstar-trophiesplace-trophiestrophies-victoryall-star-trophiesmvp-trophiestrophies-family-reunionhorseshoescounty-fair-awardstrophies-cards-pokertrophies-beer-pongtrophies-camperstrophies-cornholetrophies-paintballtrophies-pinewood-derby-scoutstrophies-table-tennis-ping-pongtrophies-car-truckquickshiptrophies-wheeltrophies-go-kartquickshiptrophies-tractor11Browse all award categories A-Z. Complete directory organized by occasion and activity. Find your category quickly and shop with confidence.1 🏆 Looking for more? Explore our full Full Selection of Trophies and Awards by style. ]]>custom-pageclocks1"1-2 business days" "Marquette, MI" "UPS"personalized gifts498852-310.451611.65Quick TrophyGiftsClocks1:14%"New Products"Find these fabulous Brushed Aluminum Clock discounted at TrophyCentral. TrophyCentral is known for its top-rated customer serviceEngraved Clockscustom-pageplace-trophies1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy 1st place column insert trophy features a choice of column color, a marble base and free trophy engraving.1st / 2nd / 3rd / Etc., Sportscustom-pageplace-trophies1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy 1st place insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.1st / 2nd / 3rd / Etc., Sportscustom-pageplace-trophies1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy 2nd place column insert trophy features a choice of column color, a marble base and free trophy engraving.1st / 2nd / 3rd / Etc., Sportscustom-pageplace-trophies1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy 2nd place insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.1st / 2nd / 3rd / Etc., Sportscustom-pageplace-trophies1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy 3rd place column insert trophy features a choice of column color, a marble base and free trophy engraving.1st / 2nd / 3rd / Etc., Sportscustom-pageplace-trophies1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy 3rd place insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.1st / 2nd / 3rd / Etc., Sportscustom-pageplace-trophies1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy 4th Place column insert trophy features a choice of column color, a marble base and free trophy engraving.1st / 2nd / 3rd / Etc., Sportscustom-pagetrophies-academic1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy academic excellence column insert trophy features a choice of column color, a marble base and free trophy engraving.Academiccustom-pagetrophies-academic1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy academic excellence insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Academiccustom-pageall-star-trophies1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy all-star column insert trophy features a choice of column color, a marble base and free trophy engraving.All Starcustom-pageall-star-trophies1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy all-star insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.All Starcustom-pageart-trophies1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy art column insert trophy features a choice of column color, a marble base and free trophy engraving.Art, Academiccustom-pagetrophies-cooking-culinary1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy baking column insert trophy features a choice of column color, a marble base and free trophy engraving.Cooking / Culinarycustom-pagetrophies-cooking-culinary1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy baking insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Cooking / Culinarycustom-pagetrophies-music1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy Band column insert trophy features a choice of column color, a marble base and free trophy engraving.Music / Band / Choruscustom-pagetrophies-music1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy Band insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Music / Band / Choruscustom-pagetrophies-baseball1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Economy Column Insert Baseball Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Baseball / T-Ball, Sportscustom-pagetrophies-baseball1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Economy Participation Insert Baseball Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Baseball / T-Ball, Sportscustom-pagetrophies-basketball1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Economy Column Insert Trophy - Basketball. Ideal for leagues, schools, and tournaments. Fast shipping.Basketball, Sportscustom-pagetrophies-basketball1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Economy Participation Insert Trophy - Basketball. Ideal for leagues, schools, and tournaments. Fast shipping.Basketball, Sportscustom-pagetrophies-beer-pong1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy Beer Pong column insert trophy features a choice of column color, a marble base and free trophy engraving.Beer Pongcustom-pagetrophies-beer-pong1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy Beer Pong insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Beer Pongcustom-pagetrophies-campers1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy Camping / Camp column insert trophy features a choice of column color, a marble base and free trophy engraving.Camp / Campingcustom-pagetrophies-campers1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy Camping / Camp insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Camp / Campingcustom-pagetrophies-cheerleading-spirit1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy cheerleading column insert trophy features a choice of column color, a marble base and free trophy engraving.Cheerleading, Sportscustom-pagetrophies-cheerleading-spirit1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy cheerleading insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Cheerleading, Sportscustom-pagetrophies-chess1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy chess column insert trophy features a choice of column color, a marble base and free trophy engraving.Chesscustom-pagetrophies-chess1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy chess insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Chesscustom-pagecitizenship-awards1498551-210.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy citizenship excellence column insert trophy features a choice of column color, a marble base and free trophy engraving.Citizenshipcustom-pagetrophies-coach1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy coach column insert trophy features a choice of column color, a marble base and free trophy engraving.Coach, Sportscustom-pagetrophies1trophies498551-310.45TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy column insert trophy comes with a large choice of subject inserts and features a choice of column color, a marble base and free trophy engraving. Fast 1-2 day shipping.custom-pagetrophies1trophies498551-310.5TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our single column budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.custom-pagetrophies-cornhole1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy cornhole column insert trophy features a choice of column color, a marble base and free trophy engraving.Cornholecustom-pagetrophies-cornhole1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy cornhole insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Cornholecustom-pagecounty-fair-awards1498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy county fair column insert trophy features a choice of column color, a marble base and free trophy engraving.County Faircustom-pagecounty-fair-awards1498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy county fair insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.County Faircustom-pagetrophies-cooking-culinary1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy Culinary / Cooking column insert trophy features a choice of column color, a marble base and free trophy engraving.Cooking / Culinarycustom-pagetrophies-cooking-culinary1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy Culinary / Cooking insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Cooking / Culinarycustom-pagetrophies-bicycle-cycling1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy cycling column insert trophy features a choice of column color, a marble base and free trophy engraving.Bicycling / Cycling, Sportscustom-pagetrophies-bicycle-cycling1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy cycling insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Bicycling / Cycling, Sportscustom-pagetrophies-dance1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy dance column insert trophy features a choice of column color, a marble base and free trophy engraving.Dancecustom-pagetrophies-dance1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy dance insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Dancecustom-pagetrophies-darts1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy darts column insert trophy features a choice of column color, a marble base and free trophy engraving.Dartscustom-pagetrophies-darts1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy darts insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Dartscustom-pagedebate-trophies1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy debate column insert trophy features a choice of column color, a marble base and free trophy engraving.Debatecustom-pagedebate-trophies1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy debate insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Debatecustom-pagetrophies-downhill-skiing1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy downhill skiing column insert trophy features a choice of column color, a marble base and free trophy engraving.Skiing (Downhill), Sportscustom-pagetrophies-drama1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy drama column insert trophy features a choice of column color, a marble base and free trophy engraving.Dramacustom-pagetrophies-drama1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy drama insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Dramacustom-pagetrophies-general1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy excellence column insert trophy features a choice of column color, a marble base and free trophy engraving.custom-pagetrophies-general1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy excellence insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.custom-pagetrophies-family-reunion1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy family reunion column insert trophy features a choice of column color, a marble base and free trophy engraving.Family Reunioncustom-pagetrophies-family-reunion1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy family reunion insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Family Reunioncustom-pagequickshiptrophies-fireman1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy fire department column insert trophy features a choice of column color, a marble base and free trophy engraving.Firefightercustom-pagequickshiptrophies-fireman1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy fire department insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Firefightercustom-pagetrophies-bass-fishing1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy fishing column insert trophy features a choice of column color, a marble base and free trophy engraving.Fishing, Sportscustom-pagetrophies-bass-fishing1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy fishing insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Fishing, Sportscustom-pagetrophies-football1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Economy Column Insert Trophy - Football. Ideal for leagues, schools, and tournaments. Fast shipping.Football, Sportscustom-pagetrophies-football1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Economy Participation Insert Trophy - Football. Ideal for leagues, schools, and tournaments. Fast shipping.Football, Sportscustom-pagetrophies-golf1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Economy Column Insert Trophy - Golf. Ideal for leagues, schools, and tournaments. Fast shipping.Golf, Sportscustom-pagetrophies-golf1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Economy Participation Insert Trophy - Golf. Ideal for leagues, schools, and tournaments. Fast shipping.Golf, Sportscustom-pagequickshiptrophies-graduate1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy Graduation column insert trophy features a choice of column color, a marble base and free trophy engraving.Graduation, Academiccustom-pagequickshiptrophies-graduate1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy Graduation insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Graduation, Academiccustom-pagetrophies-general1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy great job column insert trophy features a choice of column color, a marble base and free trophy engraving.custom-pagetrophies-general1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy great job insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.custom-pagetrophies-gymnastics1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy gymnastics column insert trophy features a choice of column color, a marble base and free trophy engraving.Gymnastics, Sportscustom-pagetrophies-gymnastics1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy gymnastics insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Gymnastics, Sportscustom-pagetrophies-honor-roll-society1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy honor roll column insert trophy features a choice of column color, a marble base and free trophy engraving.Honor Roll, Academiccustom-pagetrophies-honor-roll-society1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy honor roll insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Honor Roll, Academiccustom-pagetrophies-honor-roll-society1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy honor society column insert trophy features a choice of column color, a marble base and free trophy engraving.Honor Society, Academiccustom-pagetrophies-honor-roll-society1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy honor society insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Honor Society, Academiccustom-pageplace-trophies1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy honorable mention column insert trophy features a choice of column color, a marble base and free trophy engraving.custom-pageplace-trophies1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy honorable mention insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.custom-pagehorseshoes1498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy horeshoes column insert trophy features a choice of column color, a marble base and free trophy engraving.Horseshoescustom-pagehorseshoes1498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy horeshoes insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Horseshoescustom-pagetrophies-marksman-shooting-rifle1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy hunting column insert trophy features a choice of column color, a marble base and free trophy engraving.custom-pagetrophies-marksman-shooting-rifle1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy hunting insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.custom-pagetrophies1trophies498551-310.45TrophyCentralTrophies11:14%,10:18%,50:24%,100:28%Our economy insert trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Fast 1-2 day shipping.custom-pagetrophies-karate-martial-arts1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy karate column insert trophy features a choice of column color, a marble base and free trophy engraving.Karate / Martial Arts, Sportscustom-pagetrophies-karate-martial-arts1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy karate insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Karate / Martial Arts, Sportscustom-pagetrophies-track-field1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy marathon column insert trophy features a choice of column color, a marble base and free trophy engraving.custom-pagerunning-trophies1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy marathon insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.custom-pagetrophies-math1trophies498551-210.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy math excellence column insert trophy features a choice of column color, a marble base and free trophy engraving.Mathcustom-pagetrophies-general1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy most improved column insert trophy features a choice of column color, a marble base and free trophy engraving.Most Improvedcustom-pagetrophies-general1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy most improved insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Most Improvedcustom-pagetrophies-music1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy music column insert trophy features a choice of column color, a marble base and free trophy engraving.Music / Band / Choruscustom-pagetrophies-music1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy music insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Music / Band / Choruscustom-pagetrophies-music1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy music lyre column insert trophy features a choice of column color, a marble base and free trophy engraving.Music / Band / Choruscustom-pagetrophies-music1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy music lyre insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Music / Band / Choruscustom-pagemvp-trophies1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy MVP column insert trophy features a choice of column color, a marble base and free trophy engraving.MVP, Sportscustom-pageperfect-attendance-awards1498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy perfect attendance column insert trophy features a choice of column color, a marble base and free trophy engraving.Attendance, Academiccustom-pageperfect-attendance-awards1498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy perfect attendance insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Attendance, Academiccustom-pagephotography-trophies-and-awards1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy photography column insert trophy features a choice of column color, a marble base and free trophy engraving.Photographycustom-pagepickleball-trophies1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy pickleball column insert trophy features a choice of column color, a marble base and free trophy engraving.Pickleball, Sportscustom-pagepickleball-trophies1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy pickleball insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Pickleball, Sportscustom-pagetrophies-marksman-shooting-rifle1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy pistol column insert trophy features a choice of column color, a marble base and free trophy engraving.custom-pagetrophies-marksman-shooting-rifle1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy pistol insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.custom-pageracing-trophies-awards1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy racing column insert trophy features a choice of column color, a marble base and free trophy engraving.Racing, Sportscustom-pageracing-trophies-awards1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy racing insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Racing, Sportscustom-pagereadingawards1498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy reading column insert trophy features a choice of column color, a marble base and free trophy engraving.Readingcustom-pagereadingawards1display case498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy reading insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Readingcustom-pagereligioustrophies1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy cross column insert trophy features a choice of column color, a marble base and free trophy engraving.custom-pagereligioustrophies1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy cross insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.custom-pagestar-trophies1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy rising-star column insert trophy features a choice of column color, a marble base and free trophy engraving.Starcustom-pagestar-trophies1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy rising-star insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Starcustom-pagerunning-trophies1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy running column insert trophy features a choice of column color, a marble base and free trophy engraving.custom-pagerunning-trophies1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy running insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.custom-pagescienceawards1498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy science column insert trophy features a choice of column color, a marble base and free trophy engraving.Sciencecustom-pagescienceawards1498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy science insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Sciencecustom-pagetrophies-soccer1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Economy Soccer Column Insert Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagetrophies-soccer1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Economy Soccer Participation Insert Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagetrophies-softball1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy softball column insert trophy features a choice of column color, a marble base and free trophy engraving.Softball, Sportscustom-pagetrophies-softball1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy softball insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Softball, Sportscustom-pagequickshiptrophies-spelling1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy spelling column insert trophy features a choice of column color, a marble base and free trophy engraving.Spellingcustom-pagequickshiptrophies-spelling1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy spelling insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Spellingcustom-pagestar-trophies1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy star-performer column insert trophy features a choice of column color, a marble base and free trophy engraving.Starcustom-pagestar-trophies1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy star-performer insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Starcustom-pagetrophies-swimming-diving1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy swimming column insert trophy features a choice of column color, a marble base and free trophy engraving.Swimming / Diving, Sportscustom-pagetrophies-swimming-diving1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy swimming insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Swimming / Diving, Sportscustom-pagetrophies-t-ball1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy t-ball column insert trophy features a choice of column color, a marble base and free trophy engraving.Baseball / T-Ball, T-Ball, Sportscustom-pagetrophies-t-ball1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy t-ball insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Baseball / T-Ball, T-Ball, Sportscustom-pagetrophies-table-tennis-ping-pong1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy table tennis column insert trophy features a choice of column color, a marble base and free trophy engraving.Ping Pong / Table Tenniscustom-pagetrophies-table-tennis-ping-pong1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy table tennis insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Ping Pong / Table Tenniscustom-pagetrophies-tennis1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy tennis column insert trophy features a choice of column color, a marble base and free trophy engraving.Tennis, Sportscustom-pagetrophies-tennis1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy tennis insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Tennis, Sportscustom-pagetorch-trophies1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy Torch column insert trophy features a choice of column color, a marble base and free trophy engraving.Torch, 1st / 2nd / 3rd / Etc.custom-pagetorch-trophies1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy Torch insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Torch, 1st / 2nd / 3rd / Etc.custom-pagetrophies-track-field1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy track column insert trophy features a choice of column color, a marble base and free trophy engraving.custom-pagetrophies-track-field1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy track insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.custom-pagetrophies-car-truck1498851-212421.33TrophiesSports, Hobby, Org, Livestock1Find these vintage pick-up truck budget trophies with a marble base discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtvintagepickupscb1trophies498551-312Trophy CentralTrophies1Find this budget trophy discounted at Trophy Central. Features a real marble base and a choice of over 80 plastic figures. Engraving is free. Fast 1-2 day shipping.1custom-pagetrophies-volleyball1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy volleyball column insert trophy features a choice of column color, a marble base and free trophy engraving.Volleyball, Sportscustom-pagetrophies-volleyball1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy volleyball insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Volleyball, Sportscustom-pagetrophies-volunteer1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy volunteer column insert trophy features a choice of column color, a marble base and free trophy engraving.Volunteercustom-pagequickshiptrophies-fireman1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy volunteer firefighter column insert trophy features a choice of column color, a marble base and free trophy engraving.Firefightercustom-pagequickshiptrophies-fireman1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy volunteer firefighter insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Firefightercustom-pagetrophies-volunteer1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy volunteer insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.volunteer-e-part-iVolunteercustom-pagetrophies-weightlifting-power1trophies498551-210.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy weightlifting excellence column insert trophy features a choice of column color, a marble base and free trophy engraving.Weightlifting, Sportscustom-pagetrophies-wrestling1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy wrestling column insert trophy features a choice of column color, a marble base and free trophy engraving.Wrestling, Sportscustom-pagetrophies-wrestling1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy wrestling insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Wrestling, Sportscustom-pagemascottrophies1"4-6 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511016.25Classic MedallicsTrophiesAcademic1:22%,5:24%,10:28%,50:32%"Mascot Awards"Find Buffalo Trophies Discounted at TrophyCentral. Each Mascot and Buffalo Trophy Includes Engraving. Fast Shipping!mt2020Mascotcustom-pagemascotinserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsMascots1Buy these quality Buffalos Mascot Medal Inserts at TrophyCentral. Each Buffalos Insert can be used to create a unique plaque, medal or trophy.489919Mascot
11Comprehensive guide for teachers and administrators on building sustainable recognition programs that celebrate character, integrity, and positive behavior in schools.11Create a powerful employee recognition program with our comprehensive step-by-step playbook. Learn proven strategies, avoid common pitfalls, and build a culture of appreciation that drives real results.11Comprehensive guide for coaches on creating meaningful sportsmanship awards that reinforce team values. Includes award design systems, selection processes, recognition formats, implementation timelines, and strategies.11Stop forgetting your best stories. Learn to document character moments using phone notes, weekly reflections, or voice memos. Perfect for scholarship prep.custom-pagename-badges-tagswoyoulipr100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoName Badges1Find These Custom Bulb Shaped Badges Discounted At TrophyCentral.namebadges-bulbcustom-pagequickshiptrophies-bull1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find This Bull Figure Place Trophy with 1st, 2nd or 3rd Place Gold Trim, Marble Base and Free Engraving Discounted at TrophyCentral. Ships in a fast 1-2 days!qtbullplcustom-pagequickshiptrophies-bull1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%This popular Bull Figure Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!qtbullyrcustom-pagequickshiptrophies-bull1trophies498852-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with bull figure discounted at TrophyCentral. Includes free text engraving!cup-bull-pcustom-pagequickshiptrophies-bull1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these bull figure budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtbullscbcustom-pagequickshiptrophies-bull1498852-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Find this budget bull award trophy discounted at Trophy Central. Features a real marble base and plastic bull figure. Engraving is free. Fast 1-2 day shipping.quickshiptrophies-bullcustom-pagequickshiptrophies-bull1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:26%Find these fabulous two-tier Bull Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtbullttcustom-pagequickshiptrophies-bull1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.751434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:28%Find this awesome Bull Figure two-tier championship trophy discounted, and with free engraving, at TrophyCentral!qtbullttwcustom-pagequickshiptrophies-bull1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:21%,100:24%These popular Bull Figure Elite Series Trophies feature a choice of column size and color, a white marble base and free trophy personalization!custom-pagequickshiptrophies-bull1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.05Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%Find This Popular Bull Figure Deluxe Platform Series Trophy Discounted at TrophyCentral. Real Marble Base; Free Personalization!custom-pagemedallion-inserts-general-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these quality Bull Dog Inserts (Litho) at TrophyCentral. Each Bull Dog Insert can be used to create a unique plaque, medal or trophy.50506103-09-2018
custom-pagemascotpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:22%,50:30%,100:33%,500:47%"Mascot Awards" "Mascot Pins"Find these Bull Dog Lapel Pins and other colorful mascot pins at TrophyCentral. Fast 1-2 day shipping!em09Mascotcustom-pagequickshiptrophies-bull1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Bull Figure figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-bull-scbcustom-pagequickshiptrophies-bull1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.41226Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:18%,10:23%Find these fabulous two-tier, 3-column champion Bull Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtbull3ccustom-pagequickshiptrophies-bull1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:27%,100:32%Our popular Bull Figure participation trophies feature a real slant-front marble base and free engraving.qtbullnccustom-pagequickshiptrophies-bull1trophies498551-310.452429Trophies1Find our Bull star column trophy discounted at TrophyCentral. Features a real marble base, 6 inch gold star-shaped column, free engraving and fast shipping.bull-star-column-trophycustom-pagequickshiptrophies-rabbitqtbullncqtbulldmqtbullplqtbullyrqtbullttqtbullttwqtbull3cqtbullscmqtbullscbcup-bull-pcup-bull-scbbdg-bullbull-star-column-trophy11Find Bull Trophies discounted at TrophyCentral. Each Bull Trophy includes engraving. Fast 1-2 day shipping.bull trophies, bull trophy, bull awards, bull trophies and awards

Shop With Confidence at TrophyCentral

We offer a huge selection, discounted prices and great customer service. Do you need help with some ideas or with ordering? Yes, we sell online, but we have real people who would love to help you! Feel free to call our customer service experts in Michigan, New York and online. TrophyCentral - delivering smiles since 1999!


]]>
quickshiptrophies-goatBull Figure
custom-pagemascot-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoName Badges1Find These Custom Bulldog Mascot Badges Discounted At TrophyCentral.mascotbadges-bulldog2custom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceSealsEmbosser Seals1:22%,3:28%,5:31%Find these Bulldog Certificate Seals discounted at TrophyCentral. Seals are easy to apply with a pressure-sensitive backing.803bldgMascotcustom-pageplaques1plaques498552-41JDSPlaques1Find this bulldog plaque discounted at TrophyCentral. Our bulldog mascot plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Mascotcustom-pagemascottrophies1trophies105503-610.4511016.25Classic MedallicsTrophiesAcademic1:22%,5:24%,10:29%,50:32%"Mascot Awards"Buy this Bull Dog mascot trophy and other mascot awards at TrophyCentral.ts1023Mascotcustom-pagemascot-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoName Badges1Find These Custom Bulldog Shaped Mascot Badges Discounted At TrophyCentral.mascotbadges-bulldogcustom-pagemascotinserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsMascots1Buy these quality Bulldogs Mascot Medal Inserts at TrophyCentral. Each Insert can be used to create a unique plaque, medal or trophy.489922Mascot
custom-pagedisplaycases211"7-10 business days" "Connelly Springs, North Carolina" "UPS (FedEx available on request)"display case286127-1010.45840.45SpartaCraftDisplay CasesSpecialty Cases1:14%Buy this Burial Flag and other Flags at discounted prices from TrophyCentral.Flag Casescustom-pagetrophies-soccer1"2-4 business days" "Marquette, MI" "UPS"medals498552-40.530012.37PDU-SMedalsSports, Hobby, Org, Livestock1:22%,100:35%"Sports Medals" "Soccer Medals" "Soccer Awards" "Soccer Medals and Trophies" "Soccer Trophies and Medals"Burst-Out Soccer Ball Medal. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.08-10-2013Soccer, Sportscustom-pagequickshiptrophies-bass1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.7169.14Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,5:26%,50:30%"Fishing Trophies" "Fishing Awards"This fun Fishing (Bass) 'Burst Thru' trophy has an exciting and captivating design that your athletes and kids will love. Fishing (Bass) trophies include free engraving.wbt79008-01-2022Fishing, Sportscustom-pagetrophies-car-truck1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.7169.14Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,5:26%,50:30%This fun Car Show 'Burst Thru' trophy has an exciting and captivating design that your athletes and kids will love. Car Show trophies include free engraving.wbt792custom-pagetrophies-cheerleading-spirit1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.7169.14Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,10:25%,25:27%"Cheerleading Trophy" "Cheerleading Trophies"This fun Cheer / Pom Pom 'Burst Thru' trophy has an exciting and captivating design that your athletes and kids will love. Cheer / Pom Pom trophies include free engraving.wbt660Cheerleading, Sportscustom-pagetrophies-ice-hockey1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.7169.14Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,5:26%,50:30%"Hockey Trophies" "Hockey Trophy" "Hockey Awards"This fun Hockey 'Burst Thru' trophy has an exciting and captivating design that your athletes and kids will love. Hockey trophies include free engraving.wbt767Hockey, Sportscustom-pageinserts15011014897355073885070285182155182065071565181855186225187145177915177834919215178365177905187455177895186014897675184834898415186935181715186825181595187575177845186565182144898305185015178015042515014015071655181605185715176535183565177875184995133215014115181845181745045115177985185344898755186715185935187605182885187265186454981505075745177865183674897245181575186675187305075825183711inserts11"Award for Business" "Awards for Business"1inserts112-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
498555-8.52
custom-pageletter-shaped-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoName Badges1Find these popular C-shaped custom mascot badges at TrophyCentral. Great for fundraising! TrophyCentral is a top-rated Yahoo merchant.letterbadges-ccustom-pagemedallion-inserts-occupational-subjects12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Caduceus Inserts (Litho) at TrophyCentral. Each Caduceus Insert can be used to create a unique plaque, medal or trophy.504301
custom-pagemedallion-inserts-occupational-subjects12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these high-quality Caduceus Inserts at TrophyCentral. Each Caduceus Insert can be used to create a unique plaque, medal or trophy.517852Occupations
custom-pagegeneral-corporate-awards1"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"458221510.45318.45Vision AwardsCrystal Awards1:22%,26:33%Caelum Jade Glass Awards on Marble from TrophyCentral.See our complete selection ofin a variety of sizes and styles.general-corporate-awards12-20-2020custom-pagetrophies-car-truck1trophies498551-310.452429Trophies1Find this popular Camaro trophy discounted at TrophyCentral. Features a real marble base, stylish 4-inch gold cup, free engraving and fast shipping.camaro-cup-place-trophycustom-pagetrophies-car-truck1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Fabulous Camaro Place Trophy with 1st, 2nd or 3rd Place Trim, Marble Base and Free Engraving. Ships in a fast 1-2 days!qtcamaroplcustom-pagetrophies-car-truck1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find these popular Camaro Figure year trim trophies discounted at TrophyCentral. Available in multiple sizes and includes free personalization.qtcamaroyrcustom-pagetrophies-car-truck1trophies498852-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with Camaro figure discounted at TrophyCentral. Includes free text engraving!cup-camaro-pcustom-pagetrophies-car-truck1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these Camaro budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtcamaroscbcustom-pagetrophies-car-truck1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:26%Find these fabulous two-tier Camaro Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtcamarottcustom-pagetrophies-car-truck1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.751434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:28%Find this awesome Camaro Figure two tier championship trophy discounted at TrophyCentral. Add up to 3 lines of Free Personalization!qtcamarottwcustom-pagetrophies-car-truck1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:21%,100:24%This popular Camaro Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtcamarosccustom-pagetrophies-car-truck1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.05Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%Find This Popular Camaro Deluxe Platform Series Trophy Discounted at TrophyCentral. Real Marble Base; Free Personalization!custom-pagetrophies-car-truck1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Camaro figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-camaro-scbcustom-pagetrophies-car-truck1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.41226Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:18%,10:23%Find these fabulous Camaro Champions Line 3-column Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qtcamaro3ccustom-pagetrophies-car-truck1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:27%,100:32%Our popular Car Show, Camaro participation trophies feature a real slant-front marble base and free engraving.qtcamaronccustom-pagetrophies-car-truck1trophies498551-310.452429Trophies1Find our Camaro star column trophy discounted at TrophyCentral. Features a real marble base, 6 inch gold star-shaped column, free engraving and fast shipping.camaro-star-column-trophy11See a fabulous selection of Camaro Figure Trophies at TrophyCentral. Free engraving on Camaro Trophies.camaro trophies, camaro trophy, camaro awards, camaro trophies and awards

Shop for Car & Truck Trophies with Confidence at TrophyCentral

We offer a huge selection, discounted prices and free shipping on orders for trophies, awards and great customer service. Do you need help with some ideas or with ordering? Yes, we sell online, but we have real people who would love to help you! Feel free to call our customer service experts in Michigan, New York and online. TrophyCentral - delivering smiles since 1999!


]]>
Camaro
noindexed-items111custom-pagetrophies-campers1trophies498551-310.452429Trophies1Find this popular Camp place trim insert trophy discounted at TrophyCentral. Features a real marble base, stylish 4-inch gold cup, free engraving and fast shipping.camp-cup-place-trophy-icustom-pagefreeawardcertificates1"Download Only"free-camp4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Camp Spirit certificate template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.camp-spirit-awardcamp-spiritCampingcustom-pagesummer-camp-awardscampers-champ-icamping-e-part-icamping-e-single-icup-camp-incampers-part-icampers-single-icampers-mccampers-mc-prcampers-jigfcampers-jibfcampers-jisfcampers-plaque-icamp-cup-place-trophy-icamp-cup-place-column-trophy-i1trophies1Find camp trophies, medals and awards discounted at TrophyCentral. Each camp trophy includes engraving. Medals feature a camping design and include a ribbon.

Camp Trophies and Awards - Meaningful Recognition for Every Camper, Counselor, and Season

Camp trophies and awards mark the end of a summer season in a way that no photograph or certificate can fully capture, giving campers and counselors a tangible keepsake that connects them to the friendships, accomplishments, and memories made during their time at camp. From cabin competition champions and color war winners to activity specialists earning recognition in archery, swimming, ropes course, and arts and crafts, quality camp awards reflect the full range of achievement and personal growth that a summer program delivers. Our camp trophy collection features achievement figurines and insert designs suited for every camp activity and recognition category, in sizes from affordable individual camper awards to the large cabin championship and color war trophies that become part of a camp's permanent recognition tradition. Camp medals with free neck ribbons offer a wearable alternative ideal for activity competitions and large closing ceremonies where presenting a medal to every participating camper is the goal, while camp plaques provide permanent wall-mounted recognition suited for lodge and dining hall displays honoring outstanding counselors, long-term staff, and milestone program achievements. Every camp trophy includes free engraving personalized with camper name, award category, camp name, and session or summer year.

Frequently Asked Questions About Camp Trophies and Awards

What types of camp awards and recognition programs use trophies?

Camp trophies and awards are used across a wide range of summer camp recognition contexts, from individual activity competitions to season-long program traditions that campers look forward to every year. Color war and camp Olympics competitions are among the most common uses for larger camp trophies, where the season-culminating team competition deserves a championship trophy that reflects the intensity and meaning of the event within the camp community. Cabin competition trophies recognize the group that accumulated the most points across the session through spirit, cleanliness, activity participation, and sportsmanship, with the award often displayed in the winning cabin or dining hall as a symbol of seasonal pride. Individual activity recognition programs present trophies and medals to campers who demonstrated excellence or significant improvement in specific skills including swimming, archery, tennis, horseback riding, ropes course, sailing, and performing arts. Counselor of the session and staff recognition awards honor the adults who make the camp experience possible, with trophies and plaques presented at end of session ceremonies acknowledging outstanding leadership, camper impact, and program contribution. End of summer banquets and closing ceremonies bring all recognition together in a single event, making the full range of camp award sizes and formats relevant in a single evening where every camper and staff member deserving recognition receives a meaningful award.

What should camp trophy and award engraving include?

Camp award engraving should capture the specific recognition and season so the award remains meaningful as a keepsake long after the summer ends. Essential elements include camper or recipient name, award title, camp name, and summer year. For example: Jake Morrison, Color War Champion, Blue Team, Camp Lakeview, Summer 2025, or Emma Rodriguez, Archery Excellence Award, Camp Pinecrest, Session 2, 2025. Cabin competition trophies benefit from including the cabin name alongside the award title: Lakeside Cabin, Spirit Award Champions, Camp Ridgewood, Summer 2025. Counselor and staff awards should note the specific role and session alongside a brief recognition phrase such as Outstanding Counselor, Waterfront Division, Camp Sunrise, 2025. For camps running multiple sessions throughout the summer, noting the specific session number helps recipients remember exactly when their achievement occurred. Activity specialist awards gain meaning from including the specific skill level achieved, such as Advanced Swimmer or Expert Archer, alongside the camper name and camp details. Camps building a permanent recognition tradition with perpetual trophies that accumulate new winners each summer should establish a consistent engraving format from the first year so the trophy's growing history of champions reads as an organized record rather than a collection of different formatting styles.

Should camps give awards to every camper or only to top performers and competition winners?

The right approach for camp recognition depends on the camp's philosophy and the specific program, but most successful camps use a layered recognition structure that ensures every camper receives some form of acknowledgment while reserving more significant awards for genuine achievement and competition outcomes. Universal participation recognition in the form of certificates, medals, or small keepsakes presented to every camper at the closing ceremony ensures that every child leaves with a tangible memory of their summer regardless of competitive performance, which is particularly important for younger camper age groups where the experience of receiving an award may be as significant as the award itself. Competitive recognition through color war trophies, cabin competition awards, and activity champion medals should be earned and presented in a way that celebrates genuine achievement and effort, giving the awards real meaning within the camp community. Individual recognition for personal growth, character, and specific accomplishment, such as most improved swimmer, best new camper, or outstanding sportsmanship, serves the important purpose of seeing individual campers beyond their competitive performance and acknowledging the personal qualities they demonstrated during the session. Counselor and staff recognition is often overlooked in camp award programs but carries significant impact for retention, morale, and program quality, making it worth including in every end of session ceremony regardless of budget constraints. For specific guidance on building a complete camp recognition program see our camp awards resource guide, which covers recognition strategies for every type of summer program.

If you need more information before deciding, see our expert resource section:
]]>
trophies-campersCamp / Camping
custom-pagefreeawardcertificates1"Download Only"free-camp4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Camper of the Week Award template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.camper-of-the-weekcamper-of-the-weekCampingcustom-pagetrophies-campers20498551-30.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful Campers 2" Epoxy-covered insert decal discounted at TrophyCentral. Fast 1-2 day shipping.Camp / Campingcustom-pagefreeawardcertificates1"Download Only"free-camp4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Camping Award template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.camping-awardcamping-awardCampingcustom-pagetrophies-campers1trophies498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Camp / Campers Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Camp / Campingcustom-pagetrophies-campers1trophies498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Campers insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-Campers-InsertCamp / Campingcustom-pagetrophies-campers1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Campers single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - CampersCamp / Campingcustom-pagetrophies-campers1trophies498551-311821.06TrophyCentralTrophies1Camp / Campingcustom-pagetrophies-campers1trophies498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Camp / Campers Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Camp / Campingcustom-pagetrophies-campers1trophies498551-30.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this Colorful Campers Insert Medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Camp / Campingcustom-pagetrophies-campers1trophies498551-30.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this Campers insert medal With A Personalized Front Rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Camp / Campingcustom-pageplaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these campers insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Campers / Campingcustom-pagetrophies-campers1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Campers insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - CampersCamp / Campingcustom-pagetrophies-campers1trophies498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Camp / Campers Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Camp / Campingcustom-pageask-trophy-expert11Yes! You can easily add plates to your perpetual plaque as new winners are recognized. Learn how the process works and how to order replacement plates.11Custom ribbons need 25-100 piece minimums for flat ribbons, 10-25 for rosettes. Add event names, years, or achievements with 2-3 week production time. custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Canoe Standard Inserts (Litho) at TrophyCentral. Each Canoe Standard Insert can be used to create a unique plaque, medal or trophy.50247112-20-2040Boating / Sailing, Sports
custom-pagequickshiptrophies-graduate1embossed-seals"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceSealsEmbosser Seals1:22%,3:28%,5:31%803dgGraduation, Academiccustom-pagedisplaycases211"5-10 business days" "Connelly Springs, North Carolina" "UPS (FedEx available on request)"display case286125-1010.456108.45SpartaCraftDisplay CasesSpecialty Cases11:14%"Military Awards"12-20-2040Flag Casescustom-pagedisplaycases211"7-10 business days" "Connelly Springs, North Carolina" "UPS (FedEx available on request)"display case286127-1010.45460.45SpartaCraftDisplay CasesSpecialty Cases11:14%"Display Cases" "Popular Display Cases" "Most Popular Display Cases"Capitol Flag Cases from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.Flag Casescustom-pageclocks11"7-10 business days w/engraving" "Chicago, Illinois" "UPS (FedEx available on request)"personalized gifts606307-101 3 230.45129.81RS OwensGiftsEngraved Gifts1:22%Find this Captain's Clock and other personalized gifts at TrophyCentral. All clocks include free engraving.Engraved Clockscustom-pagenoname11acraccarholdwallmountracinghelmetracecardisplaynasdisplaynasdisplaydoublecapdisplay11Find Car Display Cases Discounted at TrophyCentral; a Perfect Way to Display Your Prized Model Race Car. Optional engraving and fast shipping!

Shop for Car & Racing Display Cases with Confidence at TrophyCentral

We offer a huge selection, discounted prices and fabulous customer service. Do you need help with some ideas or with ordering? Yes, we sell online, but we have real people who would love to help you! Feel free to call our experts in Michigan, New York and online. TrophyCentral - delivering smiles since 1999!


]]>
sports-resource-hub11Discover the ultimate car show trophy and award guide! From classic car shows to hot rod events, find creative award ideas that celebrate automotive excellence and passion.custom-pageblog-trophycentral11Based on the content, here are a few meta description options for you: Option 1 (Benefit-focused): "Discover unique car show trophy ideas that celebrate automotive excellence. From crystal piston awards to vintage steering wheels, find the perfect trophies to honor your event's winners and create lasting memories.1custom-pageshop-by-categorytr9926wbt792qtdograceqtcamaroncqtcamaroscqtcamaroplqtcamaroyrqtcamarottqtcamarottwqtcamaro3cqtcamarodmmqtcamaroscbcup-camaro-scbcup-camaro-pcamaro-cup-place-trophycamaro-cup-place-column-trophycamaro-star-column-trophyqtchevyncqtchevyscqtchevydmqtchevyplqtchevyyrqtchevyttqtchevyttwqtchevy3ccup-chevy-pmqtchevyscbcup-chevy-scbqtvintagepickupncqtvintagepickupscqtvintagepickupplqtvintagepickupyrqtvintagepickupttqtvintagepickupttwqtvintagepickup3cqtvintagepickupdmcup-vintagepickup-scbcup-vintagepickup-pmqtvintagepickupscbpick-up-truck-cup-place-column-trophypick-up-truck-cup-place-trophyqtscarncqtscarscqtscardmqtscaryrqtscarplqtscarttqtscarttwqtscar3cqtstockperpmqtscarscbcup-scar-pcup-scar-scbqtstreetrodncqtstreetrodscqtstreetroddmqtstreetrodplqtstreetrodyrqtstreetrodttqtstreetrodttwqtstreetrod3cmqtstreetrodscbcup-streetrod-scbcup-streetrod-pstreet-rod-cup-place-column-trophystreet-rod-cup-place-trophy1trophies1Find a great selection of car show trophies discounted at TrophyCentral. Each car show trophy includes free personalization. Fast 1-2 day shipping.

Car Show Trophies and Awards - Recognize Every Build, Class, and Best in Show

Car show trophies are the centerpiece of the award ceremony tradition that turns a gathering of automotive enthusiasts into a competitive event worth preparing for, traveling to, and coming back to year after year. Whether the show features rows of pristine muscle cars competing for class honors, lifted trucks drawing crowds to the custom truck division, daily-driven imports showcasing aftermarket builds, or a mixed field of classics and customs spanning every era of American automotive history, the right trophy communicates that the judges took the competition seriously and that the winners earned something worth displaying. Our car show trophy collection features car and truck figurine designs on traditional column bases in a range of sizes from affordable dash plaque and participant trophies to impressive multi-column Best in Show pieces that serve as the visual anchor of the entire awards program. Column designs with car insert figurines in gold and silver finishes allow show organizers to build a consistent trophy program across all award categories, while premium resin car sculptures offer a more detailed and distinctive alternative for flagship categories and feature awards that warrant a more distinctive presentation. Every trophy includes free engraving personalized with owner name, award category, show name, car club or organizing group, and year so the award serves as a complete record of the achievement rather than a generic figurine on a base.

Frequently Asked Questions About Car Show Trophies

What award categories do most car and truck shows use?

Car and truck show award structures typically combine vehicle class awards with special category trophies that recognize specific areas of excellence regardless of class division. Vehicle class awards divide entries by era, body style, or vehicle type to ensure fair competition among similar builds, with common divisions including pre-1949 classics, 1950s, 1960s, muscle cars, trucks, imports, and modified or custom classes that allow organizers to group vehicles with similar competitive profiles. Special category awards recognize excellence in specific areas regardless of class, with Best Paint, Best Engine, Best Interior, Best of Show, Most Original, Best Custom, and Longest Distance Traveled among the most popular. Truck-specific shows add categories including Best Lifted Truck, Best Lowered Truck, Best Work Truck, and Best Engine Bay to reflect the specific build styles that define the truck show community. People's Choice awards decided by show attendee vote are standard at cruise nights and charity shows where community engagement is as important as competitive judging. Organizers of larger shows sometimes add Mayor's Award, Sponsor's Choice, or Club President's Award for additional special recognition that extends beyond the standard judging categories. Participant dash plaques presented to every registered entrant are expected at most shows, acknowledging that every owner who brought their vehicle contributed to making the event possible regardless of competitive outcome.

What trophy sizes work best for different car show award levels?

Car show trophy sizing creates the visual hierarchy that communicates achievement level to every person at the awards ceremony, making proportional sizing across all award categories one of the most important decisions an organizer makes when ordering trophies. Participant and dash plaque awards work best as smaller flat plaque pieces or 6-inch to 8-inch economy trophies that acknowledge every entrant without visually competing with the class and category awards. Vehicle class winners in individual divisions are well served by 12-inch to 16-inch single column trophies that have genuine display presence without overshadowing the special category and Best in Show awards at the top of the program. Special category winners for Best Paint, Best Engine, and Best Interior deserve 14-inch to 18-inch trophies that reflect the selective nature of the award and reward the specific excellence being recognized at a level above class competition. People's Choice awards typically rate the same tier as special categories since the collective vote of the attending public carries real prestige within the enthusiast community. The Best in Show or Best of Show trophy should be visibly and unmistakably more impressive than every other award at the event, with 24-inch to 30-inch multi-column championship pieces the standard choice for this role at most organized shows. The visual gap between a class winner trophy and the Best in Show piece is what gives the top award its meaning and creates the moment that owners remember and photograph, so investing in the flagship award is always the right decision regardless of the overall event budget.

What should car show trophy engraving include?

Car show trophy engraving should document the vehicle, the owner, the award, and the event so the trophy tells a complete story when the owner looks at it years later. Essential elements include owner name, vehicle year and make, award category, show or event name, organizing club or association, and year. For example: Mike Torres, 1969 Camaro SS, Best in Show, Lakeside Annual Car Show, River City Classic Car Club, 2025, or Patricia Walsh, 1955 Chevy Bel Air, Best Paint, Charity Cruise Night, August 2025. Including the vehicle year and make is particularly meaningful for car show trophies because the vehicle is the centerpiece of the achievement and a trophy that names both the owner and the car creates a far more complete keepsake than one that only identifies the person. For truck show trophies, noting the specific division such as Best Lifted Truck 2025 or Custom Truck Class Winner helps the award communicate the competitive context without requiring additional explanation. People's Choice awards benefit from noting that the recognition came from the vote of fellow enthusiasts and show attendees rather than from judges, since many owners consider a people's vote the most meaningful recognition they can receive at a car show. When space is limited on smaller trophies, owner name, award title, show name, and year are the four essential elements that make an engraved trophy meaningfully different from an unengraved one.

If you need more information before deciding, see our expert resource section:
]]>
Car Show
custom-pagemascotpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:30%,50:36%,100:46%,500:52%"Mascot Awards"Find These Cardinal Lapel Pins with Antique Finish Discounted at TrophyCentral! Also See Our Other Fabulous School Mascot Pins. Fast 1-2 Day Shipping!pm20Mascotcustom-pagemascot-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoName Badges1Find These Custom Cardinal Mascot Badges Discounted At TrophyCentral.mascotbadges-cardinalcustom-pageplaques1plaques498552-41JDSPlaques1Find this cardinal plaque discounted at TrophyCentral. Our cardinal mascot plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Mascotcustom-pagemascotinserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsMascots1Buy these quality Cardinals Mascot Medal Inserts at TrophyCentral. Each Cardinals Insert can be used to create a unique plaque, medal or trophy.489952Mascot
custom-pageaward-medalsqtcardsncqtcardsscqtcardsdmqtcardsyrqtcardsplqtcardsttqtcardsttwqtcards3cqtcardtrpokerkeychainlapelpinpokermedalpokerplaquetm9862qtcardsperpmqtcardsscbcup-cards-pcup-cards-scbbdg-cardscards-poker-cup-place-column-trophycards-poker-cup-place-trophycards-poker-star-column-trophy1trophies1Find Poker Trophies Discounted at TrophyCentral. Each Poker Trophy and Cards Trophy Includes Free Personalization!Custom Poker Trophies TrophyCentral has an industry-leading selection of poker trophies to meet your needs. Be sure to see our popular Single Column trophies, available in several sizes and with several different color columns.
All of our poker trophies include up to three lines of FREE ENGRAVING (larger awards include additional lines).

The TrophyCentral Difference

We have the guaranteed lowest prices and top-rated customer service. Yes, there are "real" people at TrophyCentral ready to answer your questions and to help you find the right cards (poker) trophy for your needs. If you have any questions regarding your cards or poker trophy order, simply call us toll-free at 1-888-809-8800.]]>
silver-cup-trophies trophies-victory
custom-pagetrophies-cards-poker1trophies498551-310.452429Trophies1Find this popular Cards / Poker trophy discounted at TrophyCentral. Features a real marble base, stylish 4-inch gold cup, free engraving and fast shipping.cards-poker-cup-place-trophycustom-pagetrophies-cards-poker1trophies498551-310.452429Trophies1Find our Cards / Poker star column trophy discounted at TrophyCentral. Features a real marble base, 6 inch gold star-shaped column, free engraving and fast shipping.cards/poker-star-column-trophycustom-pagetrophies-cards-poker1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Fabulous Cards Figure trophy with choice of 1st, 2nd or 3rd place trim.qtcardsplcustom-pagetrophies-cards-poker1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%This popular Cards Figure trophy features a real marble base, column, figure and trim indicating year of award. Includes up to three lines of free engraving!qtcardsyrcustom-pagetrophies-cards-poker1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous two-tier Cards Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtcardsttcustom-pagetrophies-cards-poker1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.2115Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%See this championship trophy with a Cards figure at TrophyCentral. Be sure to see all of our Cards figure awards.qtcardsttwcustom-pagetrophies-cards-poker1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%This popular Cards Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtcardssccustom-pagetrophies-cards-poker1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451623.65Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%These quick-ship trophies from TrophyCentral feature a Playing Cards figure, real marble base and marble trophy figure platform, choice of column size and color.qtcardsdmcustom-pagetrophies-cards-poker1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Cards figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-cards-scbcustom-pagetrophies-cards-poker1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.4118Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous two-tier, 3-column champion Cards Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtcards3ccustom-pagetrophies-cards-poker1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%,25:23%,50:29%,100:34%Our popular Cards participation trophies feature a real slant-front marble base and free engraving.qtcardsnccustom-pagegeneral-corporate-awards11"7-10 business days w/engraving" "Chicago, Illinois" "UPS (FedEx available on request)"606307-101 3 230.45216.45RS OwensTrophies1:22%12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
498555-8.52
custom-pagewalnut-insert-plaques1"3-6 business days with engraving, Without engraving: 1-3 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"plaques105503-610.4511219.65Classic MedallicsPlaquesInsert1:22%,3:24%,5:27%"School Awards" "School Products"Genuine Walnut Catholic Youth Organization (CYO) Plaque with 2 Inch Insert and Free Engraving.51-1501Religiouscustom-pagemedallion-inserts-general-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these quality Cats Inserts (Litho) at TrophyCentral. Each Cats Insert can be used to create a unique plaque, medal or trophy.501861General
custom-pagetrophies-golf1"10 business days" "Aliquippa, PA" "UPS"trophies1500110-1410.451236.45Glass AmericaCrystal Awards1:22%,10:25%Cavanaugh Golf Tower. Ideal for leagues, schools, and tournaments. Fast shipping.Golf, Sportscustom-pagefloating-plaques1"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"plaques458221510.451240.05Vision AwardsPlaquesEngraved Plaques1:22%,26:35%"Star Awards" "General Recognition Awards" "Star Award"Unique Corporate Awards: Celeb from TrophyCentral.custom-pagegift-certificate-templates1"Download Only"certificates4985501Trophy CentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our celebrate themed template is free and designed exclusively for Trophy Central. This gift certificate measures 5" x 3" and can be easily downloaded and printed.Celebrate-Gift-Certificategc-celebrate-521Birthday, Appreciation, Gift Certificate, Holidaycustom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsGeneral1:22%Buy these high-quality Celebrate Teamwork Inserts at TrophyCentral. Each Celebrate Teamwork Insert can be used to create a unique plaque, medal or trophy.518622General, Star
custom-pageschool-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"Find these Celebrating Excellence pins discounted at TrophyCentral. Each lapel pin features a quality clutch-back. Fast 1-2 day shipping.br411Business, Generalcustom-pagecorporatepins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsBusiness1:30%,50:32%,100:35%,500:39%Find these Celebrating Teamwork pins discounted at TrophyCentral. Each Celebrating Teamwork Award pin features a quality clutch-back. Fast 1-2 day shipping.cete04-04-2008Business11Discover the perfect awards to celebrate your child's theater, dance, and music achievements. From first recitals to starring roles, learn how to choose meaningful recognition that builds confidence and celebrates creativity.custom-pagegeneral-corporate-awards11"7-10 business days w/engraving" "Kentucky" "UPS (FedEx available on request)"general410187-1010.45432.45JcharlesTrophies1:22%,25:25%"Corporate Awards"Celestial Corporate Awards from TrophyCentral. Discounted Trophies, Awards and Promotional Products.custom-pagemusicartpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsMusic, Drama, Art, Dance1:22%,50:30%,100:33%,500:45%"Music Lapel Pins" "Band Lapel Pins" "Music Pins"Find These Cello Pins Discounted at TrophyCentral. Each Cello Pin Features a Clutch-Pin Back and Fast 1-2 Day Shipping!mp22Music / Band / Choruscustom-pagetm990115"1-3 business days" "Columbia, South Carolina; Marquette, Michigan" "UPS (FedEx available on request)"290631-21 2 3 230.45100020.45Certificate SourceCertificatesAward Certificates1:22%,50:38%,100:42%Recipients will love these realistic photo reading award certificates discounted at TrophyCentral. Each certificate measures 8 1/2" x 11" and typically ships in 1-2 days.7008Readingcustom-pagecertificate-diploma-covers125"1-3 business days wo/imprinting, 8-14 days w/imprinting" "Columbia, South Carolina" "UPS (FedEx available on request)"diploma covers290631-31 2 3 230.4520020.45Certificates1"School Products" "Quick-Ship Items" "Diploma Holders" "Padded Diploma Covers" "School Diploma Covers" "Diploma Covers" "Custom Diploma Covers" "Award Certificates and Diploma Covers" "Award Certificates and Diploma Holders" "Award Certificates and Diploma Frames" "Award Certificate and Diploma Holders" "Certificate and Diploma Holders" "Certificates and Frames" "Certificates and Diploma Holders" "Diploma Covers and Certificates" "Diploma Covers and Award Certificates" "Diploma Covers, Frames and Holders" "Diploma Covers, Frames, Holders and Certificates"custom-pageawardcertificates115"1-3 business days" "Columbia, South Carolina; Marquette, Michigan" "UPS (FedEx available on request)"certificates290631-21 2 3 230.45100020.45Certificate SourceCertificatesAward Certificates1:22%,50:38%,100:42%Find these Academic Excellence certificates discounted at TrophyCentral. Each Academic Excellence certificate measures 8 1/2 x 11 inches and typically ships in 1-2 days.7021Academiccustom-pageawardcertificates11certificates290631-31 2 3 230.45100020.45Certificate SourceCertificatesAward Certificates1:22%,25:24%,100:40%,500:50%Find These Printed Certificates of Achievement At TrophyCentral. Each Certificate of Achievement Measures 8 1/2 x 11.904Generalcustom-pagesporcer15"1-3 business days" "Columbia, South Carolina; Marquette, Michigan" "UPS (FedEx available on request)"certificates290631-21 2 3 230.45100020.45Certificate SourceCertificatesAward Certificates1:22%,50:38%,100:42%Find these Athletics certificates discounted at TrophyCentral. Each Athletics certificate measures 8 1/2 x 11 inches and typically ships in 1-2 days.7019Sportscustom-pageawardcertificates115"1-3 business days" "Columbia, South Carolina; Marquette, Michigan" "UPS (FedEx available on request)"certificates290631-21 2 3 230.45100020.45Certificate SourceCertificatesAward Certificates1:22%,50:38%,100:42%Recipients will love these realistic Certificate of Award discounted at TrophyCentral. Each certificate measures 8 1/2 x 11 inches and typically ships in 1-2 days.7007Generalcustom-pagemusic-award-certificates15910 803music"1-3 business days" "Columbia, South Carolina; Marquette, Michigan" "UPS (FedEx available on request)"certificates290631-21 2 3 230.45100020.45Certificate SourceCertificatesAward Certificates1:22%,50:38%,100:42%Find these Certificates of Music discounted at TrophyCentral. Each Certificate of Music measures 8 1/2 x 11 inches and typically ships in 1-2 days.7034Music / Band / Choruscustom-pageawardcertificates115"1-3 business days" "Columbia, South Carolina; Marquette, Michigan" "UPS (FedEx available on request)"certificates290631-21 2 3 230.45100020.45Certificate SourceCertificatesAward Certificates1:22%,50:38%,100:42%Find these Participation certificates discounted at TrophyCentral. Each Participation certificate measures 8 1/2 x 11 inches and typically ships in 1-2 days.7020Academiccustom-pageawardcertificates115965 903 attendance 7022 tm9755 ap10 ec34 hp15"1-3 business days" "Columbia, South Carolina; Marquette, Michigan" "UPS (FedEx available on request)"certificates290631-21 2 3 230.45100020.45Certificate SourceCertificatesAward Certificates1:22%,50:38%,100:42%Find these Perfect Attendance certificates discounted at TrophyCentral. Each Perfect Attendance certificate measures 8 1/2 x 11 inches and typically ships in 1-2 days.7003Perfect Attendance / Attendancecustom-pagefree-school-certificate-templates1"Download Only"free-academic49855011TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Free printable Scholarship Award certificate from TrophyCentral, honoring academic scholarship recipients. Measures 11 x 8 1/2 inches.Free-Certificate-of-Scholarship-Certificatescholarship-freeAcademic, Achievementcustom-pagecertificatespn4642wlpn4931wlgpn4931wlspn4931blgpn4931bkgpn4931grgpn4931whgpn4642blpn4642whpn4642grcertificate-plaque-ch-gcertificate-plaque-ch-scertificate-plaque-bm-gcertificate-plaque-bm-scertificate-plaque-ch-flcertificate-plaque-bm-fl1plaques1"Graduation Gifts" "Graduation Gift" "Plaques" "Award Certificates and Diploma Covers" "Award Certificates and Diploma Holders" "Award Certificates and Diploma Frames" "Award Certificate and Diploma Holders" "Certificate and Diploma Holders" "Certificates and Frames" "Certificates and Diploma Holders" "Diploma Covers and Certificates" "Diploma Covers and Award Certificates" "Diploma Covers, Frames and Holders" "Diploma Covers, Frames, Holders and Certificates"

Certificate Plaques - Display Diplomas and Credentials with Lasting Elegance

Certificate plaques protect and present diplomas, professional licenses, training certifications, and achievement awards in a finished, wall-ready display that gives important documents the permanence they deserve. Available in rich cherry and walnut wood finishes, sophisticated black marble, and classic framed styles with gold or silver accent borders, our certificate plaques hold standard 8-1/2 x 11 inch documents under clear plexiglass that shields paper from dust, moisture, and physical damage while keeping credentials fully visible and readable. Frameless styles offer a clean contemporary presentation that lets the document itself take center stage, while framed options add a decorative border that complements simpler certificate designs. Optional engraving plates below the document window add recipient name, credential details, or a recognition message for a fully customized finished piece. Value pricing makes it practical to present certificate plaques alongside the certificate itself, turning a paper award into a complete recognition package the recipient can hang immediately.

Frequently Asked Questions About Certificate Plaques

What types of documents do certificate plaques hold?

Certificate plaques are designed to hold standard 8-1/2 x 11 inch documents, which covers the vast majority of diplomas, professional certifications, training completion certificates, employee recognition awards, and academic achievement certificates issued by schools, universities, licensing boards, and organizations. College and university diplomas, professional licenses such as those issued to CPAs, nurses, real estate agents, and contractors, safety training completions, employee of the month certificates, sales achievement awards, volunteer service recognition, and participation certificates all fit the standard document size. Larger diploma formats from some universities may require a larger plaque size, so it is worth checking the exact dimensions of the document before ordering. Our 10-1/2 x 13 inch plaque options accommodate larger documents while maintaining the same polished presentation as the standard size.

How do framed and frameless certificate plaques differ?

Framed certificate plaques add a decorative gold or silver border around the document window, creating a traditional formal presentation that emphasizes the importance of the credential. The frame draws the eye and complements certificates with simpler designs or plain borders, adding visual weight that the document alone may lack. Framed styles suit professional offices, medical and law practices, and any setting where a classical polished appearance is appropriate. Frameless certificate plaques mount the document under edge-to-edge plexiglass without a surrounding border, producing a clean contemporary look that maximizes document visibility and works well in modern offices and minimalist spaces. Certificates with decorative borders, institutional seals, or distinctive graphic designs tend to display particularly well in frameless styles since nothing competes with the document's own design. The material choice, cherry or walnut wood versus black marble, also shapes the overall impression, with wood finishes conveying warmth and tradition and marble suggesting executive sophistication.

Should certificate plaques include additional engraving?

Additional engraving on the nameplate below the document window is optional but adds meaningful context, particularly when the certificate itself does not include the recipient's full name, when the organization presenting the plaque wants to add a personal message, or when the credential benefits from supplementary details not printed on the certificate. Professional certifications are often enhanced with license numbers or credential abbreviations, for example CPA License 12345, Renewed 2025 or Project Management Professional, PMP 2024. Employee recognition certificates benefit from department or supervisor details that personalize the award beyond what the printed certificate states. Academic diplomas can note graduation honors, academic year, or a congratulatory message from the presenting organization. When the certificate already contains all relevant information clearly and legibly, a clean plaque without additional engraving lets the document speak for itself. The decision comes down to whether added text enhances the award or creates visual clutter competing with the certificate design.

If you need more information before deciding, see our expert resource section:
]]>
certificate-diploma-covers
custom-pagesporcerembosserseals8031st8032nd8033rd8031nw8032nw8033nw8034nw803a803ach803da802802bl802sl802blsl803bldg803dg803cit803eag803fs803df803g803h803hrpaw803hnt802hr803hs803803math803m803music803mstg803os803part803dp803paw803pawbg803p803read803ss803sci803st803sre803dtemgofose1certificates1Shop certificate seals for school awards, honor roll, perfect attendance, graduation, and more. Gold foil and color options available in packs of 100. As low as $0.19 each. Fast 1-2 day shipping.

Gold Certificate Seals - The Single Best Upgrade for Any Award Certificate

A certificate seal is the fastest and most affordable way to elevate any printed award from an ordinary document to something recipients display with pride. The reflective shimmer of a gold foil seal or the colorful design of a subject-specific embossed seal communicates at a glance that a certificate is official, intentional, and meaningful in a way that plain paper alone never can. From elementary teachers who seal every honor roll certificate at the end of each nine-week marking period, to principals presenting academic excellence awards at end-of-year assemblies, from high school graduation coordinators adding diploma seals to cap and gown ceremony programs, to reading teachers who apply reading seals to completion certificates for every student who finished the semester challenge, certificate seals work equally well on professionally printed certificates and on home-printed free templates, instantly upgrading either to award-ceremony quality. Our selection covers every common school and recognition occasion, including honor roll in round and ribbon designs, academic excellence, achievement, merit, participation, and special recognition seals suitable for any program, subject-specific seals for reading, math, science, music, and citizenship, graduation and diploma seals with cap and diploma imagery, mascot seals in bulldog, eagle, mustang, hornet, and paw designs for school spirit recognition, nine-weeks and semester seals for quarterly and semester programs, place ribbon seals for 1st, 2nd, and 3rd place competition recognition, and affordable color and gold foil embossed seals for programs that need a simple, general-purpose option at the lowest possible cost per seal.

Frequently Asked Questions About Certificate Seals

What is the difference between gold foil seals, color seals, and embossed seals?

Gold foil seals feature a metallic gold reflective surface that creates the classic prestigious look most associated with official certificates and diplomas. They are self-adhesive and apply directly to any certificate surface. Color seals include printed designs in multiple colors, making them well suited for subject-specific and mascot designs where color adds recognition value. Embossed foil seals combine a metallic foil finish with a raised dimensional design for a premium look and tactile feel. All three types are self-adhesive and apply cleanly to paper certificates, printed templates, and diploma covers alike.

How many seals come in each pack and what do they cost per seal?

Most of our subject-specific and design seals are sold in packs with pricing that drops significantly with quantity, making them very affordable for classroom and school-wide programs recognizing large numbers of students each semester. Our color certificate seals and embossed foil seals offer the lowest per-seal cost and are ideal for programs that need a general-purpose seal in high volume. Quantity pricing is shown on each product page. Orders over $99 qualify for free economy shipping, making it practical to stock up for a full year of recognition programs in a single order.

Can I use certificate seals on free printable templates and home-printed certificates?

Yes, certificate seals work on any paper certificate including home-printed templates, and adding a seal is the single most effective way to make a free or low-cost printed certificate look polished and official. Simply download and print any of our free certificate templates, apply the appropriate seal, and the finished result is indistinguishable from a professionally printed award. For the best appearance, print on heavyweight cardstock rather than standard copy paper before applying the seal.

If you need more information before deciding, see our expert resource section:
]]>
awardcertificates1 sporcer
custom-pagegeneral-corporate-awards11"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"458221510.45630.45Vision AwardsTrophies1:22%,26:31%Champion design elements compose the Chalice. Its swooping spans of grey and ebony marble embrace two elegant glass panels artistically arced at right angles.unused-products11"7-10 business days w/engraving" "Chicago, Illinois" "UPS (FedEx available on request)""PC10=606307-101 34230RS Owens1:22%custom-pagedisplaycases21111rowchcora secodira chcodica mihodica chcoshdica"5-10 business days" "Connelly Springs, North Carolina" "UPS (FedEx available on request)"display case286125-1010.45432.45SpartaCraftDisplay CasesSpecialty Cases1:14%"Military Awards" "Display Cases" "Popular Display Cases" "Most Popular Display Cases"Find this Challenge Coin Display discounted at TrophyCentral. Military challenge coin displays feature a beautiful Walnut finish.secodi6tiChallenge Coin Displays11Find challenge coin displays discounted at TrophyCentral. Each military challenge coin display can be engraved for a special touch!Shop for an Engraved Challenge Coin Display We carry beautiful challenge coin displays in a variety of sizes and finishes. Similar to our flag cases, coin displays feature optional engraving. Most ship in just a week. If you have any questions, please call our display case experts in Michigan and New York. They have been helping customers just like you since 1999!
]]>
custom-pagedisplaycases11display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger aluminum display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 120"W x 16"D. Model: 11410-ck-sn.11410-ck-snFloor-Standingcustom-pagedisplaycases11display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger aluminum display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 144"W x 16"D. Model: 11412-ck-sn.11412-ck-snFloor-Standingcustom-pagedisplaycases11display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger aluminum display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 48"W x 16"D. Model: 11404-ck-sn.11404-ck-snFloor-Standingcustom-pagedisplaycases11display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger aluminum display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 60"W x 16"D. Model: 11405-ck-sn.11405-ck-snFloor-Standingcustom-pagedisplaycases11display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger aluminum display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 72"W x 16"D. Model: 11406-ck-sn.11406-ck-snFloor-Standingcustom-pagedisplaycases11display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger aluminum display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 96"W x 16"D. Model: 11408-ck-sn.11408-ck-snFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger aluminum display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 120"W x 16"D. Model: 11410-pb-sn.11410-ck-snFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger aluminum display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 144"W x 16"D. Model: 11412-pb-sn.11412-ck-snFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger aluminum display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 48"W x 16"D. Model: 11404-pb-sn.11404-ck-snFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger aluminum display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 60"W x 16"D. Model: 11405-pb-sn.11405-ck-snFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger aluminum display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 72"W x 16"D. Model: 11406-pb-sn.11406-ck-snFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger aluminum display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 96"W x 16"D. Model: 11408-pb-sn.11408-ck-snFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger aluminum display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 120"W x 16"D. Model: 11410-wb-sn.11410-ck-snFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger aluminum display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 144"W x 16"D. Model: 11412-wb-sn.11412-ck-snFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger aluminum display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 48"W x 16"D. Model: 11404-wb-sn.11404-ck-snFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger aluminum display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 60"W x 16"D. Model: 11405-wb-sn.11405-ck-snFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger aluminum display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 72"W x 16"D. Model: 11406-wb-sn.11406-ck-snFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger aluminum display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 96"W x 16"D. Model: 11408-wb-sn.11408-ck-snFloor-Standingcustom-pagedisplaycases11display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger black laminate display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 48"W x 16"D. Model: 13404-ck-sn.13404-ck-snFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger black laminate display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 60"W x 16"D. Model: 13405-ck-sn.13404-ck-snFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger black laminate display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 72"W x 16"D. Model: 13406-ck-sn.13406-wb-snFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger black laminate display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 48"W x 16"D. Model: 13404-pb-sn.13404-ck-snFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger black laminate display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 60"W x 16"D. Model: 13405-pb-sn.13404-ck-snFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger black laminate display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 72"W x 16"D. Model: 13406-pb-sn.13406-wb-snFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger black laminate display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 48"W x 16"D. Model: 13404-wb-sn.13404-ck-snFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger black laminate display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 60"W x 16"D. Model: 13405-wb-sn.13404-ck-snFloor-Standingcustom-pagedisplaycases11display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger black laminate display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 72"W x 16"D. Model: 13406-wb-sn.13406-wb-snFloor-Standingcustom-pagedisplaycases11display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger light oak vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 120"W x 16"D. Model: 10410ck-sn-k.10410ck-sn-kFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger light oak vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 144"W x 16"D. Model: 10412ck-sn-k.10412ck-sn-wFloor-Standingcustom-pagedisplaycases11display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger light oak vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 48"W x 16"D. Model: 10404ck-sn-k.10404ck-sn-kFloor-Standingcustom-pagedisplaycases11display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger light oak vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 60"W x 16"D. Model: 10405ck-sn-k.10405ck-sn-kFloor-Standingcustom-pagedisplaycases11display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger light oak vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 72"W x 16"D. Model: 10406ck-sn-k.10406ck-sn-kFloor-Standingcustom-pagedisplaycases11display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger light oak vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 96"W x 16"D. Model: 10408ck-sn-k.10408ck-sn-kFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger light oak vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 120"W x 16"D. Model: 10410pb-sn-k.10410ck-sn-kFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger light oak vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 144"W x 16"D. Model: 10412pb-sn-k.10412ck-sn-wFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger light oak vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 48"W x 16"D. Model: 10404pb-sn-k.10404ck-sn-kFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger light oak vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 60"W x 16"D. Model: 10405pb-sn-k.10405ck-sn-kFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger light oak vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 72"W x 16"D. Model: 10406pb-sn-k.10406ck-sn-kFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger light oak vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 96"W x 16"D. Model: 10408pb-sn-k.Floor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger light oak vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 120"W x 16"D. Model: 10410wb-sn-k.10410ck-sn-kFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger light oak vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 144"W x 16"D. Model: 10412wb-sn-k.10412ck-sn-wFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger light oak vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 48"W x 16"D. Model: 10404wb-sn-k.10404ck-sn-kFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger light oak vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 60"W x 16"D. Model: 10405wb-sn-k.10405ck-sn-kFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger light oak vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 72"W x 16"D. Model: 10406wb-sn-k.10406ck-sn-kFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger light oak vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 96"W x 16"D. Model: 10408wb-sn-k.10408ck-sn-kFloor-Standing11Find Challenger Series trophy cases discounted at TrophyCentral. These high-quality cases are perfect for schools. Made in the USA.displaycases1custom-pagedisplaycases11display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger walnut vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 120"W x 16"D. Model: 10410ck-sn-w.10410ck-sn-wFloor-Standingcustom-pagedisplaycases11display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger walnut vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 144"W x 16"D. Model: 10412ck-sn-w.10412ck-sn-wFloor-Standingcustom-pagedisplaycases11display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger walnut vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 48"W x 16"D. Model: 10404ck-sn-w.10404ck-sn-wFloor-Standingcustom-pagedisplaycases11display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger walnut vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 60"W x 16"D. Model: 10405ck-sn-w.10405ck-sn-wFloor-Standingcustom-pagedisplaycases11display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger walnut vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 72"W x 16"D. Model: 10406ck-sn-w.10406ck-sn-wFloor-Standingcustom-pagedisplaycases11display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger walnut vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 96"W x 16"D. Model: 10408ck-sn-w.10408ck-sn-wFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger walnut vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 120"W x 16"D. Model: 10410pb-sn-w.10410ck-sn-wFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger walnut vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 144"W x 16"D. Model: 10412pb-sn-w.10412ck-sn-wFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger walnut vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 48"W x 16"D. Model: 10404pb-sn-w.10404ck-sn-wFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger walnut vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 60"W x 16"D. Model: 10405pb-sn-w.10405ck-sn-wFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger walnut vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 72"W x 16"D. Model: 10406pb-sn-w.10406ck-sn-wFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger walnut vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 96"W x 16"D. Model: 10408pb-sn-w.10408ck-sn-kFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger walnut vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 120"W x 16"D. Model: 10410wb-sn-w.10410ck-sn-wFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger walnut vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 144"W x 16"D. Model: 10412wb-sn-w.10412ck-sn-wFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger walnut vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 48"W x 16"D. Model: 10404wb-sn-w.10404ck-sn-wFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger walnut vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 60"W x 16"D. Model: 10405wb-sn-w.10405ck-sn-wFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger walnut vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 72"W x 16"D. Model: 10406wb-sn-w.10406ck-sn-wFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Challenger walnut vinyl display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 96"W x 16"D. Model: 10408wb-sn-w.10408ck-sn-kFloor-Standingcustom-pagewalmouncas145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Champion wall-mounted display case w/ mirror back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 30"H x 36"W x 14"D.2282mb-bzWall-Mountedcustom-pagewalmouncas1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Champion wall-mounted display case w/ mirror back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 30"H x 36"W x 14"D.2282mb-bzWall-Mountedcustom-pagewalmouncas145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Champion wall-mounted display case w/ mirror back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 30"H x 36"W x 14"D.2282mb-bzWall-Mountedcustom-pagewalmouncas145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Champion wall-mounted display case w/ plaque fabric back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 30"H x 36"W x 14"D.2282wb-bzWall-Mountedcustom-pagewalmouncas145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Champion wall-mounted display case w/ plaque fabric back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 48"H x 48"W x 16"D.2040-4-pb-snWall-Mountedcustom-pagewalmouncas145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Champion wall-mounted display case w/ plaque fabric back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 48"H x 60"W x 16"D.2040-5-pb-bzWall-Mountedcustom-pagewalmouncas145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Champion wall-mounted display case w/ plaque fabric back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 48"H x 72"W x 16"D.2040-6-pb-bzWall-Mountedcustom-pagewalmouncas145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Champion wall-mounted display case w/ plaque fabric back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 30"H x 36"W x 14"D.2282wb-bzWall-Mountedcustom-pagewalmouncas145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Champion wall-mounted display case w/ plaque fabric back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 48"H x 48"W x 16"D.2040-4-pb-snWall-Mountedcustom-pagewalmouncas1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Champion wall-mounted display case w/ plaque fabric back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 48"H x 60"W x 16"D.2040-5-pb-bzWall-Mountedcustom-pagewalmouncas1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Champion wall-mounted display case w/ plaque fabric back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 48"H x 72"W x 16"D.2040-6-pb-bzWall-Mountedcustom-pagewalmouncas145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Champion wall-mounted display case w/ plaque fabric back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 30"H x 36"W x 14"D.2282wb-bzWall-Mountedcustom-pagewalmouncas1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Champion wall-mounted display case w/ plaque fabric back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 48"H x 48"W x 16"D.2040-4-pb-snWall-Mountedcustom-pagewalmouncas145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Champion wall-mounted display case w/ plaque fabric back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 48"H x 60"W x 16"D.2040-5-pb-bzWall-Mountedcustom-pagewalmouncas145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Champion wall-mounted display case w/ plaque fabric back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 48"H x 72"W x 16"D.2040-6-pb-bzWall-Mountedcustom-pagewalmouncas145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Champion wall-mounted display case w/ white laminate back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 30"H x 36"W x 14"D.2282wb-bzWall-Mountedcustom-pagewalmouncas145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Champion wall-mounted display case w/ white laminate back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 48"H x 48"W x 16"D.2040-4-pb-snWall-Mountedcustom-pagewalmouncas145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Champion wall-mounted display case w/ white laminate back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 48"H x 60"W x 16"D.2040-5-wb-bzWall-Mountedcustom-pagewalmouncas145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Champion wall-mounted display case w/ white laminate back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 48"H x 72"W x 16"D.2040-6-wb-bzWall-Mountedcustom-pagewalmouncas145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Champion wall-mounted display case w/ white laminate back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 30"H x 36"W x 14"D.2282wb-bzWall-Mountedcustom-pagewalmouncas145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Champion wall-mounted display case w/ white laminate back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 48"H x 48"W x 16"D.2040-4-pb-snWall-Mountedcustom-pagewalmouncas1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Champion wall-mounted display case w/ white laminate back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 48"H x 60"W x 16"D.2040-5-wb-bzWall-Mountedcustom-pagewalmouncas1display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Champion wall-mounted display case w/ white laminate back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 48"H x 72"W x 16"D.2040-6-wb-bzWall-Mountedcustom-pagewalmouncas145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Champion wall-mounted display case w/ white laminate back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 30"H x 36"W x 14"D.2282wb-bzWall-Mountedcustom-pagewalmouncas145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Champion wall-mounted display case w/ white laminate back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 48"H x 48"W x 16"D.2040-4-pb-snWall-Mountedcustom-pagewalmouncas145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Champion wall-mounted display case w/ white laminate back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 48"H x 60"W x 16"D.2040-5-wb-bzWall-Mountedcustom-pagewalmouncas145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Champion wall-mounted display case w/ white laminate back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 48"H x 72"W x 16"D.2040-6-wb-bzWall-Mountedcustom-pagecup-trophies-large-and-small1trophies498552-411229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find this Champion's Cup trophy discounted at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's Cupcustom-pagetrophies1trophies498551-311Trophies1Find our Champion's Cup Trophy discounted at TrophyCentral. Features a beautful Cherry finish wood base, gold cup and figure. Engraving is free. Fast 1-2 day shipping.custom-pagetrophies1trophies498551-311.5Trophies1Find our Champion's Cup Insert Trophy discounted at TrophyCentral. Features a beautful Cherry finish wood base, gold cup and colorful 2" insert. Engraving is free. Fast 1-2 day shipping.custom-pagetrophies1trophies498551-212Trophies1:14%,3:19%,10:27%Find this fabulous two-tier trophy discounted at TrophyCentral. Available in three sizes. Features free personalization and fast 1-2 day shipping!11Football award ideas beyond MVP: 15 categories covering effort, character, and position excellence, with budget tips for any roster size.custom-pageperplaq481x61x50x910x601x62x53xx601xx44x481ycrystalbowl67xxcrystal22va8221sftriocrystalvasescupcascade1cup-trophies-large-and-small1Find championship trophies discounted at TrophyCentral. Each championship trophy includes free personalization for a special touch.

Championship Trophies - Crystal Cups and Award Trophies for Every Champion and Title Event

Championship trophies carry a weight and presence that no other award format can match because they are built specifically to communicate the significance of a title won at the end of a full season or tournament bracket. Where participation trophies acknowledge effort and category awards recognize individual performance, a championship trophy declares that one team or competitor stood above all others when it mattered most. Our championship trophy collection features crystal cup designs in classic loving cup forms that evoke the tradition of championship recognition across every sport and competition level, multi-column presentation trophies with substantial bases and impressive height appropriate for the trophy table centerpiece at any awards banquet, and distinctive crystal and resin championship pieces that elevate the visual standard of the entire awards program. Every championship trophy includes free engraving personalized with the champion name or team name, title or award category, league or organization, and season year, ensuring the award documents the specific accomplishment rather than serving as an unidentified piece of hardware on a shelf years from now. Championship trophies are available in a range of sizes to suit every budget and event scale, from mid-size championship pieces for recreational league title winners to towering presentation trophies worthy of regional and state championship programs.

Frequently Asked Questions About Championship Trophies

What size championship trophy is appropriate for different events and competition levels?

Championship trophy size should reflect the scale and prestige of the competition being crowned, since the physical presence of the award communicates the significance of the title to everyone who sees it. Recreational league championships and small local tournament titles are well served by mid-size championship trophies in the 14-inch to 18-inch range that stand clearly apart from the participation and category awards distributed at the same event without requiring a large per-trophy budget. Regional tournament championships, travel club title events, and competitive league season champions warrant 20-inch to 24-inch championship trophies that carry genuine visual weight and serve as the clear centerpiece of the entire awards program. State championship events, major invitational tournaments, and prestigious competitive programs deserve 24-inch to 30-inch and larger championship pieces that match the magnitude of the accomplishment being recognized and make a strong impression in victory photos and trophy case displays for years to come. The most important principle is that the championship trophy should be visibly and unmistakably more impressive than every other award at the event, creating a clear visual hierarchy where the size and quality of the championship piece communicates instantly that something exceptional was achieved. A championship trophy that is only marginally larger than the runner-up award fails to deliver the moment that champions and their communities remember, so investing in the top award is always the right call regardless of the overall event budget.

What should championship trophy engraving include?

Championship trophy engraving should document the full context of the title so the award serves as a complete record of the accomplishment decades from now. Essential elements include the champion name or team name, championship title, league or tournament name, and season year. For example: Riverside Rockets, League Champions, Metro Youth Basketball Association, 2025, or Emma Sullivan, Tournament Champion, Girls 14U Division, Tri-State Soccer Classic, Fall 2025. Final season records add meaningful context to team championship trophies when space allows, such as Champions, 16-2 Record or Undefeated Champions, 14-0, communicating the dominance behind the title rather than just the outcome. Individual championship trophies benefit from noting the specific competition category or division alongside the champion name to distinguish the award from generic recognition. For perpetual championship trophies that will accumulate new champion engravings year after year, a consistent format across all years creates a clean, organized display that honors each champion equally within the trophy's growing history. Coach and program recognition on team championship trophies adds an element that champions appreciate years later, noting the head coach name alongside the team record gives the trophy a more complete picture of the people behind the title.

What sports and events are championship trophies used for?

Championship trophies are the appropriate top award for any competition where a single winner or team is crowned at the end of a bracket, season, or tournament, making them relevant across virtually every competitive context imaginable. Youth and adult sports leagues including football, soccer, basketball, baseball, softball, volleyball, hockey, and golf all use championship trophies to crown their season title winners, with the trophy serving as the defining award of the entire league year. Tournament brackets across every sport at every age level use championship trophies as the top prize that every team or competitor competing in the event is ultimately working toward. Academic competitions including math leagues, science olympiad, debate tournaments, and spelling bee championships use championship trophies to honor the title winner with an award that matches the competitive investment required to reach the top. Fantasy sports leagues, office competitions, and recreational bowling and golf leagues use championship trophies with the same seriousness as their athletic counterparts, since a title among friends and colleagues carries its own brand of bragging rights that a quality championship trophy honors appropriately. Corporate sales competitions, employee performance championships, and business recognition programs present championship trophies for top performance across a defined competition period, applying the championship framework to professional achievement in a way that motivates participants as effectively as athletic competition does on a sports field. See our complete collections of cup trophies, perpetual trophies, and all trophies and awards for every championship recognition option.

If you need more information before deciding, see our expert resource section:
]]>
silver-cup-trophies champion-perpetual-trophiesChampionship Trophies
custom-pagetrophies1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)""PT1=Trophies" "PC12=498552-310.751434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:28%Find this fabulous 26-28" championship trophy with a real wood base discounted at TrophyCentral. Free Engraving and Fast 1-2 day shipping! Quantity discounts available.championship-woodcustom-pageinserts15135515170845184785115024976635173864938514927011inserts11Find Charitable Organization Inserts discounted at TrophyCentral. Each 2" insert fits in a medal frame, plaque or trophy to create a unique recognition item. Charitable Organizationscustom-pageblog-trophycentral11Planning a charity car show? This complete guide covers everything from choosing the right nonprofit partner and setting entry fees to sponsorships, raffles, silent auctions, and donor recognition strategies that keep supporters coming back year after year.custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Checkered Flags Racing Inserts (Litho) at TrophyCentral. Each Checkered Flags Racing Insert can be used to create a unique plaque, medal or trophy.495291
custom-pagetrophies-cheerleading-spirit1trophies498551-310.452429Trophies1Find this popular Cheerleader trophy discounted at TrophyCentral. Features a real marble base, stylish 4-inch gold cup, free engraving and fast shipping.cheerleader-cup-place-trophycustom-pagetrophies-cheerleading-spirit12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "Sports Medals" "Cheerleading Awards" "Cheerleading Medals"These inexpensive 1 1/4 inch Cheerleader Medals offer a high quality, but low price for those on a tight budget.e9010Return to thesection for more great medal choices!cheerleadingmedalsCheerleading, Sports
custom-pagetrophies-cheerleading-spirit12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these Cheerleader Inserts discounted at TrophyCentral. Each Cheer insert can be used to create a unique plaque, medal or trophy.50152Cheerleading, Sports
custom-pagetrophies-cheerleading-spirit12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these colorful Cheerleader Inserts at TrophyCentral. Each Cheerleader Insert can be used to create a unique plaque, medal or trophy.518404Cheerleading, Sports
custom-pagekeychains21"1-3 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"105502-40.39125035.39Classic MedallicsGiftsKeychains1:22%,10:25%,25:32%,50:39%,100:47%Find these popular Pewter Cheerleader Key Chains at TrophyCentral; discounted prices!pk56-cmKeychainscheerleadingmedals1sports-pins1Find cheerleading pins discounted at TrophyCentral. Each cheerleading lapel pin features a clutch back.

Shop for Cheer & Spirit Pins with Confidence at TrophyCentral

We offer a huge selection, discounted prices and top-rated customer service. Do you need help with some ideas or with ordering? Yes, we sell online, but we have real people who would love to help you! Feel free to call our customer service experts in Michigan, New York and online. TrophyCentral - delivering smiles since 1999!


]]>
custom-pagetrophies-cheerleading-spirit1trophies498551-310.452429Trophies1Find our Cheerleader star column trophy discounted at TrophyCentral. Features a real marble base, 6 inch gold star-shaped column, free engraving and fast shipping.cheerleader-star-column-trophycustom-pagetrophies-cheerleading-spirit1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%"Cheerleader Trophies" "Cheerleading Trophies" "Cheerleader Trophy" "Cheerleading Trophy" "Trophies, Cheerleader" "Trophies, Cheerleading"Find this popular cheerleader figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at trophyCentral. Ships in a fast 1-2 days!1qtcheerplCheerleading, 1st / 2nd / 3rd / Etc., Sportscustom-pagetrophies-cheerleading-spirit20medals498552-40.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful Cheer 2" Epoxy-covered insert decal discounted at TrophyCentral. Fast 1-2 day shipping.Cheerleading, Sportscustom-pagetrophies-cheerleading-spirit1"2-4 business days" "Marquette, MI" "UPS"medals498552-40.530012.37PDU-SMedalsSports, Hobby, Org, Livestock1:22%,100:35%"Cheer Awards" "Cheerleading Awards" "Cheerleader Awards" "Cheerleading Medals"cheermedal08-10-2013Cheerleading, Sportscustom-pagetrophies-cheerleading-spirit1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%"Cheerleader Trophies" "Cheerleading Trophies" "Cheerleader Trophy" "Cheerleading Trophy" "Trophies, Cheerleader" "Trophies, Cheerleading"Find this popular cheerleading year trim trophy discounted at trophyCentral. Available in multiple sizes and includes free engraving. Features gold year of event trim.qtcheeryrCheerleading, Sportscustom-pagetrophies-cheerleading-spirit1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with cheerleading figure discounted at TrophyCentral. Includes free text engraving!cup-cheer-pCheerleading, Sportscustom-pagetrophies-cheerleading-spirit1medals498552-30.525033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this Cheer Megaphone 2 1/4" Antique Gold Medal Discounted at TrophyCentral. Each medal features a free ribbon. Fast shipping!Cheerleading, Sportscustom-pagefree-sports-templates1"Download Only"free-sports49855011TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"See this Cheerleader Certificate designed exclusively for TrophyCentral! Cheerleader Certificates can be downloaded for free! Each cheerleader certificate measures 11 x 8 1/2 inches.cheerleadingfrCheerleading, Sportscustom-pagetrophies-cheerleading-spirit1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Cheer / Spirit Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Cheerleading, Sportscustom-pagetrophies-cheerleading-spirit1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these cheerleading budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtcheerscbCheerleading, Sportscustom-pagetrophies-cheerleading-spirit1498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Find this budget cheerleading award trophy discounted at Trophy Central. Features a real marble base and plastic cheerleading figure. Engraving is free. Fast 1-2 day shipping.bdg-cheerleadingCheerleading, Sportscustom-pagetrophies-cheerleading-spirit1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511230.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,6:23%,12:24%,24:26%"Cheerleader Awards"tr9915Cheerleading, Sportscustom-pagesporcercheerleadingfr1cheerleadingfr"PC11=290631-31 2 3 230.45100020.45Certificate SourceCertificatesAward Certificates1:22%,25:27%,100:40%,500:50%"Cheer Awards" "Cheerleading Awards" "Cheerleader Awards"Give your cheerleading squad the recognition they deserve with cheerleading certificates from Trophy Central. Shop our discounted cheerleading certificates today!1035Cheerleading, Sportscustom-pagetrophies-cheerleading-spirit1trophies498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Cheer insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-Cheer-InsertCheerleading, Sportscustom-pagetrophies-cheerleading-spirit1cl50 cl107 1035"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%"Cheer Awards" "Cheerleading Awards" "Cheerleader Awards" "Cheerleader Trophies" "Cheerleading Trophies" "Cheerleader Trophy" "Cheerleading Trophy" "Trophies, Cheerleader" "Trophies, Cheerleading"Find these fabulous two-tier Cheerleading Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtcheerttCheerleading, Sportscustom-pagetrophies-cheerleading-spirit1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.2115Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%"Cheerleader Trophies" "Cheerleading Trophies" "Cheerleader Trophy" "Cheerleading Trophy" "Trophies, Cheerleader" "Trophies, Cheerleading"See this championship trophy with a Cheer figure at TrophyCentral. Be sure to see all of our Cheer figure awards.qtcheerttwCheerleading, Sportscustom-pagetrophies-cheerleading-spirit1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Cheerleading single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - CheerCheerleading, Sportscustom-pagetrophies-cheerleading-spirit1cl50 cl107 1035"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%"Cheerleader Trophies" "Cheerleading Trophies" "Cheerleader Trophy" "Cheerleading Trophy" "Trophies, Cheerleader" "Trophies, Cheerleading"Find these popular Cheerleading Elite Series trophies discounted and with free personalization at TrophyCentral.qtcheerscIn addition to these classic trophies, be sure to see all of ourtrophies-cheerleading-spiritCheerleading, Sports11A comprehensive guide to cheerleading competitions in the US, covering high school, college, and professional levels, including famous cheerleading awards.custom-pagetrophies-cheerleading-spirit1trophies498551-311821.06TrophyCentralTrophies1Cheerleading, Sportscustom-pagetrophies-cheerleading-spirit50medals9303310-May1Simba CalMedals1These 2 1/2 inch custom cheer Medals come with an outer-ring which allows you to add your school or league name, date and location.custom-pagetrophies-cheerleading-spirit1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451623.65Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%"Cheerleader Trophies" "Cheerleading Trophies" "Cheerleader Trophy" "Cheerleading Trophy" "Trophies, Cheerleader" "Trophies, Cheerleading"These quick-ship trophies from TrophyCentral feature a Cheerleader High Five figure, real marble base and marble trophy figure platform, choice of column size and color.qtcheerdmCheerleading, Sportscustom-pagetrophies-cheerleading-spirit1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"498852-30.38150030Quick TrophyDog TagsSports, Hobby, Org, Livestock1:14%,10:15%Find these cheerleader dog tags discounted at TrophyCentral. The price of each cheerleading dog tag includes custom engraving and 24" chain!qtdogcheerCheerleading, Sportscoaching-teaching-guides11Creative cheerleading award ideas with engraving examples for your squad banquet. From Stunt Superstar to Spirit Supreme, discover 15+ unique ways to recognize every cheerleader with actual trophy wording templates.custom-pagetrophies-cheerleading-spirit1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Cheerleading figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-cheer-scbCheerleading, Sportscustom-pagetrophies-cheerleading-spirit1trophies498551-310.71217.38Trophies1Cheerleading, Sportscustom-pagetrophies-cheerleading-spirit1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Cheer / Spirit Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Cheerleading, Sportscustom-pagetrophies-cheerleading-spirit1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.4118Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%"Cheerleader Trophies" "Cheerleading Trophies" "Cheerleader Trophy" "Cheerleading Trophy" "Trophies, Cheerleader" "Trophies, Cheerleading"Find these fabulous two-tier, 3-column champion Cheer Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtcheer3cSee more championshipin other great styles.trophies-cheerleading-spiritCheerleading, Sportscustom-pagetrophies-cheerleading-spirit1medals498552-30.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this Colorful Cheer insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Cheerleading, Sportscustom-pagetrophies-cheerleading-spirit1medals498552-40.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this Cheer insert medal With A Personalized Front Rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Cheerleading, Sportscustom-pageplaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these cheerleading insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Cheerleading, Sports11"Cheerleading Medals" "Cheerleader Medals"Find a great selection of 2" Cheerleading Inserts at TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.1cheerleadingpins1sports-medals1Cheerleading medals in a variety of styles and finishes to please your entire squad. Each cheer medal includes a ribbon! Fast 1-2 day shipping.

Shop with Ease for Cheerleading Award Medals!

If you are looking to buy online, look no further! We have a huge selection of cheerleading medals, pins and awards at discounted prices. Our experts in New York and Michigan have been providing suggestions and guidance since 1999 and would be happy to help you with all of your questions and needs! For personal service, call our team at 1-888-809-8800 or order online any time!
Be sure to see our fun trophy and engraving guides: ]]>
cheerleadingpins trophies-cheerleading-spiritCheerleading
custom-pagetrophies-cheerleading-spirit1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our cheerleading insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - CheerCheerleading, Sportscustom-pagetrophies-cheerleading-spirit1cl50 cl107 1035"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%,25:23%,50:29%,100:34%"Cheerleader Trophies" "Cheerleading Trophies" "Cheerleader Trophy" "Cheerleading Trophy" "Trophies, Cheerleader" "Trophies, Cheerleading" "Cheer Awards" "Cheerleading Awards" "Cheerleader Awards"Our Cheerleading Participation Trophies feature a real slant-front white marble base and free personalization. Significant quantity discounts available.qtcheerncSee more:trophies-cheerleading-spiritCheerleading, Sportscustom-pagetrophies-cheerleading-spirit1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.41234Quick TrophyTrophiesPerpetual Trophies1:14%,3:15%,10:16%Find this Perpetual Cheerleading Trophy Discounted at TrophyCentral. Each Trophy has enough room for 32 names. Ships in just 1-2 days.qtcheerperpReturn tosection for additional choices.trophies-cheerleading-spiritCheerleading, Sportscustom-pageplaques1ps5864 ps5866 8xwalplaqwsu"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498852-310.45811.6Quick TrophyPlaquesInsert1:14%,3:14%"Cheerleading Awards" "Cheer Awards" "Cheerleading Awards" "Cheerleader Awards"See this stunning Cheerleading plaque and other Holographic Plaques at TrophyCentral.qsinplaqcheerleadingCheerleading, Sportscustom-pagetrophies-cheerleading-spirit1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Cheer / Spirit Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Cheerleading, Sportscustom-pagetrophies-gymnasticscheer-plaque-iqsinplaqcheerleadingcl107cl26qtdogcheer48982450152502591518404cheer-ei1trophies1"Cheerleading Awards" "Trophies" "Sports Trophies" "Cheer Awards" "Cheerleading Awards" "Cheerleader Awards"Honor your squad with premium custom cheerleading trophies, medals and awards. Detailed figurines and colorful pom-pom designs. Free personalization. Order today!trophies-cheerleading-spirit

Custom Cheerleading Trophies & Awards — Honor Every Routine, Every Squad

Cheerleading trophies serve two distinct worlds, and the recognition program for each looks very different. Sideline and school spirit programs — from Pop Warner youth squads cheering on football teams to middle school, JV, and varsity squads building school pride at every home game — rely on participation trophies and end-of-season awards that honor the dedication of every member alongside standout individual recognition for captains, most valuable cheerleaders, and most spirited performers. Competitive all-star programs operate on a tournament circuit with age divisions from Mini and Youth through Junior, Senior, and Open, where trophies and plaques mark placement at local invitational competitions, regional qualifiers, and national championships. Our cheerleading trophies feature dynamic figurines capturing cheerleaders in high-kick, high-five, and pom-pom poses, Lightning Boltz spirit award designs, resin sculptures depicting stunt sequences and jump formations, and double-platform column trophies in multiple heights for tiered placement recognition. Individual honors bring the awards ceremony to life: Most Spirited recognizes the cheerleader who elevates every routine, Best Tumbler honors the athlete whose skills anchor the team's difficulty score, Best Stunter celebrates the flyer or base whose technique earns the crowd's biggest reactions, and Most Improved marks the kind of growth that coaches remember for years. Cheerleading medals with free ribbons offer a practical and affordable complement to trophies for large squads, and cheer spirit pins add a keepsake element that athletes collect and display long after the season ends. Every cheerleading trophy includes free engraving personalized with athlete names, squad, and season details.

Frequently Asked Questions About Cheerleading Trophies

What trophy sizes work best for different cheerleading award categories?

Youth and Pop Warner squads benefit from 6-inch to 8-inch participation trophies that every member receives, meaningful to young athletes and easy to carry home after the last game of the season. Middle school and JV programs typically step up to 8-inch to 12-inch trophies for end-of-season recognition, with larger pieces for placement finishers at competitions. Individual honors like Most Spirited, Best Tumbler, Captain Award, and MVP warrant 12-inch to 16-inch trophies or plaques that stand apart from standard participation pieces. Competitive all-star placement trophies for regional and national events typically range from 14 to 24 inches depending on the level of competition, with first-place finishers at major invitationals deserving the largest, most impressive designs available.

What details should cheerleading trophy engraving include?

For team and squad trophies, include the squad name, program or school name, competition or season, and finishing position or award title. For individual awards, add the athlete's name, award title, and season. Specific award titles make individual trophies memorable — “Most Spirited” or “Best Stunter Award” means far more than a generic “Cheerleading Award.” Keep text concise and readable, prioritizing the most meaningful details when space is limited.

How do recognition programs differ between sideline cheer and competitive all-star programs?

Sideline and school spirit programs focus on season-end recognition: participation trophies for every squad member, individual honors for captains and standout performers, and coach appreciation awards. Competitive all-star programs center on placement recognition at each event on the competition circuit — first, second, and third place trophies or plaques for each age division at invitationals, regionals, and national qualifiers, often ordered in bulk across a full season schedule. Many all-star gyms also present internal awards at year-end banquets recognizing athletes across all their competitive teams.

If you need more information before deciding, see our expert resource section:
]]>
Cheerleading / Spirit
11Discover the ultimate cheerleading trophy and medal guide! From championship squads to spirit leaders, find creative award ideas that celebrate athletic excellence and team spirit.custom-pagesports-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsGeneral1:22%,50:30%,100:33%,500:47%"Star Awards" "Star Award"Star Performer Chenille Letter Pins: EC Series Star Performer Chenille Lapel Pins feature a high-quality enameled finish and ship in just 1-2 business days!ec9012-22-2009Dramacustom-pagecitizenship-awardsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsGeneral1:22%,50:30%,100:33%,500:47%"Volunteer Items" "School Pins"Chenille CITIZENSHIP Letter Pins: EC Series Chenille CITIZENSHIP Lapel Pins feature a high-quality enameled finish and ship in just 1-2 business days!ec63Citizenshipcustom-pagecertificateplaques1plaques498553-4141239Plaques1Find this Cherry certificate plaque with a gold frame discounted at TrophyCentral. Measures 10 1/2 x 13 and holds an 8 1/2 x 11 certificate or diploma.custom-pagecertificateplaques1plaques498553-4141239Plaques1Find this Cherry certificate plaque with a silver frame discounted at TrophyCentral. Measures 10 1/2 x 13 and holds an 8 1/2 x 11 certificate or diploma.certificate-plaque-ch-gcustom-pageplaques1"1-2 business days" "Marquette, MI" "UPS"plaques498852-310.51017.50Quick TrophyPlaquesColor Plaques1:14%,3:17%"New Products"Cherry finish engraved wall-mount plaque. Select gold or white plate with sublimated black text. Option to add full-color logo and up to 13 lines of text10x8cherryfinishBlank, Generalcustom-pageplaques1"1-2 business days" "Marquette, MI" "UPS"plaques498852-310.51034.50Quick TrophyPlaquesColor Plaques1:14%,3:17%"New Products"Find 12" x 9" Color Printed Plaques with a Cherry Wood Finish Discounted at TrophyCentral. Free Engraving!12x9cherryfinishBlank, Generalcustom-pageplaques1"1-2 business days" "Marquette, MI" "UPS"plaques498852-310.51013.50Quick TrophyPlaquesColor Plaques1:14%,3:17%"New Products"Find 7" x 9" Color Printed Plaques with a Cherry Wood Finish at TrophyCentral. Free Engraving!7x9cherryfinishBlank, Generalcustom-pageplaques1"1-2 business days" "Marquette, MI" "UPS"plaques498852-310.51017.50Quick TrophyPlaquesColor Plaques1:14%,3:17%"New Products"Buy these Fabulous 8" x 10" Full Color Plaques with a Cherry Wood Finish at TrophyCentral. Free Engraving!8x10cherryfinishBlank, Generalcustom-pageplaques1"1-2 business days" "Marquette, MI" "UPS"plaques498852-310.51034.50Quick TrophyPlaquesColor Plaques1:14%,3:17%"New Products"Buy these Fabulous 9" x 12" Color Plaques with a Cherry Finish at TrophyCentral. Free Engraving!9x12cherryfinishBlank, Generalcustom-pageplaques1"1-2 business days" "Marquette, MI" "UPS"plaques498852-310.51013.50Quick TrophyPlaquesColor Plaques1:14%,3:17%"New Products"Find 9" x 7" Color Printed Plaques with a Cherry Finish at TrophyCentral. Free Engraving!9x7cherryfinishBlank, Generalcustom-pagetrophies-chess1trophies498551-310.452429Trophies1Find this popular Chess trophy discounted at TrophyCentral. Features a real marble base, stylish 4-inch gold cup, free engraving and fast shipping.chess-cup-place-trophycustom-pagetrophies-chess1trophies498551-310.452429Trophies1Find this popular Chess place trim insert trophy discounted at TrophyCentral. Features a real marble base, stylish 4-inch gold cup, free engraving and fast shipping.chess-cup-place-trophy-icustom-pagetrophies-chess1trophies498552-311622.85TrophiesSchool1Find this popular Chess figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at trophyCentral. Ships in a fast 1-2 days!mqt-chess-p-plChesscustom-pagetrophies-chess1medals498554-Feb0.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful Chess 2" Epoxy-covered insert decal discounted at TrophyCentral. Fast 1-2 day shipping.Chesscustom-pagefree-sports-templates1trophies-chess"Download Only"certificates4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Chess template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Chess-Certificatechess-freeChesscustom-pagetrophies-chess1"4-6 business days " "Mount Vernon, NY" "UPS"trophies105503-610.4511229.25Classic MedallicsTrophiesGeneral1:22%,20:24%Find these very popular Star Insert Awards at TrophyCentral; Choose from hundreds of inserts!tr556003-30-2017custom-pagetrophies-chess12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these high-quality Chess Inserts at TrophyCentral. Each Chess Insert can be used to create a unique plaque, medal or trophy.50401Chess
custom-pagetrophies-chess1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Chess Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Chesscustom-pagetrophies-chess1trophies498552-313633.4TrophiesSchool1Find this budget chess award trophy discounted at Trophy Central. Features a real marble base and plastic figure. Engraving is free. Fast 1-2 day shipping.Chesscustom-pagetrophies-chess1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511230.45Classic MedallicsTrophiesAcademic1:22%,6:23%,12:24%,24:26%"Chess Awards"Shop for Cast Stone Chess Awards at TrophyCentral. We have a great selection of Chess and other recognition trophies at discounted prices.tr9912Chesscustom-pagetrophies-chess1trophies498552-411229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find this chess champion's cup trophy discounted at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's Cup - ChessChesscustom-pagetrophies-chess1trophies498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Chess insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-Chess-InsertChesscustom-pagetrophies-chess1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Chess single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - ChessChesscustom-pagetrophies-chess1trophies498551-311821.06TrophyCentralTrophies1Chesscustom-pagetrophies-chess1trophies498552-311623.65TrophiesSchool1These quick-ship trophies from TrophyCentral feature a chess board figure, real marble base and marble platform, choice of column size and color. Fast 1-2 day shipping.mqt-chess-p-dmChesscoaching-teaching-guides11Creative chess award ideas with engraving examples for tournaments and clubs. From Grandmaster in Training to Best Game Award, discover 15+ unique ways to recognize chess players with actual trophy wording templates. custom-pagetrophies-chess1trophies498551-310.71217.38Trophies1Chesscustom-pagetrophies-chess1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Chess Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Chesscustom-pagetrophies-chess1medals498553-Feb0.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this colorful Chess insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Chesscustom-pagetrophies-chess1medals498553-Feb0.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this Chess insert medal with a personalized front rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Chesscustom-pageplaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these chess insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Chessacademic-general-medalschess-mcchess-mc-prme111ge9824chess-jigfchess-jibfchess-jisf11Chess medals in a variety of designs and finishes. Each chess medal includes a free ribbon and is a great way to recognize chess students and players of all kinds.1Shop with Ease at TrophyCentral Find a large selection of chess awards and medal, low prices and great customer service. Be sure to see our personalized rim frame with our unique chess insert. Add your school, event or organization name for a special touch. If you have any questions, please email or call. Our experts have been helping customers since 1999 and they would love to help you, too!

Frequently Asked Questions (FAQ)

♟️ What types of chess medals do you offer?

We offer a variety of high-quality chess medals, including gold, silver, and bronze finishes. Our medals feature classic chess designs such as kings, queens, and full chessboards, making them perfect for tournaments, school competitions, and club events.

🏅 Who are these chess medals ideal for?

Our chess medals are perfect for school chess clubs, local tournaments, scholastic chess leagues, and even friendly chess matches. Whether recognizing a grand champion or a rising chess star, these medals make great awards.

🖋️ Can I customize my chess medal?

Yes! Many of our chess medals include free engraving, allowing you to personalize each award with a player's name, event title, or tournament date.

📦 How quickly do chess medals ship?

Most of our chess medals ship in just 1-2 business days! If you need them for an event, expedited shipping options are available at checkout.

🎨 Do you offer different ribbon colors for chess medals?

All are available with a red/white/blue ribbons, but many also allow you to choose from a variety of ribbon colors to match your school, club, or event theme.

🏆 Do you sell chess trophies in addition to medals?

Absolutely! In addition to chess medals, we also offer a great selection of chess trophies and awards to recognize top players and champions.

]]>
trophies-chessChess
custom-pagetrophies-chess1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our chess insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - ChessChesscustom-pagetrophies-chess1trophies498552-313633.4TrophiesSchool1Our chess participation trophies feature a real slant-front white marble base and free personalization. Significant quantity discounts available. Fast 1-2 shipping.mqt-chess-p-ncChesscustom-pagetrophies-chess1plaques498552-41JDSPlaques1Find this chess plaque discounted at TrophyCentral. Our chess plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Chesscustom-pagetrophies-chess1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Chess Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Chesscustom-pagetrophies-chess1trophies498551-310.452429Trophies1Find our Chess star column trophy discounted at TrophyCentral. Features a real marble base, 6 inch gold star-shaped column, free engraving and fast shipping.chess-star-column-trophycustom-pagedebate-trophieschess-award-plaque50401chess-plaque-ichess-free1trophies1Find a great selection of chess trophies at TrophyCentral. Each chess trophy and award includes free engraving. Chess medals include a ribbon.

Custom Chess Trophies - Honor Every Move, Match, and Milestone

Chess trophies recognize the patience, strategic brilliance, and competitive drive that define one of the world's oldest and most respected games. From elementary school scholastic tournaments introducing beginners to the joy of the board, to middle and high school chess club championships where rising players stake their reputations on every opening, from regional and state-qualifying tournaments attracting serious competitors, to adult club leagues and retirement community ladder competitions where lifelong enthusiasts measure their game, quality chess awards commemorate the mental effort and dedication that tournament play demands. Our versatile selection includes traditional column trophies and double-platform designs featuring classic chess piece figurines, cast stone and resin awards depicting boards and pieces in rich detail, championship cups and perpetual trophies ideal for passing between annual club champions, insert plaques customizable for any club or tournament name, and medals in gold, silver, and bronze for Swiss-system and round-robin events recognizing top finishers across every rating section.

Chess Award Ideas for Your Tournament or Club

Chess isn't just a game - it's a battle of minds, a test of patience, and a journey of continuous improvement. Whether you're running a school chess club, organizing a tournament, or celebrating your team's season, here are award ideas that honor every type of player - plus engraving examples for each.

Tournament Champions

  • Tournament Champion - The player who conquered all challengers. Their name belongs on the championship board forever.
  • Grandmaster in Training - Shows exceptional skill and dedication. Future chess master material with every move calculated three steps ahead.
  • Best Game Award - Played the most brilliant, exciting, or instructive game of the tournament. A masterpiece worth studying.

Skill Recognition Awards

  • Tactical Genius - Finds combinations others miss. Their forks, pins, and skewers appear out of nowhere.
  • Endgame Expert - Turns drawn positions into wins. Could probably checkmate with a king and a pawn against a queen.
  • Opening Master - Knows more opening theory than a chess encyclopedia. Always gets a good position out of the opening.
  • Speed Demon - Blitz chess champion who moves faster than thought. Makes good moves with seconds on the clock.
  • Problem Solver - Puzzle champion who solves tactics others can't see. Mate in three? Solved in seconds.

Character and Special Recognition

  • Most Improved Player - Rating jumped like a rocket. From learning how knights move to beating experienced players.
  • Best Sportsmanship - Wins with grace, loses with dignity. Always shakes hands and analyzes games with opponents.
  • Iron Board Award - Never misses club meetings or tournaments. Dedication that inspires everyone around them.
  • Comeback King / Queen - Specializes in winning lost positions. Never resigns, never surrenders, always finds resources.
  • Chess Ambassador - Teaches beginners, organizes events, and spreads the love of chess wherever they go.
  • First Tournament Award - Brave enough to play their first competitive games. The beginning of a chess journey.
  • Team Player Award - Scores crucial points for the team. Reliable on any board, always gives their best effort.

Engraving Examples

  • Tournament Trophy: FIRST PLACE / [Player Name] / Spring Chess Tournament 2025
  • Club Award: CHESS CLUB MVP / [Player Name] / [School/Club Name] 2024-25
  • Achievement Award: MOST IMPROVED PLAYER / [Player Name] / Rating: 800 to 1200

Chess teaches life skills - critical thinking, patience, and learning from mistakes. Recognize effort and improvement alongside tournament victories. The player who studied hardest or helped others learn deserves recognition too.

Frequently Asked Questions About Chess Trophies

What trophy sizes work best for different chess award categories?

Elementary school and beginners events benefit from 6-inch to 9-inch participation trophies ensuring every young player receives recognition for competing, building enthusiasm for the game and encouraging return play the following year. Section winners and top board finishers at club tournaments deserve 10-inch to 14-inch single column trophies with chess figurines or insert designs that distinguish their achievement from participation awards. Tournament champions and top-section finishers at invitational or qualifying events warrant 15-inch to 18-inch premium trophies with substantial presence reflecting superior performance across multiple rounds. Club championship titles and perpetual awards passed annually between league champions demand 20-inch to 24-inch multi-column or perpetual trophies whose size and weight convey the prestige of the title. Medals in gold, silver, and bronze work especially well for Swiss-system tournaments recognizing multiple finishers across rating sections without requiring a separate trophy for every place.

What details should chess trophy engraving include?

Comprehensive engraving preserves tournament memories and documents competitive achievement for a player's record. Essential elements include player name, place finish or award title, tournament or event name, sponsoring club or organization, and year. For rated tournaments, including the rating section (Open, U1800, U1400, etc.) adds meaningful context that experienced players value. Keep text concise and readable, prioritizing the most meaningful details when space limitations on smaller trophies require choices.

Do you offer bulk discounts for chess tournaments?

Yes, TrophyCentral offers significant bulk discounts on chess trophies and medals that scale with order quantity, keeping award budgets manageable for events of any size. Swiss-system tournaments ordering medals across multiple rating sections, scholastic coordinators buying participation trophies for an entire school program, and clubs purchasing awards for a full season all benefit from bulk pricing.

If you need more information before deciding, see our expert resource section:

Be sure to also browse our complete trophies and awards collection to explore additional designs for every sport and occasion.

]]>
trophies star-trophies trophies-victoryChess
11All of our car trophies with a Chevy figure include free engraving!chevy trophies, chevy trophy, chevy awards, chevy trophies and awards

Shop for Car & Truck Trophies with Confidence at TrophyCentral

We offer a huge selection, discounted prices and free shipping on orders for trophies, awards and great customer service. Do you need help with some ideas or with ordering? Yes, we sell online, but we have real people who would love to help you! Feel free to call our customer service experts in Michigan, New York and online. TrophyCentral - delivering smiles since 1999!


]]>
quickshiptrophies-camero quickshiptrophies-stock-carChevy
custom-pagenew-trophies-21trophies498551-310.452429Trophies1Find our Chevy star column trophy discounted at TrophyCentral. Features a real marble base, 6 inch gold star-shaped column, free engraving and fast shipping.chevy-star-column-trophycustom-pagequickshiptrophies-chicken1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Fabulous Chicken Figure trophy with choice of 1st, 2nd or 3rd place trim.qtchickenplcustom-pagequickshiptrophies-chicken1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%This popular Chicken Figure trophy features a real marble base, column, figure and trim indicating year of award. Includes up to three lines of free engraving!qtchickenyrcustom-pagequickshiptrophies-chicken1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with chicken figure discounted at TrophyCentral. Includes free text engraving!cup-chicken-pcustom-pagequickshiptrophies-chicken1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these chicken figure budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtchickenscbcustom-pagequickshiptrophies-chicken1498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Find this budget chicken award trophy discounted at Trophy Central. Features a real marble base and plastic chicken figure. Engraving is free. Fast 1-2 day shipping.bdg-chickencustom-pagequickshiptrophies-chicken1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:26%Find these fabulous Chicken Figure Winners Line Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qtchickenttcustom-pagequickshiptrophies-chicken1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.751434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:28%Find this awesome Chicken Figure two-tier championship trophy discounted, and with free engraving, at TrophyCentral!qtchickenttwcustom-pagequickshiptrophies-chicken1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:21%,100:24%These popular Chicken Figure Elite Series Trophies feature a choice of column size and color, a white marble base and free trophy personalization!custom-pagequickshiptrophies-chicken1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.05Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%Find This Popular Chicken Figure Deluxe Platform Series Trophy Discounted at TrophyCentral. Real Marble Base; Free Personalization!custom-pagequickshiptrophies-chicken1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Chicken Figure figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-chicken-scbcustom-pagequickshiptrophies-chicken1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.41226Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:18%,10:23%Find these fabulous two-tier, 3-column champion Chicken Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtchicken3ccustom-pagequickshiptrophies-chicken1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:27%,100:32%Our popular Chicken Figure Participation Trophies feature a real slant-front marble base and free personalization. Significant quantity discounts available.qtchickennccustom-pagenew-trophies-21trophies498551-310.452429Trophies1Find our Chicken star column trophy discounted at TrophyCentral. Features a real marble base, 6 inch gold star-shaped column, free engraving and fast shipping.chicken-star-column-trophycustom-pagequickshiptrophies-rabbitqtchickenncqtchickenplqtchickenyrqtchickenttqtchickenttwqtchicken3cqtchickenscqtchickendmmqtchickenscbcup-chicken-scbcup-chicken-pbdg-chicken11Find Chicken Trophies discounted at TrophyCentral. Each Chicken Trophy includes engraving. Fast 1-2 day shipping.chicken trophies, chicken trophy, chicken awards, chicken trophies and awards

Shop With Confidence at TrophyCentral

We offer a huge selection, discounted prices and top-rated customer service. Do you need help with some ideas or with ordering? Yes, we sell online, but we have real people who would love to help you! Feel free to call our customer service experts in Michigan, New York and online. TrophyCentral - delivering smiles since 1999!


]]>
11See these unique Bank Trophies at TrophyCentral. Bank Trophies are available in Soccer, Football, Baseball, T-Ball and Basketball and include engraving!1custom-pagefreeawardcertificates1"Download Only"free-cooking4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our chili cook-off template is free and designed exclusively for TrophyCentral. Chili cookoff templates and award certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.chili-cook-off-templatechili-cook-off-521Cooking / Culinarycustom-pagetrophies-cooking-culinary1trophies498552-41Trophies1Find this chili bowl trophy discounted at TrophyCentral. All trophies include free engraving. Fast 1-2 day shipping.Cooking / Culinarycustom-pagemusicartpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsMusic, Drama, Art, Dance1:22%,50:28%,100:32%,500:42%"Music Lapel Pins" "Band Lapel Pins" "Band Awards" "School Pins"Find Lyre - Choir pins at TrophyCentral. Each AP Series Lyre - Choir pin includes a clutch back.ap23Music / Band / Choruscustom-pagemusicartpins1plastic-pinbox-t5498551-20.550040.5TrophyCentralLapel Pins11:22%,25:24%,100,27%,500:30%Find our 3D Series gold choir pin discounted at TrophyCentral. Each outstanding volunteer pin features a clutch back so it can be easily and safely attached to clothing. Fast 1-2 day shipping.Music / Band / Choruscustom-pagefreeawardcertificates1"Download Only"free-music4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our choir template is free and designed exclusively for TrophyCentral. Choir templates and award certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.choir-templatechoir-521Choir, Musiccustom-pagegold-pins-lapelplasticpinboxvelapinbox151-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
lapel pins105502-30.31150030.3Classic MedallicsLapel PinsMusic, Drama, Art, Dance1:30%,50:36%,100:39%,500:42%,1000:48%"Music Lapel Pins" "Band Lapel Pins" "Band Awards" "School Pins"Find this fabulous Choir letter pin at TrophyCentralcl30Return to our section for more great choices.lapel-award-pins06-15-2010Music / Band / Chorus
custom-pagetrophies-music12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic MedallicsMedalsMusic, Drama, Art, Dance1:22%,100:28%,500:34%,1000:45%"Music Awards" "Award Medals - All Subjects" "School Medals" "Music Medals"These inexpensive 1 1/4 inch Choir Medals offer a high quality, but low price for those on a tight budget.e9134Music / Band / Chorus
custom-pagemusicartpins1plastic-pinbox-t5lapel pins498551-20.525040.5TrophyCentralLapel Pins11:22%,25:24%,100,27%,500:30%Find this Choir Gold Enamel lapel pin discounted at TrophyCentral. Features a clutch-pin back for easy attachment to clothing.. Fast 1-2 day shipping.choir-u-pbMusic / Band / Chorus11Discover how to choose the perfect trophy case for your school, business, or home. Learn about wall vs. freestanding cases, glass vs. acrylic, lighting, security features, and display tips to keep awards safe and shining.custom-pagemusicartpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsMusic, Drama, Art, Dance1:22%,50:28%,100:32%,500:42%"Music Lapel Pins" "Band Lapel Pins" "Band Awards" "School Pins"Find these popular Lyre - Chorus AP Series Lapel Pins discounted at TrophyCentral. Fast 1-2 day shipping!ap2508-20-2016Music / Band / Choruscustom-pagemusicartpins1plastic-pinbox-t5498551-20.550040.5TrophyCentralLapel Pins11:22%,25:24%,100,27%,500:30%Find our 3D Series gold chorus pin discounted at TrophyCentral. Each outstanding volunteer pin features a clutch back so it can be easily and safely attached to clothing. Fast 1-2 day shipping.Music / Band / Choruscustom-pagefreeawardcertificates1"Download Only"free-music49855011TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Chorus template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Chorus-Certificatechorus-freeChorus, Musiccustom-pagemusicartpins1plastic-pinbox-t5lapel pins498551-20.525040.5TrophyCentralLapel Pins11:22%,25:24%,100,27%,500:30%Find this Chorus Gold Enamel lapel pin discounted at TrophyCentral. Features a clutch-pin back for easy attachment to clothing.. Fast 1-2 day shipping.chorus-u-pbMusic / Band / Choruscustom-pagemedallion-inserts-organizations12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsReligious1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals" "Religious Medals"Buy these quality Christian Symbols Inserts (Litho) at TrophyCentral. Each 2" insert can be used to create a unique plaque, medal or trophy.497663Religious
custom-pagefreeawardcertificates1"Download Only"certificates4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Christmas award template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Christmas-Award-Certificatechristmas-freeChristmas, Holidaycustom-pagegift-certificate-templates1"Download Only"certificates4985501Trophy CentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Christmas themed template is free and designed exclusively for Trophy Central. This gift certificate measures 5" x 3" and can be easily downloaded and printed.Christmas-Gift-Certificategc-christmas-521Christmas, Gift Certificate, Holidaycustom-pageacrylicawards11"1-2 business days" "Marquette, MI" "UPS"general498852-310.451613.25Quick TrophyCrystal Awards1:14%"New Products"See this Circle Acrylic Award with Pewter Finish Base from TrophyCentral.Leadershipcustom-pagegeneral-corporate-awards1"14 business days" "Erlanger, KY" "UPS"general410187-1010.451 2 3 4 5 6 7 8 9420.45JcharlesPlaques1:22%,6:23%,25:25%Find the Circlescape Plaque at TrophyCentral; plaque price includes engraving.custom-pagecitizenship-awards1medals498551-20.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful Citizenship 2" Epoxy-covered insert sticker discounted at TrophyCentral. Fast shipping, free over $99.custom-pagecitizenship-awards1498551-211821.06TrophyCentralTrophies1Citizenshipcoaching-teaching-guides11Meaningful citizenship award ideas to recognize character, leadership, and community service. Honor students who make a difference with creative awards celebrating kindness, integrity, and positive influence.custom-page70231"Download Only"certificates49855011TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"See this Citizenship Certificate designed exclusively for TrophyCentral! Citizenship Certificates can be downloaded for free! Each citizenship certificate measures 11 x 8 1/2 inches.citizenshipfrCitizenshipcustom-pagecitizenship-awards102-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130042.75Classic MedallicsMedalsAcademic1:22%,25:24%,50:30%,100:36%,500:42%"School Medals" "School Award Medals" "Scholastic Medals" "Scholastic Award Medals" "Academic Medals" "Academic Award Medals" "Medals, School"Your students will love this colorful Mylar Citizenship Medal from TrophyCentral. Each Citizenship medal includes a neck ribbon!tm9704Citizenship
custom-pagecitizenship-awards12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these high-quality Citizenship Award Inserts at TrophyCentral. Each Citizenship Award Insert can be used to create a unique plaque, medal or trophy.518155Citizenship
custom-pagecitizenship-awards1"3-6 business days with engraving, Without engraving: 1-3 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"plaques105503-610.4511219.65Classic MedallicsPlaquesInsert1:22%,3:24%,5:27%Genuine Walnut Citizenship Award Plaque with 2 Inch Insert and Free Engraving.51-8155Citizenshipcustom-pageaward-medals803citbr318ec63944hp05ap67res6xxcitizenship-ei4897045181551trophies-academic1Find citizenship lapel pins, certificates, trophies and awards discounted at TrophyCentral. Browse our citizenship awards now!

Citizenship Trophies and Awards for Every Achievement Level

TrophyCentral offers a wide selection of citizenship trophies, medals, and awards designed to inspire students and recognize positive character at every level. From participation awards for classroom citizenship programs to impressive trophies for outstanding community service honorees, our collection ensures you will find the right award for every student and every occasion. With over 2,300 five-star reviews and trusted by schools and community organizations since 1999, TrophyCentral delivers quality awards at guaranteed lowest prices. Every trophy includes free personalized engraving and most orders ship in just 1-2 business days. Free economy shipping is available on orders over $99.

Citizenship Award Ideas for Your School or Program

Citizenship awards recognize the students who make our schools and communities better places. Here are award ideas that honor character, kindness, and leadership with meaningful recognition - plus engraving examples for each.

Character Excellence Awards

  • Outstanding Citizen Award - Exemplifies respect, responsibility, and kindness daily. The student everyone looks up to.
  • Role Model Award - Sets the standard for behavior and attitude. Leading by example every day.
  • Integrity Award - Always does the right thing, even when no one is watching. Honesty personified.

Leadership and Community Service Awards

  • Student Leader Award - Takes initiative, organizes others, makes positive change happen.
  • Peer Mentor Award - Helps new students, supports classmates, builds inclusive communities.
  • Positive Influence Award - Their attitude and actions make everyone around them better.
  • Service Above Self - Volunteers without being asked. Always ready to help others.
  • Community Champion - Makes a difference beyond the classroom. Active in making the world better.
  • Helping Hands Award - First to volunteer, last to leave. Service with a smile.

Daily Excellence Awards

  • Kindness Counts Award - Small acts of kindness that make big differences. Compassion in action.
  • Respect and Responsibility - Treats everyone with respect. Takes ownership of actions and choices.
  • Peacemaker Award - Resolves conflicts, builds bridges, creates harmony in the classroom.

Engraving Examples

  • Traditional Format: OUTSTANDING CITIZENSHIP / [Student Name] / [School Name] - 2025
  • Character Focus: CHARACTER COUNTS AWARD / [Student Name] / "Leading with Kindness"
  • Inspirational Message: [Student Name] / "Be the Change" / Citizenship Award 2025

Consider having students nominate peers for citizenship awards. Often, students see acts of kindness and leadership that adults miss. Create clear criteria focusing on daily actions rather than single grand gestures. The quiet student who always includes others might deserve recognition as much as the student council president.

Frequently Asked Questions About Citizenship Trophies

What types of citizenship and character programs are these awards suitable for?

Our citizenship trophies and awards are suitable for a wide range of programs including elementary and middle school citizenship recognition, character education initiatives, community service awards, anti-bullying program recognition, student council achievement, good neighbor awards, and school and district citizenship competitions at all grade levels.

Does engraving come included with citizenship trophies?

Yes, every citizenship trophy includes free personalized engraving at no extra cost. You can add the student's name, school, program name, and recognition details to create a meaningful award that reinforces positive values and community contribution.

Do you offer citizenship medals in addition to trophies?

Yes, we carry citizenship medals that make an excellent and affordable alternative to trophies, ideal for recognizing an entire class or large group of students in a citizenship or character program. Every citizenship medal includes a free neck ribbon, and optional engraving is also available.

How quickly will citizenship trophy orders ship?

Most citizenship trophy orders are processed and shipped within 1-2 business days, with same-day processing available on many orders placed early in the day. Expedited shipping options are also available at checkout for time-sensitive recognition events. Orders over $99 qualify for free economy shipping.

If you need more information before deciding, see our expert resource section:

Be sure to also browse our academic trophies and awards for additional recognition options for schools and educational programs.

]]>
Citizenship
custom-pagecitizenship-awards1medals498551-2120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Citizenship Excellence Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Shipping is free over $99.Citizenship (General)custom-pagecitizenship-awards15citizenshipfr 944 923"1-3 business days" "Columbia, South Carolina; Marquette, Michigan" "UPS (FedEx available on request)"290631-21 2 3 230.45100020.45Certificate SourceCertificatesAward Certificates1:22%,50:38%,100:42%Find these Citizenship certificates discounted at TrophyCentral. Each Citizenship certificate measures 8 1/2 x 11 inches and typically ships in 1-2 days.7023Citizenshipcustom-page70231290631-31 2 3 230.45100020.45Certificate SourceCertificatesAward Certificates1:22%,25:24%,100:40%,500:50%Find These Printed Citizenship certificates at TrophyCentral. Each Citizenship certificate measures 11 x 8 1/2 inches.944Citizenshipcustom-pagecitizenship-awards1498551-211.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Citizenship insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-Citizenship-InsertCitizenshipcustom-pagecitizenship-awards1498551-210.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Citizenship single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - CitizenshipCitizenshipcustom-pagecitizenship-awards1498551-210.71217.38Trophies1Citizenshipcustom-pagecitizenship-awards1medals498551-2120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Citizenship Excellence Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Shipping is free over $99.Citizenship (General)custom-pagecitizenship-awards1medals498551-20.525035.5TrophyCentralMedalsSports, Hobby, Org, Livestock1Find this colorful Citizenship insert medal discounted at TrophyCentral. Fast shipping, free over $99.Citizenshipcustom-pagecitizenship-awards1medals498551-20.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this Citizenship Excellence insert medal With A Personalized Front Rim discounted at TrophyCentral. Fast shipping, free over $99.Citizenshipcustom-pagecitizenship-awards1498551-21.1Plaques1Find this citizenship insert plaque discounted at trophyCentral. Price includes free engraving. Shipping is free over $99.Citizenship1citizenship-awards1Shop for citizenship medals at TrophyCentral. Citizenship medals include a neck ribbon and most ship in just 1-2 business days.

Citizenship Medals - Character and Community Recognition for Schools and Youth Programs

Citizenship medals recognize the qualities that make a student a positive presence in their school and community, honoring the respect, responsibility, integrity, compassion, and service that academic grades alone cannot measure. Where honor roll medals reward academic performance and athletic medals recognize competitive achievement, citizenship medals see the whole student, acknowledging the character qualities and community contributions that teachers observe every day but rarely have a formal opportunity to honor with the same tangible recognition given to academic and athletic accomplishments. Our citizenship medal collection features designs recognizing the core character traits and civic values central to most school character education programs, in sizes and styles suited for elementary through high school award ceremonies, quarterly character recognition programs, end of year assemblies, and community youth organization recognition events. Each medal includes a free neck ribbon for immediate wearable presentation, and volume pricing makes it practical to recognize every deserving student across every grade level in a single recognition event without straining a school or organization budget.

Frequently Asked Questions About Citizenship Medals

What occasions and programs use citizenship medals?

Citizenship medals are most commonly used in school character education programs, community youth organizations, and civic recognition events where the goal is to honor positive values and community contributions alongside or in place of academic and athletic performance. Elementary schools presenting citizenship medals at quarterly or end of year assemblies create a formal recognition moment for students who demonstrated exceptional respect, responsibility, helpfulness, and positive leadership within their classroom and school community throughout the period. Middle school character recognition programs use citizenship medals to acknowledge students navigating a challenging developmental period with integrity and empathy, recognizing the social and community dimensions of growing up that fall outside the academic grade report. High school programs present citizenship medals alongside academic and athletic honors at end of year ceremonies, ensuring that students who contributed meaningfully to school culture through service, leadership, and character receive formal recognition equal in presentation quality to the academic and athletic awards distributed at the same event. Community youth organizations including scouting programs, 4-H clubs, and civic youth groups use citizenship medals to honor members who demonstrated the organization's core values through community service, peer leadership, and personal character development during the program year. Naturalization ceremonies and civics education programs at the district level use citizenship medals to mark meaningful milestones in students' understanding and embrace of civic responsibility and democratic participation.

How do citizenship medals differ from good conduct and character awards?

Citizenship medals, good conduct awards, and character recognition all honor positive student behavior but approach recognition from slightly different angles that make each format appropriate for different program goals and contexts. Citizenship medals specifically recognize a student's contribution to and participation in the broader school and community, emphasizing the outward-facing qualities of civic responsibility, service to others, respect for community standards, and positive influence on peers that define good citizenship in a social and civic context. Good conduct awards focus more narrowly on behavioral compliance within the school setting, recognizing students who consistently followed school rules, treated others with respect, and contributed to a positive classroom environment throughout a specific period. Character awards recognize the inner qualities and personal values that drive positive behavior, including honesty, integrity, compassion, perseverance, and responsibility, which may or may not be directly expressed through civic participation. Many schools use all three recognition types within a complete character education program, with citizenship medals reserved for students who demonstrated their values through specific community contributions and leadership actions rather than simply through consistent personal behavior. The distinction matters for the student receiving the award because a citizenship medal communicates that their community noticed and valued their specific contribution rather than simply rewarding the absence of negative behavior.

What should citizenship medal engraving include?

Citizenship medal engraving works best when it captures the student, the specific recognition, and the school or program context so the medal remains a meaningful keepsake that the recipient connects to a specific time and community in their life. Essential elements include student name, award title, school or organization name, and year. For example: Jordan Rivera, Citizenship Award, Lincoln Elementary School, 2024-2025, or Maya Chen, Outstanding Community Service, Jefferson Middle School, Spring 2025. For programs presenting citizenship medals tied to specific character traits or pillars, including the specific value being honored adds meaningful context: Tyler Walsh, Respect Award, Brookside Academy, 2025, or Emma Park, Responsibility and Leadership, Riverside Charter School, 2025. Community organization citizenship medals benefit from including the program or chapter name alongside the organization: Nathan Flores, Citizenship Medal, Troop 214, Boy Scouts of America, 2025. When engraving space is limited, student name, award title, and year are the three essential elements that distinguish a personalized citizenship medal from a generic recognition piece, with school name added when space permits. The specific character quality being recognized is worth including even on smaller medals when possible, since the distinction between a general citizenship award and a specific respect or service award makes the recognition more meaningful and personal to the recipient.

If you need more information before deciding, see our expert resource section:
]]>
medals-generalCitizenship
custom-pagecitizenship-awards12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these quality Mylar Citizenship Decal Inserts at TrophyCentral. Each decal can be used to create a unique plaque, medal or trophy.489704Citizenship
custom-pagecitizenship-awards1498551-210.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our citizenship insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - CitizenshipCitizenshipcustom-pagecitizenship-awardsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:30%,50:32%,100:35%,500:39%"Patriotic Awards"Find Citizenship Pins discounted at TrophyCentral. Each Citizenship Award Pin features a quality clutch-back. Fast 1-2 day shipping on lapel pins.br318Citizenshipcustom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceSealsEmbosser Seals1:22%,3:28%,5:31%Find these Citizenship Embossed Certificate Seals discounted at TrophyCentral.803citCitizenshipcustom-pagecitizenship-awards1medals498551-2120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Citizenship Excellence Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Shipping is free over $99.Citizenship (General)11-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105501-21500301Find these fabulous CL Series Chenille Letter Pins at Top-Rated TrophyCentral.cl-series-letter-pins
custom-pagename-badges-tagswoyoulipr100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoName Badges1Find These Custom Class Of (Year) Badges Great Selection of Badges and Magnets. Discounted At TrophyCentral.namebadges-classcustom-pageschool-pinsplastic-pinbox-t1pins498551-30.550040.5TrophyCentralLapel Pins1:22%,25:24%,100,27%,500:30%Find our 3D-Series Class of 2026 pin discounted at TrophyCentral. Perfect for graduation and year-end school events. Fast 1-2 day shipping.2026custom-pagename-badges-tagswoyoulipr100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoName Badges1Find These Custom Class Of Badges Discounted At TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.namebadges-classofcustom-pagetrophies11stinaw clasacaw starplaque1 qtcupdm staracaw"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451032.95TrophyCentralTrophiesMusic, Drama, Art, Dance1:14%,5:24%This Oscar-like trophy and Star Achievement award are perfect for recognizing outstanding performances of any kind! Free engraving and fast 1-2 day shipping.trophies-dramaReturn to the section for other great choices.trophies-dramaDramabobatr1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.711012.1Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,5:28%,50:34%"Basketball Trophies"Classic Line Trophy - Basketball. Ideal for leagues, schools, and tournaments. Fast shipping.wge457Basketball, Sportscustom-pagetrophies-bowling1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.711012.1Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,5:28%,50:34%"Bowling Trophies" "Bowling Awards"See these fabulous Classic Line Trophies - Bowling at TrophyCentral. Price includes engraving!wge46305-31-2011Bowlingcustom-pagetrophies-cheerleading-spirit1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.711012.1Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,5:28%,50:34%"Cheerleading Trophies" "Cheer Awards" "Cheerleading Awards" "Cheerleader Awards"See these fabulous Classic Line Trophies - Cheerleading at TrophyCentral. Price includes engraving!wge460Looking for something different? See more greatand awards.trophies-cheerleading-spirit02-15-2014Cheerleading, Sportscustom-pagetrophies-football1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.711012.1Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,5:28%,50:34%"Football Trophies"Classic Line Award - Football. Ideal for leagues, schools, and tournaments. Fast shipping.wge45910-30-2018Football, Sportscustom-pagetrophies-ice-hockey1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.711012.1Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,5:28%,50:34%"Hockey Trophies" "Hockey Awards"See these fabulous Classic Line Hockey Trophies Discounted at TrophyCentral. Price includes engraving!wge46706-20-2013Hockey, Sportscustom-pagetrophies-soccer1trophies465711-210.711012.1Tower RibbonTrophiesSports, Hobby, Org, Livestock1"Soccer Trophies" "Soccer Medals and Trophies" "Soccer Trophies and Medals"Classic Line Soccer Trophy - Traditional Design with Free Engraving. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagetrophies-swimming-diving1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.711012.1Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,5:28%,50:34%"Swimming Trophies" "Swimming Awards"See these fabulous Classic Line Trophies - Swimming at TrophyCentral. Price includes engraving!wge479Swimming / Diving, Sportscustom-pagetrophies-tennis1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.711012.1Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,5:28%,50:34%"Tennis Trophies" "Tennis Awards"See these fabulous Classic Line Trophies - Tennis at TrophyCentral. Price includes engraving!wge471Return to oursection for more popular awards for kids and adults alike.trophies-tennisTennis, Sportscustom-pagetrophies-track-field11041 cl42"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.711012.1Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,5:28%,50:34%"Track Trophies" "Track Awards"See these fabulous Classic Line Track Trophies at TrophyCentral. Track Shoe Trophy price includes engraving!wge473Return to thesection for additional styles and sizes.trophies-track-fieldcustom-pagetrophies1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.41234Quick TrophyTrophiesPerpetual Trophies1:14%,3:15%,10:16%Find this Perpetual Classic Trophy Discounted at TrophyCentral. Each Trophy has enough room for 32 names. Ships in just 1-2 days.champion-perpetual-trophiescustom-pageribbons1-tiaras1"1-3 business days" "Topeka, Indiana" "UPS (Post Office Priority Mail also available)"465711-21 260.8244.4Tower RibbonSpiritTiaras1:22%This Simple Heart Tiara Is Perfect For Your Prom Needs And Will Go Easy On Your Budget! Measures 2 3/8" Tall and Ships in Just 1 Business Day!rtp6615custom-pagetrophies-academic11"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451032.95TrophyCentralTrophies1:22%,5:29%Find this classic achievement trophy discounted at TrophyCentral. Includes free engraving for a special touch!achievement-trophies-awardsDanceAchievementcustom-pagemedallion-inserts-arts-and-music-medallions12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105502-41130025Classic MedallicsInsertsMusic, Drama, Art, Dance1:22%"Award Medals" "Art / Dance / Drama Medals" "Award Medals - All Subjects" "Music Awards"Buy these quality Classical Music Inserts (Litho) at TrophyCentral. Each Classical Music Insert can be used to create a unique plaque, medal or trophy.504461Music / Band / Chorus
custom-pagemusicartpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsMusic, Drama, Art, Dance1:22%,50:30%,100:38%,500:58%"Music Lapel Pins" "Band Lapel Pins" "Band Awards" "School Pins"Find these fabulous Music Clef - Band Pins Discounted at TrophyCentral. Pins Ship in just 1-2 Business Days!ep81Music / Band / Choruscustom-pagemusicartpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsMusic, Drama, Art, Dance1:22%,50:30%,100:38%,500:58%"Music Lapel Pins" "Band Lapel Pins" "Band Awards" "School Pins"See these fabulous Music Clef - Choir Pins and other music lapel pins at TrophyCentral. Music Clef - Choir Pins ship in just 1-2 business days!ep8208-01-2022Music / Band / Choruscustom-pagemusicartpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsMusic, Drama, Art, Dance1:22%,50:30%,100:38%,500:58%"Music Lapel Pins" "Band Lapel Pins" "Band Awards" "School Pins"See these fabulous Music Clef - Chorus Pins and other music lapel pins at TrophyCentral. Music Clef - Chorus Pins ship in just 1-2 business days!ep83Music / Band / Choruscustom-pagemusicartpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsMusic, Drama, Art, Dance1:22%,50:30%,100:38%,500:58%"Music Lapel Pins" "Band Lapel Pins" "Band Awards" "School Pins"See these fabulous Music Clef Pins and other music lapel pins at TrophyCentral. Music Clef Pins ship in just 1-2 business days!ep85Music / Band / Choruscustom-pagemusicartpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsMusic, Drama, Art, Dance1:22%,50:30%,100:38%,500:58%"Music Lapel Pins" "Band Lapel Pins" "Band Awards" "School Pins"See these fabulous Music Clef - Orchestra Pins and other music lapel pins at TrophyCentral. Music Clef - Orchestra Pins ship in just 1-2 business days!ep8607-10-2014Music / Band / Choruscustom-pagenoindexed-items1exclude1Click to see our stock logo options for our custom ribbons and rosettes. Adding a logo gives your ribbon a more professional look and adds a special touch!1custom-pageclocks11personalized gifts105503-610.4511217.25Classic MedallicsGiftsDesk Sets1:22%This clock and pen set has a beautiful rosewood finish and makes a great holiday or graduation gift. The price of engraving is also included so you can add a special touch.02-15-2014Engraved Giftscustom-pagetrophies-coach1498551-30.5100021TrophyCentralInsertsSports, Hobby, Org, Livestock1Find this colorful Coach 2" Epoxy-covered insert sticker discounted at TrophyCentral. Fast 1-2 day shipping.Coach, Sportscustom-pagetrophies-coach1trophies498551-31.520033TrophyCentralMedalsSports, Hobby, Org, Livestock1Find these Coach Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Coach, Sportscustom-pagetrophies-coach1trophies498551-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Coach insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Coach, Sportscustom-pagetrophies-coach1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Coach single column insert trophy features a choice of column color, a marble base and free trophy engraving.Coach, Sportscustom-pagetrophies-coach1trophies498551-311821.06TrophyCentralTrophies1Coach, Sportscustom-pagesports-inserts1105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Coach GENERAL Inserts (Litho) at TrophyCentral. Each Coach GENERAL Insert can be used to create a unique plaque, medal or trophy.498111Coach, Sportscustom-pagetrophies-coach1trophies498551-310.71217.38Trophies1Coach, Sportscustom-pagetrophies-coach1trophies498551-31.520033TrophyCentralMedalsSports, Hobby, Org, Livestock1Find these Coach Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Coach, Sportscustom-pagetrophies-coach1trophies498551-30.525035.5TrophyCentralMedalsSports, Hobby, Org, Livestock1Find this colorful Coach insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Coach, Sportscustom-pagetrophies-coach1trophies498551-30.525035.5TrophyCentralMedalsSports, Hobby, Org, Livestock1Find this Coach insert medal with a personalized front rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Coach, Sportscustom-pagetrophies-coach1plaques498551-311.1Plaques1Find these Coach insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Coach, Sportscustom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Coach Inserts (Litho) at TrophyCentral. Each Coach Insert can be used to create a unique plaque, medal or trophy.507413Coach, Sports
custom-pagetrophies-coach1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our coach insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Coach, Sportscustom-pagekeychains21105502-40.39125035.39Classic MedallicsGiftsKeychains1:22%,10:25%,25:32%,50:39%,100:47%"Coach Awards"Find these popular Pewter Coach Key Chains at TrophyCentral; discounted prices!pk67-cmKeychainscustom-pageholographic-sports-plaques1plaques498552-41JDSPlaques1Find this Coach Plaque discounted at TrophyCentral. Our coach plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Coach, Sportssports-resource-hub11Discover effective coaching resources for motivating young athletes! From team rewards to individual recognition, find creative tools that inspire athletic development and celebrate achievements.custom-pagetrophies-coach1trophies498551-31.520033TrophyCentralMedalsSports, Hobby, Org, Livestock1Find these Coach Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Coach, Sportscustom-pagetrophies-coach1trophies498551-310.452429Trophies1Find our Coach star column trophy discounted at TrophyCentral. Features a real marble base, 6 inch gold star-shaped column, free engraving and fast shipping.coach-star-column-trophycustom-pageaward-medalsbdg-whistle-pmqt-whistle-p-ncmqt-whistle-p-scmqt-whistle-p-dmmqt-whistle-p-plcoach-part-icoach-single-icoach-champ-icoach-e-part-icoach-e-single-icup-coach-scb-icup-coach-incoach-jigfcoach-jisfcoach-jibfcoach-mccoach-mc-prgiftwhistlecoach-award-plaquecoach-plaque-imqt-whistle-p-nccoachfr8x10photocoach-star-column-trophy1trophies1Shop coaches trophies, medals and gifts at TrophyCentral. Show your appreciation for your coach's hard work throughout the season with a custom trophy or gift for a personal touch!

Coach Trophies and Awards - Meaningful Recognition for the Leaders Behind Every Team

Coach trophies and awards recognize the preparation, dedication, and personal investment that coaching demands at every level of youth and competitive sports. A coach spends hundreds of hours planning practices, studying opponents, managing team dynamics, communicating with parents, and showing up for athletes in ways that go far beyond what happens on the field or court, and a quality coach award acknowledges that contribution in a way that a handshake and a thank you cannot. Our coach award collection spans traditional coach trophies with figurine designs suited for end of season banquet presentations, engraved plaques appropriate for permanent office or classroom display, crystal awards suited for distinguished service and retirement recognition, and engraved gifts including clocks, pen sets, and desk accessories that coaches use every day long after the season ends. Every coach award includes free engraving personalized with coach name, award title, team or program name, sport, and season year, ensuring the recognition documents the specific contribution being honored rather than serving as a generic piece of hardware.

Frequently Asked Questions About Coach Trophies and Awards

What occasions are coach trophies and awards most commonly presented?

Coach awards are presented across a wide range of occasions that reflect the different relationships coaches build with their athletes, families, and programs over the course of a career. End of season banquets are the most common occasion for coach award presentation, where teams and booster organizations take the opportunity to formally thank the coaching staff alongside the player recognition program. These awards are most meaningful when presented publicly in front of the athletes the coach spent the season developing, giving the recognition the ceremonial weight it deserves rather than delivering it privately or through the mail. Coach of the year awards presented by leagues, associations, and athletic departments recognize a specific season's outstanding coaching performance among all coaches within the program, carrying competitive prestige that a team-specific end of season gift does not. Retirement recognition for coaches completing long careers deserves the most substantial award investment, since a coach retiring after ten, twenty, or thirty years of service has accumulated a contribution that a modest plaque or small trophy cannot adequately honor. Milestone recognition for coaches reaching significant tenure marks such as five years, ten years, or a specific win total uses the occasion to acknowledge sustained commitment before retirement arrives. Assistant coach recognition is frequently overlooked in award programs but matters enormously for retention, morale, and the culture of programs that depend on volunteer and part-time coaching staff to function.

What award format works best for coach recognition?

The right coach award format depends on the occasion, the depth of service being recognized, and where the award will be displayed after the presentation. Coach trophies with figurine designs are the most traditional end of season gift from a team, providing a standing award that coaches display in their home or office alongside the accumulated trophies of their coaching career. They work best for annual end of season recognition where the goal is a meaningful personal keepsake from a specific group of athletes at a specific point in time. Engraved plaques are the stronger choice when the coach award will be displayed in a professional setting such as a school office, athletic department hallway, or program trophy case, where a wall-mounted piece integrates more naturally than a standing trophy and creates a more formal, institutional recognition appropriate for coach of the year and distinguished service honors. Crystal and glass awards suit retirement recognition and long-service milestones where the material quality of the award should communicate the weight of the accomplishment, providing a visually striking piece that coaches place in a position of honor in their home or office. Practical engraved gifts including clocks, pen sets, leather journals, and desk accessories work particularly well as coach appreciation gifts from individual families, small groups, and assistant coach recognition programs where the goal is a personal, useful gift rather than a formal award, since coaches genuinely use these items long after a trophy or plaque might be put away. Many programs combine formats, presenting a trophy or crystal award at the formal banquet and giving a practical engraved gift alongside it so the coach leaves with both a display piece and something they will use every day.

What should coach award engraving include?

Coach award engraving should document the specific relationship, achievement, and service context so the award tells a complete story years after the presentation. Essential elements include coach name, award title, team or program name, sport, and season year. For example: Coach David Martinez, Coach of the Year, Westside Rockets, Metro Youth Football, 2025, or Jennifer Walsh, Head Coach, Lincoln Varsity Soccer, Thank You for an Unforgettable Season, Fall 2025. Career milestone and retirement awards deserve fuller engraving that acknowledges the scope of service: Coach Robert Chen, 20 Years of Dedicated Service, Riverside Athletic Association, 245 Wins, 3 Championships, Retired 2025. Win totals and championship counts add meaningful career context to retirement and milestone trophies that generic award titles cannot provide, turning the engraving into a permanent record of what was built rather than just when it ended. Season records strengthen end of year coach awards in the same way: Head Coach, Season Record 14-2, League Champions, 2025. For coach awards from individual families, including the player's name alongside the coach name creates a personal connection that the coach will associate with a specific athlete for years: To Coach Sullivan, From the Brennan Family, Thank You for Everything, 2025. Keep engraving concise and readable, prioritizing coach name, award title, program, and year when plate size requires choices. See our complete collections of award plaques, crystal awards, and engraved clocks for additional coach recognition options that complement coach trophies in a complete appreciation program.

If you need more information before deciding, see our expert resource section:
]]>
Coach
custom-pageplaques1ps5864 ps5866 8xwalplaqwsu"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498852-310.45811.6Quick TrophyPlaquesInsert1:14%,3:14%"Coach Awards"See this stunning Coach plaque and other Holographic Plaques at TrophyCentral.qsinplaqcoachCoach, Sportscustom-pagetrophies-coach1trophies498552-311622.85TrophiesSchool1Find this popular coaches whistle figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at trophyCentral. Ships in a fast 1-2 days!mqt-whistle-p-plCoach, Whistle, Sportscustom-pagetrophies-coach1trophies498552-313633.4TrophiesSchool1Find this budget coach's whistle award trophy discounted at Trophy Central. Features a real marble base and plastic figure. Engraving is free. Fast 1-2 day shipping.Coach, Whistle, Sportscustom-pagetrophies-coach1trophies498552-311623.65TrophiesSchool1These quick-ship trophies from TrophyCentral feature a coach's whistle figure, real marble base and marble platform, choice of column size and color. Fast 1-2 day shipping.mqt-whistle-p-dmCoach, Whistle, Sportscustom-pagetrophies-coach1trophies498552-313633.4TrophiesSchool1Our coach / whistle trophies feature a real slant-front white marble base and free personalization. Significant quantity discounts available. Fast 1-2 shipping.mqt-whistle-p-ncCoach, Whistle, Sports11Comprehensive guide for coaches on documenting athlete sportsmanship throughout the season. Learn simple systems for tracking sportsmanship and character moments.youth-soccer-coaching-guidet-ball-coaching-guideyouth-basketball-coaching-guidepee-wee-football-coaching-guidek6-teachers-classroom-guideyouth-baseball-coaching-guidesoccer-awards-guidechess-awards-guidescience-fair-awardsbasketball-awards-guidevolleyball-awards-guidetennis-award-ideashunting-award-ideasreading-award-ideasswimming-awards-guidephotography-awards-ideasmusic-awards-ideascooking-award-ideaswrestling-award-ideassoftball-awards-guidedrama-awards-ideastrack-awards-ideashonor-roll-awards-ideasdance-awards-ideasmath-award-ideascitizenship-award-ideasspelling-awards-ideasmotivation-awards-recognition-strategiesbaseball-award-ideas11Discover practical coaching and teaching guides from TrophyCentral with tips and tools to help educators and coaches inspire, motivate, and lead effectively.custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these quality Coast Guard Auxiliary Inserts (Litho) at TrophyCentral. Each Coast Guard Auxiliary Insert can be used to create a unique plaque, medal or trophy.495891Military, Hero, Coast Guard
custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality Coast Guard Inserts at TrophyCentral. Each Coast Guard Insert can be used to create a unique plaque, medal or trophy.51921Military, Hero, Coast Guard
custom-pageglass-crystal-awards1"10 business days" "Aliquippa, PA" "UPS"general1500110-1410.451236.45Glass AmericaCrystal Awards1:22%,5:33%Cobalt Iceberg Awards from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.custom-pageplaques1plaques498552-41JDSPlaques1Find this cobra plaque discounted at TrophyCentral. Our cobra mascot plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Mascotcustom-pagemascottrophies1"4-6 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511016.25Classic MedallicsTrophiesAcademic1:22%,5:24%,10:28%,50:32%"Mascot Awards"Buy this Cobra mascot trophy and other mascot awards at TrophyCentral.mt202711-30-2020Mascot11Stop writing "as captain of my team" essays. Learn 7 strategies to write authentic college and scholarship essays that reveal your real voice and stand out.custom-pagetrophies-baseballplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsSports, Hobby, Org, Livestock1:22%,50:30%,100:33%,500:47%"Baseball Awards" "Baseball Pins" "Baseball Lapel Pins"Color Baseball Lapel Pin. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.ec0607-20-2014Baseball / T-Ball, Sportscustom-pagetrophies-baseball12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Baseball Medals"Color Medal (2 3/16 Inch) Baseball Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.tm9971gBaseball / T-Ball, Sports
custom-pagetrophies-bowling12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Bowling Awards" "Bowling Medals"Your athletes will love these colorful Mylar Bowling Medals from TrophyCentral. Each Bowling medal includes a neck ribbon!tm9973gBowling
custom-pageembossed-seals1500embossed-seals"1-3 business days" "Columbia, South Carolina" "UPS (FedEx available on request)"certificates290631-31 2 3 230.454000200.45Certificate SourceSealsEmbosser Seals1:14%Find these color certificate seals discounted at TrophyCentral. Choose from red, blue, green, silver, gold and bronze. Fast shipping!embossersealscustom-pagetrophies-cheerleading-spirit12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Cheerleading Awards" "Cheerleading Medals"Your athletes will love these colorful Mylar Cheerleading (Stars) Medals from TrophyCentral. Each Cheerleading medal includes a neck ribbon!tm9918gSee more greatin a variety of styles and sizes.cheerleadingmedalsCheerleading, Sports
custom-pagetrophies-cheerleading-spirit12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Cheerleading Awards" "Cheerleading Medals"Your athletes will love these colorful Mylar Cheerleading Medals from TrophyCentral. Each Cheerleading medal includes a neck ribbon!tm9974gCheerleading, Sports
custom-pagetrophies-ice-hockey12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Hockey Awards" "Hockey Medals" "Field Hockey Medals"Your athletes will love these colorful Mylar Field Hockey Medals from TrophyCentral. Each Field Hockey medal includes a neck ribbon!tm9978gField Hockey, Sports
custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality Color Guard Male Inserts at TrophyCentral. Each Color Guard Male Insert can be used to create a unique plaque, medal or trophy.512821Military, Hero
custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality Color Guard Inserts at TrophyCentral. Each Color Guard Insert can be used to create a unique plaque, medal or trophy.512941Military, Hero
custom-pagetrophies-ice-hockey12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
trophies105503-60.37115021.37Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Hockey Awards"Your athletes will love these colorful Mylar Hockey Medals from TrophyCentral. Each Hockey medal includes a neck ribbon!tm9983gHockey, Sports
custom-pagetrophies-karate-martial-arts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Karate Awards" "Karate Medals"Your athletes will love these colorful Mylar Color Karate Medals from TrophyCentral. Each Color Karate Medals medal includes a neck ribbon!tm9985gKarate / Martial Arts, Sports
1award-medals1Shop Color Medals in gold, silver, bronze, and more vibrant finishes. Perfect for sports, schools, and events. Fast shipping and custom engraving available.Color Medals are a fun and versatile way to recognize achievement of all kinds. From local sports leagues to national events, these medals deliver the excitement of a traditional award with an eye-catching finish that recipients will treasure. Our collection makes it easy to find the right style for your needs, with options that include custom ribbons and personalized engraving. Browse our full selection today and discover why Color Medals are a popular choice within our Award Medals category.Color Medals12-3 business days
With engraving:
4-6 business days "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
105503-6115016.5award-medals1Find these quality 2-1/2 inch colorful medals at TrophyCentral. Medals include a free neck or drape ribbon and choice of gold, silver, or bronze finish.1me-medals-all
custom-pagetrophies-darts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
trophies105503-60.37115021.37Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Darts Medals"Your athletes will love these colorful Mylar Darts Medals from TrophyCentral. Each Darts medal includes a neck ribbon!tm9976gDarts
custom-pagequickshiptrophies-bass12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
trophies105503-60.37115021.37Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Fishing Awards" "Fishing Medals"Your athletes will love these colorful Mylar Fishing Medals from TrophyCentral. Each Fishing medal includes a neck ribbon!tm9979gFishing, Sports
custom-pagetrophies-football12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Football Awards" "Football Medals"Color Medals (2 3/16 Inch) - Football. Ideal for leagues, schools, and tournaments. Fast shipping.tm9977gReturn to the section for other great styles and sizes.footballmedalsFootball, Sports
custom-pageracing-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.371 2 3 4 5 6 7 8 9115021.37Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Car Racing Awards" "Racing Awards"Your athletes will love these colorful Mylar Racing Medals from TrophyCentral. Each Racing medal includes a neck ribbon!tm9913g
custom-pagetrophies-soccer12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.371 2 3 4 5 6 7 8 9115021.37Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Soccer Awards" "Soccer Medals"Color Medals (2 3/16 Inch) - Soccer. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.tm9987gSoccer, Sports
custom-pagetrophies-tennis12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.371 2 3 4 5 6 7 8 9115021.37Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Tennis Awards" "Tennis Medals"Your athletes will love these colorful Mylar Tennis Medals from TrophyCentral. Each Tennis medal includes a neck ribbon!tm9991gTennis, Sports
custom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.371 2 3 4 5 6 7 8 9115021.37Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Track Medals"Your athletes will love these colorful Mylar Track Medals from TrophyCentral. Each Track Medals medal includes a neck ribbon!tm9992g
custom-pageplace-trophies12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130042.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%Shop for 1st Place Medals at TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant. Fast 1-2 Day Shipping!tm9955gReturn to thesection for additional sizes and styles.place-medals02-28-2019Sports, Academic, General, Torch, Achievement, 1st / 2nd / 3rd / Etc.
custom-pagenoindexed-items12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-30.7530042.75Medals1Shop for 1st Place Medals (and 2nd through 6th) from TrophyCentral. Fast 1-2 Day Shipping on Place Medals and Awards.tm-series-medals1st / 2nd / 3rd Place, Torch
custom-pageplace-trophies12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130042.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%Shop for 2nd Place Medals at TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant. Fast 1-2 Day Shipping!tm9956g02-28-2019Sports, Academic, General, Torch, Achievement, 1st / 2nd / 3rd / Etc.
custom-pageplace-trophies12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130042.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%Shop for 3rd Place Medals at TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant. Fast 1-2 Day Shipping!tm9957gSports, Academic, General, Torch, Achievement, 1st / 2nd / 3rd / Etc.
custom-pageplace-trophies12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130042.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%Shop for 4th Place Medals at TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant. Fast 1-2 Day Shipping!tm9958gSports, Academic, General, Torch, Achievement, 1st / 2nd / 3rd / Etc.
custom-pageplace-trophies12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130042.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%Shop for 5th Place Medals at TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant. Fast 1-2 Day Shipping!tm9959gSports, Academic, General, Torch, Achievement, 1st / 2nd / 3rd / Etc.
custom-pageplace-trophies12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130042.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%Shop for 6th Place Medals at TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant. Fast 1-2 Day Shipping!tm9960gSports, Academic, General, Torch, Achievement, 1st / 2nd / 3rd / Etc.
11Find a great selection of Color Plaques in a variety of finishes. Each color plaque features your design with custom engraving.Custom Full Color Plaques TrophyCentral has an industry-leading selection to meet all of your needs. Plaques on this page feature a sublimated color logo. Choose from cherry, black and solid walnut finishes.

Shop with Ease at TrophyCentral!

Our experts in New York, Michigan, and online have been providing help and guidance since 1999! ]]>
custom-pagesports-inserts1105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Color Soccer Litho Medal Insert. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.498170Soccer, Sportscustom-pagetrophies-softball12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.371 2 3 4 5 6 7 8 9115021.37Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Softball Awards" "Softball Medals"Your athletes will love these colorful Mylar Softball Medals from TrophyCentral. Each Softball medal includes a neck ribbon!tm9988gSoftball, Sports
custom-pagetrophies-swimming-diving12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.371 2 3 4 5 6 7 8 9115021.37Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Swimming Awards"Your athletes will love these colorful Mylar Medals with a Swimming Design from TrophyCentral. Each medal includes a neck ribbon!Swimming / Diving, Sports
custom-pagetrophies-t-ball12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.371 2 3 4 5 6 7 8 9115021.37Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Baseball Awards" "T-Ball Awards" "T-Ball Medals"Your athletes will love these colorful Mylar T-Ball Medals from TrophyCentral. Each T-Ball medal includes a neck ribbon!tm9972gBaseball / T-Ball, Sports
custom-pagetrophies-volleyball12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.371 2 3 4 5 6 7 8 9115021.37Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Volleyball Awards" "Volleyball Medals"Your athletes will love these colorful Mylar Volleyball Medals from TrophyCentral. Each Volleyball medal includes a neck ribbon!tm9995gVolleyball, Sports
custom-pagetrophies-wrestling12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.371 2 3 4 5 6 7 8 9115021.37Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Wrestling Awards" "Wresling Medals"Your athletes will love these colorful Mylar Wrestling Medals from TrophyCentral. Each Wrestling medal includes a neck ribbon!tm9996gWrestling, Sports
custom-pageawardcertificates11certificates290631-31 2 3 230.45100020.45Certificate SourceCertificatesAward Certificates1:22%,25:24%,100:40%,500:50%Bright, colorful printed Appreciation certificate from TrophyCentral. Measures 8 1/2 x 11 inches - a cheerful way to recognize students or team members.912Generalcustom-pageawardcertificates11certificates290631-31 2 3 230.45100020.45Certificate SourceCertificatesAward Certificates1:22%,25:24%,100:40%,500:50%"Art Awards"Find these Colorful Art Award Certificates discounted at TrophyCentral. Each Art Certificate measures 8 1/2" x 11".930Art, AcademicArt Certificatecustom-pageart-trophies1medals105503-6.5115014Classic MedallicsMedals11:22%,25:24%,50:30%,100:36%,500:42%Your students will love these colorful Mylar Artist's Medals from TrophyCentral. Each medal includes a free neck ribbon!Art, Academiccustom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Colorful Baseball Medal Insert. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.497658Baseball / T-Ball, Sports
custom-pageawardcertificates11certificates290631-31 2 3 230.45100020.45Certificate SourceCertificatesAward Certificates1:22%,25:24%,100:40%,500:50%Find these Certificates of Award discounted at TrophyCentral. Each Certificate of Award measures 8 1/2" x 11".907Generalcustom-pagetrophies-honor-roll-society102-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
"PT1=Medals" "PC11=105503-60.37115021.37Classic MedallicsMedalsAcademic1:22%,25:24%,50:30%,100:36%,500:42%"Honor Roll" "Honor Roll Medals" "Honor Roll Trophies" "School Medals" "School Award Medals" "Scholastic Medals" "Scholastic Award Medals" "Academic Medals" "Academic Award Medals" "Medals, School" "Honor Student Awards"Your students will love these colorful Mylar Honor Roll Medals from TrophyCentral. Each Honor Roll medal includes a neck ribbon!honorrollmedalsHonor Roll, Academic
custom-pagehonorrollpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:22%,50:28%,100:32%,500:42%"Honor Roll" "Honor Roll Pins" "Honor Roll Trophies" "School Pins"Find these colorful Honor Roll pins at TrophyCentral. Each AP Series Honor Roll pin includes a clutch back. Bulk discounts.ap64Honor Roll, Academiccustom-pagetrophies-honor-roll-society102-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic MedallicsMedalsAcademic1:22%,25:24%,50:30%,100:36%,500:42%"Honor Roll" "Honor Roll Medals" "Honor Roll Trophies" "School Medals" "School Award Medals" "Scholastic Medals" "Scholastic Award Medals" "Academic Medals" "Academic Award Medals" "Medals, School" "Honor Student Awards"Your students will love these colorful Mylar Honor Student Medals from TrophyCentral. Each Honor Student medal includes a neck ribbon!tm9720Honor Roll, Academic
custom-pagemusic-award-certificates17034 803musiccertificates290631-31 2 3 230.45100020.45Certificate SourceCertificatesAward Certificates1:22%,25:24%,100:40%,500:50%"Music Awards"Find this musical notes award certificate discounted at TrophyCentral. This colorful musical notes certificate is beautifully printed and measures 11 x 8 1/2 inches.910Music / Band / ChorusMusic Certificatecustom-pagequickshiptrophies-spelling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453633.4Quick TrophyTrophiesAcademic1:14%,50:30%"Spelling Awards"Resin Spelling Bee Trophies from TrophyCentral. Free Engraving and Quick 1-2 Day Shipping on Trophies!Spellingcustom-pagescience-award-certificates15"1-3 business days" "Columbia, South Carolina; Marquette, Michigan" "UPS (FedEx available on request)"certificates290631-21 2 3 230.45100020.45Certificate SourceCertificatesAward Certificates1:22%,50:38%,100:42%"Science Awards"Find these science award certificates discounted at TrophyCentral. Each Science certificate measures 8 1/2 x 11 inches and typically ships in 1-2 days.7029Sciencecustom-pagescienceawards1"1 - 2 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-21 2 3 230.451224.45Certificate SourceStickersStickers1:22%,3:24%bstick6Sciencecustom-pagetrophies-softballplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsSports, Hobby, Org, Livestock1:22%,50:30%,100:33%,500:47%"Softball Awards" "Softball Pins" "Softball Lapel Pins"Find this high-quality enameled softball lapel pin discounted at TrophyCentral. Fast turnaround - just 1-2 business days.ec0405-13-2019Softball, Sportscustom-pageawardcertificates11certificates290631-31 2 3 230.45100020.45Certificate SourceCertificatesAward Certificates1:22%,25:24%,100:40%,500:50%"Spelling Bee Award" "Spelling Bee Awards" "Awards, Spelling Bee" "Spelling Bee Trophies" "Spelling Bee Trophy" "Spelling Awards" "Spelling Award" "Spelling Trophies" "Spelling Bee Medals" "Spelling Medals"Find this spelling certificate and other awards discounted at TrophyCentral. Spelling and spelling bee certificates are beautifully printed and measure 11 x 8 1/2 inches.913SpellingSpelling Certificatecustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Colossus display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 60"W x 20"D. Model: 2605-pb-gd.2605-wb-gdFloor-Standingcustom-pagedisplaycases11display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Colossus display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 72"W x 20"D. Model: 2606-pb-gd.2606-pb-gdFloor-Standingcustom-pagedisplaycases11display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Colossus display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 60"W x 20"D. Model: 2605-pb-bz.2605-pb-bzFloor-Standingcustom-pagedisplaycases11display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Colossus display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 72"W x 20"D. Model: 2606-pb-bz.2606-pb-bzFloor-Standingcustom-pagedisplaycases11display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Colossus display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 60"W x 20"D. Model: 2605-pb-sn.2605-pb-snFloor-Standingcustom-pagedisplaycases11display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Colossus display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 72"W x 20"D. Model: 2606-pb-sn.2606-pb-snFloor-Standingcustom-pagedisplaycases11display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Colossus display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 60"W x 20"D. Model: 2605-wb-gd.2605-wb-gdFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Colossus display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 72"W x 20"D. Model: 2606-wb-gd.2606-pb-gdFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Colossus display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 60"W x 20"D. Model: 2605-wb-bz.2605-pb-bzFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Colossus display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 72"W x 20"D. Model: 2606-wb-bz.2606-pb-bzFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Colossus display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 60"W x 20"D. Model: 2605-wb-sn.2605-pb-snFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Colossus display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 66"H x 72"W x 20"D. Model: 2606-wb-sn.2606-pb-snFloor-Standing11Find Colossus Series trophy cases discounted at TrophyCentral. These popular school trophy cases are made in the USA by Waddell.displaycases1floor-standing-challengercustom-pagetrophies-general1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Blank single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - BlankBlank, Generalcustom-pagetrophies1trophies498551-310.45TrophyCentralTrophies1:14%,10:18%,50:24%,100:28%This popular single column trophy from TrophyCentral features a choice of column color, column size, a marble base and free trophy engraving. Fast 1-2 day shipping.custom-pagetrophies-funny-horses-rear1trophies498553-Feb10.45Trophy CentralTrophies1This popular comic turkey award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.Funny / Gagcustom-pagetrophies-funny-horses-rear1trophies498553-Feb10.45Trophy CentralTrophies1Find this popular comic turkey figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!Funny / Gagcustom-pagetrophies-funny-horses-rear1trophies498553-Feb1Trophy CentralTrophies1Find these comic turkey budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Funny / Gagcustom-pagetrophies-funny-horses-rear1trophies498553-Feb0.45Trophy CentralTrophies1Find this budget comic turkey award trophy discounted at Trophy Central. Features a real marble base and plastic comic turkey figure. Engraving is free. Fast 1-2 day shipping.Funny / Gagcustom-pagetrophies-funny-horses-rear1trophies498553-Feb10.75Trophy CentralTrophies1Find these fabulous two-tier comic turkey three-column trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!Funny / Gagcustom-pagetrophies-funny-horses-rear1trophies498553-Feb10.45Trophy CentralTrophies1These quick-ship trophies from TrophyCentral feature a comic turkey figure, real marble base and marble trophy figure platform, choice of column size and color.Funny / Gagcustom-pagetrophies-funny-horses-rear1trophies498553-Feb10.45Trophy CentralTrophies1Our comic turkey participation trophies feature a real slant-front white marble base and free personalization. Significant quantity discounts available.Funny / Gagcustom-pagetrophies-funny-horses-rear1perpetual trophies498553-Feb11.41Trophy CentralTrophies1Find this Perpetual Comic Turkey Trophy Discounted at TrophyCentral. Each Trophy has enough room for 32 names. Ships in just 1-2 days.Funny / Gagcustom-pagenew-trophies-21trophies498551-310.452429Trophies1Find our Comic Turkey star column trophy discounted at TrophyCentral. Features a real marble base, 6 inch gold star-shaped column, free engraving and fast shipping.comic-turkey-star-column-trophy11Ghent is introducing a new series of colors for their Aria Glass Board Series. Check back for this new selection!custom-pagetrophies-golf1"10 business days" "Aliquippa, PA" "UPS"trophies1500110-1410.451236.45Glass AmericaCrystal AwardsSports, Hobby, Org, Livestock1:22%,10:25%"Hole-in-One Awards"Commander Crystal Golf Driver Trophy (2 Sizes). Ideal for leagues, schools, and tournaments. Fast shipping.Golf, Sportscustom-pagecorporatepins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsBusiness1:30%,50:34%,100:39%,500:43%"Employee Lapel Pins" "Corporate Lapel Pins"Find these Commitment to Excellence pins discounted at TrophyCentral. Each Commitment to Excellence lapel pin features a high-quality enameled finish and clutch-pin back.cotoex10-12-2010Business, Generalcustom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these high-quality Commitment To Safety Inserts at TrophyCentral. Each Commitment To Safety Insert can be used to create a unique plaque, medal or trophy.518714General
11Avoid these 10 essay mistakes students make on scholarship applications. See before-and-after examples showing exactly how to fix each error.custom-pagefreeawardcertificates1"Download Only"free-appreciation4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Community Caring template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Community-Caring-Certificatecommunity-caring-freeCommunity, Thank You, Appreciationcustom-pagefreeawardcertificates1"Download Only"free-appreciation49855011TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Community Service Award template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Community-Service-Award-Certificatecommunity-serviceCommunity, Thank You, Appreciationcustom-pageacademic-general-medals102-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic MedallicsMedalsAcademic1:22%,25:24%,50:30%,100:36%,500:42%"School Medals" "School Award Medals" "Scholastic Medals" "Scholastic Award Medals" "Academic Medals" "Academic Award Medals" "Medals, School"Your students will love these colorful Mylar Community Service Medals from TrophyCentral. Each Community Service medal includes a neck ribbon!tm9841General, Community Service, Thank You, Volunteer
custom-pagetrophies-volunteer1plaques498552-41JDSPlaques1Find this community service plaque discounted at TrophyCentral. Our community service plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Service11Plan your youth soccer trophy budget with our complete cost breakdown. Includes per-player costs, money-saving tips, and sample budgets for teams of all sizes.11Master golf tournament planning with our comprehensive guide covering budgeting, venue selection, committee formation, contest management, and award ceremonies. Includes expert trophy selection advice.11Expert guide to selecting the perfect diploma covers for graduation ceremonies. Compare padded vs unpadded, personalized options, acetate corners, and professional presentation solutions.1trophy-award-guides1Expert guide to buying the perfect trophy. Learn about acrylic vs crystal awards, resin vs column trophies, sizing tips, and material comparisons from trophy professionals.trophy-buying-guide11Expert answers to common youth baseball trophy questions. Learn about sizing, budgets, engraving, T-ball vs baseball awards, and participation vs MVP trophies.11Master the art of organizing successful cooking competitions with our comprehensive guide. Learn venue selection, food safety regulations, judging systems, and event execution for chili cook-offs, BBQ contests, and culinary events.custom-pageawardcertificates11certificates290631-31 2 3 230.45100020.45Certificate SourceCertificatesAward Certificates1:22%,25:24%,100:40%,500:50%Find These Printed Computer Award certificates at TrophyCentral. Each Computer Award certificate measures 11 x 8 1/2 inches.935Computercustom-pageawardcertificates115"1-3 business days" "Columbia, South Carolina; Marquette, Michigan" "UPS (FedEx available on request)"certificates290631-21 2 3 230.45100020.45Certificate SourceCertificatesAward Certificates1:22%,50:38%,100:42%Find these computer certificates discounted at TrophyCentral. Each Computer certificate measures 8 1/2 x 11 inches and typically ships in 1-2 days.7035Computercustom-pagefreeawardcertificates1"Download Only"free-appreciation4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Congratulations template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Congratulations-Certificatecongratulations-freeCongratulations, Appreciationcustom-pagemedallion-inserts-general-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these high-quality Congratulations Inserts at TrophyCentral. Each Congratulations Insert can be used to create a unique plaque, medal or trophy.518158General, Congratulations
custom-pagemedallion-inserts-occupational-subjects12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Construction Inserts (Litho) at TrophyCentral. Each Construction Insert can be used to create a unique plaque, medal or trophy.507249Occupations
custom-page11Need Help? Contact TrophyCentral's Top-Rated Customer Sales Representatives!custom-pagepacofbacnum11465715-71 260.455020.45Tower RibbonRibbons1:14%,5:22%custom-pagebadgeribbonsholders1"7-10 business days from receipt of camera-ready artwork" "City of Industry, CA" "UPS (FedEx available on request)"917457-10146022BNRibbonsBadge Holders1nw-3613blkcustom-pagebadgeribbonsholders1"7-10 business days from receipt of camera-ready artwork" "City of Industry, CA" "UPS (FedEx available on request)"917457-10146022BNRibbonsBadge Holders1nw-3613rdcustom-pagecooking-certificateschili-pot-trophyculinary-part-iculinary-single-iculinary-champ-iculinary-e-part-iculinary-e-single-ibaking-part-ibaking-single-ibaking-champ-ibaking-e-part-ibaking-e-single-icup-cooking-scb-icup-baking-scb-icup-baking-incup-culinary-inperpetual-insert-cookingcooking-cup-place-column-trophy-icooking-cup-place-trophy-iculinary-mgculinary-mcculinary-mc-prculinary-jigfculinary-jibfculinary-jisfbaking-jigfbaking-jisfbaking-jibfbaking-mcbaking-mc-prculinary-plaque-iculinary-award-plaquebaking-plaque-ie91351trophies1Shop cooking trophies, medals and awards to celebrate chefs, bakers, and culinary students alike. Free personalization and fast shipping at TrophyCentral.

Custom Cooking Trophies and Culinary Awards - Honor Kitchen Champions

Cooking trophies celebrate culinary excellence from backyard BBQ showdowns to professional chef competitions. Whether crowning the reigning chili champion, honoring the baker whose sourdough achieved Instagram fame, or recognizing the grill master who finally perfected brisket after years of trial and error, these awards transform kitchen victories into lasting recognition. Featuring chef hat figurines, crossed utensil designs, decorative mixing bowls, and customizable inserts for specific specialties like baking or grilling, cooking trophies range from budget-friendly 6-inch participation awards for cooking class students to impressive 18-inch championship columns for contest grand champions. Available with free engraving to immortalize winning dishes like World's Best Apple Pie or Three-Alarm Chili Champion, these trophies serve church cook-offs, county fair baking competitions, corporate team-building events, culinary school graduations, and neighborhood grilling contests where bragging rights last until next year's rematch.

Cooking Award Ideas for Your Competition or Program

Cooking combines art, science, and passion on every plate. From the pastry perfectionist to the grill master, here are award ideas that recognize culinary skill and creativity at every level - plus engraving examples for each.

Technical Excellence Awards

  • Knife Skills Master - Brunoise, julienne, chiffonade - executes every cut with precision. Speed and safety combined.
  • Temperature Control Expert - Perfect doneness every time. Never overcooks, never undercooks, always just right.
  • Sauce Specialist - Mother sauces are child's play. Creates emulsions that never break.

Cuisine and Creative Awards

  • Pastry Prodigy - Croissants that shatter perfectly. Cakes that defy gravity. Precision meets artistry.
  • Grill Master Supreme - Perfect grill marks every time. Knows when to flip by instinct alone.
  • International Cuisine Champion - Authentic flavors from around the world. Passport not required for this culinary journey.
  • Plating Picasso - Every dish is presentation-worthy. Turns food into edible art.
  • Flavor Innovator - Unexpected combinations that actually work. Pushes boundaries while respecting tradition.
  • Menu Maestro - Creates balanced menus that tell a story. Every course complements the next.

Leadership, Growth, and Special Recognition

  • Sous Chef Excellence - Right hand to everyone. Keeps the kitchen running like clockwork.
  • Team Player Award - Always helps with prep and cleanup. Makes kitchen harmony possible.
  • Safety Supervisor - Zero accidents on their watch. Makes food safety look effortless.
  • Most Improved Chef - From burning water to creating masterpieces. Dedication that inspires everyone.
  • Rising Star Award - First-year student with professional instincts. Natural talent meets hard work.
  • Sustainability Champion - Zero waste warrior. Makes delicious food while respecting every ingredient.

Engraving Examples

  • Competition Winner: IRON CHEF CHAMPION / [Student Name] / Culinary Competition 2025
  • Specialty Award: PASTRY CHEF OF THE YEAR / [Name] - Class of 2025
  • Program Award: OUTSTANDING CULINARY STUDENT / [Student Name] / [School Name] 2024-25

Great cooking is not just about following recipes - it is about understanding ingredients, respecting tradition, and adding your own creative touch. Recognize the student who helps others, the one who never wastes ingredients, and the cook who turns mistakes into new discoveries. Kitchen attitude matters as much as aptitude.

Frequently Asked Questions About Cooking Trophies

What trophy sizes work best for different cooking competitions?

Friendly neighborhood cook-offs and church fundraisers succeed with 8-inch to 10-inch single column trophies offering meaningful recognition without breaking volunteer-run budgets. County fair competitions and regional BBQ contests benefit from 12-inch to 15-inch trophies with substantial presence worthy of judges traveling distances to evaluate entries. Championship cook-offs, professional culinary competitions, and finale events demand 16-inch to 20-inch multi-column trophies or elegant cup designs reflecting elite status. Chili cook-offs embrace specialty pot-shaped trophies regardless of size because theme matters as much as height. Smart organizers use trophy sizing to create clear hierarchies with smaller awards for category winners and reserve the largest statement pieces for overall grand champions and people's choice awards.

Should cooking trophy engraving include the winning dish name?

Absolutely - Chocolate Decadence Cake Grand Champion tells a better story than First Place Baking. Winning dish names transform generic awards into conversation starters and memory triggers decades later. Examples: Karen Mitchell, Best Ribs, Sweet and Smoky Perfection, BBQ Festival 2025 or David Chen, Chili Champion, Dragon Fire Recipe, Annual Cook-Off October 2025. Category-specific contests benefit from descriptive titles like Best Chocolate Dessert, Crowd Favorite Appetizer, or Spiciest Salsa. Space-limited engravings prioritize winner name, category, event name, and date, adding dish names when room permits.

Do cooking competitions need separate trophies for different categories or combined awards?

Small events with limited budgets succeed using 3-5 combined trophies for overall winners plus category ribbons or certificates for specialty recognition, maximizing impact while controlling costs. Mid-size competitions benefit from category-specific trophies for each discipline like Best Appetizer, Best Entree, Best Dessert, plus an impressive grand champion trophy distinguishing the overall winner from category victors. Large professional competitions justify comprehensive trophy programs with first through third place awards in every category, special recognition for creativity and presentation, plus a prestigious best of show trophy. The right approach balances meaningful recognition against budget realities - passionate cooks treasure any acknowledgment of their culinary skills, whether humble or elaborate.

If you need more information before deciding, see our expert resource section:

Be sure to also browse our complete trophies and awards collection to explore additional designs for every occasion.

]]>
trophiesCooking / Culinary / Baking
1award-medals1Find culinary medals discounted at TrophyCentral. Each culinary, baking and cooking medal features a free neck ribbon. Optional engraving on medal back.cooking-culinary-medals

Cooking Medals & Culinary Recognition - Wearable Kitchen Victory

Cooking medals provide immediate wearable recognition perfect for competitions where winners proudly display their achievements during award ceremonies and victory photos. These portable awards feature embossed chef designs, crossed whisk and spatula imagery, decorative plate motifs, and culinary-themed medallions in classic gold, silver, and bronze finishes signifying placement hierarchy. Available in economical 1.5-inch economy sizes ideal for large festivals recognizing hundreds of participants to impressive 3-inch premium medallions for distinguished grand champions, cooking medals include neck ribbons in customizable colors matching event branding plus complimentary back engraving for winner names, dish categories, and competition dates. Perfect for multi-category competitions requiring dozens of placement awards, traveling cook-off circuits where portability matters, family-friendly festivals where children wear medals throughout the event, culinary school recognition ceremonies, and any competition where immediate on-site recognition creates memorable moments. Medals excel when budgets demand recognizing numerous winners affordably or when wearable awards generate better photos than other award types.

Expand your recognition program: Explore Cooking Trophies for display awards. Learn more: Complete Guide to Cooking Competitions and Trophy Award Guides.

Frequently Asked Questions About Cooking Medals

When should cooking competitions use medals as awards?

Medals excel for large-scale festivals with 50 plus competitors across multiple categories where affordability enables comprehensive recognition without budget strain. They shine during outdoor BBQ competitions and street food festivals where wearable awards create instant visual identification of winners throughout crowded venues.

What medal sizes work best for different competition levels?

Participant medals and honorable mentions succeed with 1.5-inch economy medallions providing affordable recognition ensuring every competitor leaves with tangible acknowledgment of their efforts and courage entering the competition. Category finalists and third through first place winners deserve 2-inch standard medals offering substantial presence without premium pricing, balancing visual impact against budget realities when recognizing dozens of placements. Grand champions, people's choice winners, and best of show honorees warrant 2.5-3 inch premium medals with impressive weight and detailed embossing befitting top-tier achievement. Gold medals traditionally signify first place, silver for second, bronze for third, creating instantly recognizable visual hierarchy. Ribbon color coordination with medal finishes enhances presentation, using red ribbons for first place regardless of medal color or matching ribbon hues to event branding for cohesive aesthetic.

What information should cooking medal engraving include?

Essential engraving includes winner name, specific category or placement, competition name, and event date, keeping text concise given limited back-of-medal space. Examples: Maria Santos, 1st Place Desserts, County Fair Cook-Off 2025 or Robert Lee, Chili Competition Winner, BBQ Festival October 2025. Category-specific medals benefit from descriptive titles like Best Appetizer, Spiciest Entry, or People's Choice Award adding context beyond simple placement numbers. Abbreviated dish names like Chocolate Soufle or Texas Brisket add personality when space permits. Avoid overcrowding text which reduces readability and cheapens appearance. Multi-line layouts work better than cramming information horizontally. Some organizers pre-engrave competition name and date on all medals, adding winner-specific customization after results finalized, streamlining medal distribution during hectic award ceremonies while maintaining personalization that transforms medals from generic prizes into cherished keepsakes.

If you need more information before deciding, see our expert resource section:
]]>
trophies-cooking-culinary
custom-pagetrophies-cooking-culinary1trophies498551-310.452429Trophies1Find this popular Cooking trophy discounted at TrophyCentral. Features a real marble base, stylish 4-inch gold cup, free engraving and fast shipping.cooking-cup-place-trophy-icustom-pagefreeawardcertificates1"Download Only"free-cooking4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our cooking template (female figure) is free and designed exclusively for TrophyCentral. Cooking templates and award certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.cooking-template-femalecooking-female-521Cooking / Culinarycustom-pagefreeawardcertificates1"Download Only"free-cooking4985501Trophy CentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Free Cooking Award certificate featuring a male chef design, from TrophyCentral. Measures 6" x 4" - download and print instantly.culinary-template-maleculinary-male-521Cooking / Culinarycustom-pagefreeawardcertificates1"Download Only"free-cooking4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our cooking template (male figure) is free and designed exclusively for TrophyCentral. Cooking templates measure 11 x 8 1/2 inches and can be easily downloaded and printed.cooking-template-malecooking-male-521Cooking / Culinarycustom-pagefreeawardcertificates1trophies-cooking-culinary"Download Only"certificates4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Free printable Cooking Award certificate template from TrophyCentral. Measures 11 x 8 1/2 inches - a fun way to recognize culinary talent.Free-Cooking-Award-Certificatecooking-award-freeCooking / Culinarycoaching-teaching-guides1trophies-cooking-culinary1Explore 15+ unique cooking award ideas with trophy engraving templates. From Knife Skills Master to Pastry Prodigy, celebrate your culinary students' achievements. Perfect for competitions and graduations.custom-pagecooking-pins1plasticpinboxvelapinbox5lapel pins105502-30.31150030.3Classic MedallicsLapel PinsBusiness1:30%,50:32%,100:35%,500:39%Find these BR Series Cooking Pins at TrophyCentral. Ships in Just 1-2 Business Days. Quantity Discounts are also Available!cocuarlapin06-30-2012Cooking / Culinarycustom-pagetrophies-cornhole1trophies498551-310.452429Trophies1Find this popular Cornhole trophy discounted at TrophyCentral. Features a real marble base, stylish 4-inch gold cup, free engraving and fast shipping.cornhole-cup-place-trophycustom-pagetrophies-cornhole1trophies498551-310.452429Trophies1Find this popular Cornhole place trim insert trophy discounted at TrophyCentral. Features a real marble base, stylish 4-inch gold cup, free engraving and fast shipping.cornhole-cup-place-trophy-icustom-pagetrophies-cornhole1trophies498552-310.451622.85TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find this popular cornhole figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at trophyCentral. Ships in a fast 1-2 days!Trophies With Place Trim (1st, 2nd, or 3rd) - CornholeCornholecustom-pagetrophies-cornhole20medals498554-Feb0.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful Cornhole 2" Epoxy-covered insert decal discounted at TrophyCentral. Fast 1-2 day shipping.Cornholecustom-pagetrophies-cornhole1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Cornhole Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Cornholecustom-pagetrophies-cornhole1trophies498552-310.52421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find these cornhole budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Single Column Budget Trophy - CornholeCornholecustom-pagetrophies-cornhole1trophies498552-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find this budget cornhole award trophy discounted at Trophy Central. Features a real marble base and plastic cornhole figure. Engraving is free. Fast 1-2 day shipping.Budget Cornhole TrophyCornholecustom-pagetrophies-cornhole1trophies498552-41143633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find this champion's cup cornhole trophy discounted at Trophy Central. Features a real marble base and plastic cornhole topper. Engraving is free. Fast 1-2 day shipping.Budget Cornhole TrophyCornholecustom-pagetrophies-cornhole1trophies498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Cornhole insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-Cornhole-Insertcustom-pagetrophies-cornhole1trophies498552-310.75219TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find these fabulous two-tier cornhole three-column trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!Quick-Ship Two-Tier Trophies with Cornhole FigureCornholecustom-pagetrophies-cornhole1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Cornhole single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - CornholeCornholecustom-pagetrophies-cornhole1trophies498551-311821.06TrophyCentralTrophies1Cornholecustom-pagetrophies-cornhole1trophies498552-310.451623.65TrophyCentralTrophiesSports, Hobby, Org, Livestock1These quick-ship trophies from TrophyCentral feature a cornhole figure, a real marble base and a second marble platform and choice of column size and color.Double Platform Trophies in 3 Sizes - CornholeCornholecustom-pagetrophies-cornhole1trophies498551-310.71217.38Trophies1Cornholecustom-pagetrophies-cornhole1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Cornhole Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Cornholecustom-pagetrophies-cornhole1cornhole-medalsmedals498553-Feb0.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this colorful Cornhole insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.CornholeCornholecustom-pagetrophies-cornhole1medals498553-Feb0.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this Cornhole insert medal with a personalized front rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Cornholecustom-pageplaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these cornhole insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Cornhole11Find cornhole medals discounted at TrophyCentral. Each cornhole medal features a free ribbon. Fast 1-2 day shipping.Shop with Ease at TrophyCentral! Yes, we are an online trophy shop, but we have real people who would love to help you! Do you need help finding trophies, employee recognition or custom awards? Feel free to call our customer service experts in Michigan and New York.

Frequently Asked Questions (FAQ)

What types of cornhole medals do you offer?

We offer a variety of cornhole medals in gold, silver, and bronze finishes. Our designs feature classic cornhole board and bag imagery, making them perfect for tournaments, leagues, and casual backyard competitions.

Can I customize my cornhole medals?

Yes! Many of our cornhole medals include free engraving, allowing you to personalize each medal with player names, event titles, or a special message.

How fast do cornhole medals ship?

Most cornhole medals ship within 1-2 business days. Expedited shipping options are available if you need your medals in time for an upcoming tournament.

Do you offer bulk discounts for cornhole medals?

Yes! We offer bulk pricing for large orders. If you are organizing a cornhole tournament or league, contact us for a custom quote.

Do the cornhole medals come with ribbons?

Yes! Our cornhole medals come with a choice of ribbon colors.

Do you sell other cornhole awards?

Yes! In addition to cornhole medals, we offer cornhole trophies.

]]>
trophies-cornholeCornhole
custom-pagetrophies-cornhole1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our cornhole insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - CornholeCornholecustom-pagetrophies-cornhole1trophies498552-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Cornhole Participation Trophies feature a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Trophies - CornholeCornholecustom-pagetrophies-cornhole1perpetual trophies498552-411.41234TrophyCentralTrophies1Find this Perpetual Cornhole Trophy Discounted at TrophyCentral. Each Trophy has enough room for 32 names. Ships in just 1-2 days.Perpetual Series Trophy - CornholeCornholecustom-pageholographic-sports-plaques1plaques498552-41JDSPlaques1Find this Cornhole Plaque discounted at TrophyCentral. Our cornhole plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Cornholecustom-pagetrophies-cornhole1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Cornhole Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Cornholecustom-pagetrophies-cornhole1trophies498551-310.452429Trophies1Find our Cornhole star column trophy discounted at TrophyCentral. Features a real marble base, 6 inch gold star-shaped column, free engraving and fast shipping.cornhole-star-column-trophycustom-pagehorseshoescornhole-plaque-icornhole-cup-place-trophy-icornhole-cup-place-column-trophy-icornhole-nccornhole-sccornhole-dmcornhole-plcornhole-ttcornhole-perpcornhole-scbchamp-cup-cornholecornhole-part-icornhole-single-icornhole-champ-icornhole-e-part-icornhole-e-single-icup-cornhole-scb-icup-cornhole-inbdg-cornholecornhole-mccornhole-mc-prcornhole-jigfcornhole-jibfcornhole-jisfcornhole-cup-place-trophycornhole-cup-place-column-trophycornhole-star-column-trophy1trophies1Find a great selection of cornhole trophies at TrophyCentral. Each cornhole trophy includes free engraving. Cornhole medals feature a free ribbon.🏊‍♂️ Find Custom Cornhole Trophies and Awards With Ease!

Our cornhole trophies add a fun and competitive twist to this classic backyard game, turning casual matches into memorable events. Whether for local tournaments, company picnics, or friendly neighborhood showdowns, these trophies come in a range of sizes and designs - from traditional cups to plaques with an engraved cornhole design.

✅ Fast 1-2 day shipping on cornhole trophies and medals
✅ Low prices with large bulk discounts
✅ Reliable, top-rated service ]]>
trophies cornhole-medals
noindexed-items11Shop for Corporate Art Awards at TrophyCentral. Each Art Award Includes Free Engraving or Etching.custom-pageofficesigns11"9-12 business days" "Roanoke, Virginia" "UPS (FedEx available on request)"240169-1210.455013.45RoanokeOffice Signs1Find a great selection of custom corridor signs at TrophyCentral. Each corridor and hallway sign is made to order!custom-pagemascotpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:22%,50:30%,100:33%,500:47%"Mascot Awards" "Mascot Pins"Find these Cougar Lapel Pins and other colorful mascot pins at TrophyCentral. Fast 1-2 day shipping!em05Mascotcustom-pageplaques1plaques498552-41JDSPlaques1Find this cougar plaque discounted at TrophyCentral. Our cougar mascot plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Mascotcustom-pagemascotinserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsMascots1Buy these quality Cougars Mascot Medal Inserts at TrophyCentral. Each Cougars Insert can be used to create a unique plaque, medal or trophy.489921Mascot
custom-pagename-desk-signs11desblocnampl"2-3 business days" "Roanoke, Virginia" "UPS (FedEx available on request)"240169-1210.45157.95RoanokeOffice Signs1Shop for counter desk signs in a variety of shapes and sizes. Each counter desk sign is personalized with your text. Fast 1-2 day shipping.custom-pageofficesigns11"2-3 business days" "Roanoke, Virginia" "UPS (FedEx available on request)"240169-1210.456014.25RoanokeOffice Signs1Find Custom Counter Signs for discounted at TrophyCentral. Each Counter Sign includes free engraving!custom-pagecounty-fair-awards20498551-30.5100021TrophyCentralInsertsSports, Hobby, Org, Livestock1Find this colorful County Fair 2" Epoxy-covered insert discounted at TrophyCentral. Fast 1-2 day shipping.County Faircustom-pagecounty-fair-awards1498551-31.520033TrophyCentralMedalsSports, Hobby, Org, Livestock1Find these County Fair Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.County Faircustom-pagecounty-fair-awards1498551-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a County Fair insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-County Fair-Insertcustom-pagecounty-fair-awards1498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our County Fair single column insert trophy features a choice of column color, a marble base and free trophy engraving.County Faircustom-pagecounty-fair-awards1498551-31.520033TrophyCentralMedalsSports, Hobby, Org, Livestock1Find these County Fair Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.County Faircustom-pagecounty-fair-awards1498551-30.525035.5TrophyCentralMedalsSports, Hobby, Org, Livestock1Find this colorful County Fair insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.County Faircustom-pagecounty-fair-awards1498551-30.525035.5TrophyCentralMedalsSports, Hobby, Org, Livestock1Find this County Fair insert medal with a personalized front rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.County Faircustom-pagecounty-fair-awards1plaques498551-311.11623.5TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these county fair insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.County Faircustom-pagecounty-fair-awards1498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our county fair insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.County Faircustom-pagecounty-fair-awards1498551-31.520033TrophyCentralMedalsSports, Hobby, Org, Livestock1Find these County Fair Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.County Faircustom-pageaward-medalscounty-fair-plaque-icounty-fair-ei1trophies1

County Fair Trophies and Awards - Recognize Every Champion, Exhibitor, and Outstanding Achievement

County fair trophies and awards honor a tradition of agricultural excellence, community craftsmanship, and youth development that has defined rural American life for generations. From the youngest 4-H exhibitor showing their first market animal or garden project to experienced open class competitors presenting years of refined skill in sewing, canning, photography, and fine arts, quality fair awards give tangible recognition to the preparation, dedication, and pride behind every entry. Our county fair award collection spans trophies for grand champion and reserve grand champion livestock honors, department and division winner recognition across every fair class, special awards for outstanding exhibitor and most improved, and the buckles, plaques, and perpetual trophies that mark the most prestigious achievements within a fair's competitive structure. Medals with free neck ribbons provide affordable recognition for large participation classes and junior exhibitor programs where presenting every entrant with a wearable keepsake is as important as recognizing the top finishers. Printed award ribbons in traditional blue, red, and white along with rosette ribbons for champion and supreme champion honors complete a fair award program that honors every level of competitive achievement from participation through grand champion.

Frequently Asked Questions About County Fair Trophies and Awards

What award formats do county fairs and 4-H competitions typically use?

County fair and 4-H award programs traditionally use a combination of printed ribbons, rosette ribbons, medals, trophies, and plaques at different levels of the competitive hierarchy, with each format serving a specific recognition purpose within the overall program. Printed ribbons in blue for first, red for second, and white for third are the foundational recognition item in most fair classes, distributed across dozens or hundreds of entries across every department and division throughout the fair. Champion and reserve champion rosette ribbons recognize the top two animals or entries within each livestock class and many open class departments, providing a larger and more visually distinctive award than the standard placement ribbons. Grand champion and reserve grand champion rosette ribbons, typically in purple and purple with white respectively, are among the most prestigious awards in the entire fair and are presented to the single best entry across all classes within each species or department. Trophies are typically reserved for the most prestigious recognitions at fair level, including grand champion livestock awards, outstanding exhibitor honors, and special achievement categories that warrant a standing award with lasting display value beyond the ribbon. Plaques suit permanent recognition such as fair queen awards, volunteer service recognition, superintendent honors, and long-term fair association member tributes where wall-mounted display is more appropriate than a ribbon or trophy. Medals with neck ribbons work well for junior exhibitor programs and 4-H recognition ceremonies where every participating youth receives a wearable keepsake regardless of competitive placement.

What should county fair trophy and award engraving include?

County fair award engraving should document the specific competitive achievement and fair context so the award serves as a complete record of the accomplishment. Essential elements include exhibitor name, award title, species or department and class if applicable, fair name, and year. For livestock trophies, include the species and class alongside the award title for example: Tyler Brennan, Grand Champion Market Steer, Tri-County Fair, 2025, or Sophia Martinez, Reserve Champion Breeding Gilt, Jackson County 4-H, Summer 2025. Home arts and open class trophies benefit from noting the specific department or category: Emma Walsh, Best of Show, Home Arts Department, Valley Agricultural Fair, 2025. Outstanding exhibitor and special award trophies should include the full recognition title along with the fair name and year: Nathan Chen, Outstanding Junior Exhibitor, Riverside County Fair, 2025. For perpetual trophies that carry forward the names of each year's champion, a consistent format from year one ensures the trophy's growing history reads as an organized record of fair excellence rather than a collection of different engraving styles. Sponsor name recognition on sponsored class trophies adds a community acknowledgment element that fair sponsors appreciate and that reinforces the community partnerships behind the fair's award program.

How should 4-H programs structure recognition for youth exhibitors?

4-H youth exhibitor recognition programs work best when they balance competitive achievement acknowledgment with the personal development and participation values that define the 4-H mission, ensuring that every young person who prepared and exhibited a project receives meaningful recognition for their effort regardless of where they placed in competitive judging. Universal participation recognition through medals, ribbons, or certificates presented to every junior exhibitor acknowledges the preparation, responsibility, and commitment that entering a fair project requires, which is particularly important for first-year exhibitors whose experience of the fair will shape whether they return the following year. Placing ribbons in blue, red, and white for first through third within each class provide the competitive structure that gives youth exhibitors a measurable goal and teaches them to work toward a standard of excellence evaluated by knowledgeable judges. Champion and grand champion recognition at the class and department level should be structured to reflect genuine achievement that youth exhibitors can aspire to across multiple fair years, with the award size and quality reflecting the prestige of the honor within the 4-H community. Special recognition categories including most improved exhibitor, best project record book, outstanding clover member, and achievement in project area awards acknowledge the dimensions of 4-H development that go beyond the competitive result of a single judging event. County 4-H councils and fair associations benefit from establishing consistent award standards across years so that earning a grand champion rosette or outstanding exhibitor trophy carries the same meaning and prestige from one year to the next, building a recognition tradition that youth exhibitors and their families value as part of the 4-H experience.

If you need more information before deciding, see our expert resource section:
]]>
trophies-livestock-farm-animals quickshiptrophies-tractorCounty Fair / State Fair / 4H / Fair
custom-pagetrophies-dance1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesMusic, Drama, Art, Dance1:14%,10:18%,50:22%,100:25% "Dance Trophies" "Dance Trophy" "Trophies, Dance" "Dancing Trophies" "Trophies, Dancing"Find this popular couples dance trophy with 1st, 2nd or 3rd place trim, marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!qtdanceplSee more great- perfect for next dance marathon or event!trophies-danceDance, 1st / 2nd / 3rd / Etc.custom-pagetrophies-dance1trophies498852-311821.06TrophiesMusic, Drama, Art, Dance1Find this achievement cup trophy with couples dancing figure discounted at TrophyCentral. Includes free text engraving!cup-dance-pDancecustom-pagetrophies-dance1trophies498852-312421.33TrophiesMusic, Drama, Art, Dance1Find these couples dancing budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtdancescbDancecustom-pagetrophies-dance1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75219Quick TrophyTrophiesMusic, Drama, Art, Dance1:14%,3:19%,10:27%"Dance Trophy" "Trophies, Dance" "Dancing Trophies" "Trophies, Dancing"Find these two-tier Couples Dancing Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtdancettDancecustom-pagetrophies-dance1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.2115Quick TrophyTrophiesMusic, Drama, Art, Dance1:14%,3:19%,10:28%"Dance Trophy" "Trophies, Dance" "Dancing Trophies" "Trophies, Dancing"See this dance championship trophy with a couples dancing figure at TrophyCentral. Includes free engraving. Fast 1-2 day shipping.qtdancettwDancecustom-pagetrophies-dance1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.452421.33Quick TrophyTrophiesMusic, Drama, Art, Dance1:14%,10:18%,50:24%,100:28%"Dance Trophy" "Trophies, Dance" "Dancing Trophies" "Trophies, Dancing"This popular Couples Dancing Trophy from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtdancescNot exactly what you want? See other popularin a variety of sizes and styles.trophies-danceDancecustom-pagetrophies-dance1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451623.65Quick TrophyTrophiesMusic, Drama, Art, Dance1:14%,10:18%,50:24%,100:28%"Dance Trophy" "Trophies, Dance" "Dancing Trophies" "Trophies, Dancing"These quick-ship trophies from TrophyCentral feature a gold dancing (couples) figure, real marble base and marble trophy figure platform, choice of column size and color.qtdancedmDancecustom-pagetrophies-dance1trophies498852-311218.84TrophiesMusic, Drama, Art, Dance1Find this unique cup trophy with Couples Dancing figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-dance-scbDancecustom-pagetrophies-dance1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.4118Quick TrophyTrophiesMusic, Drama, Art, Dance1:14%,3:19%,10:24%"Dance Trophy" "Trophies, Dance" "Dancing Trophies" "Trophies, Dancing"Find these two-tier, 3-column Couples Dancing Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtdance3cDancecustom-pagetrophies-dance1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.453633.4Quick TrophyTrophiesMusic, Drama, Art, Dance1:14%,10:17%,25:23%,50:29%,100:34%"Dance Trophy" "Trophies, Dance" "Dancing Trophies" "Trophies, Dancing"Our popular dancing (couples) participation trophies feature a real slant-front marble base and free engraving.qtdancencReturn to oursection for more popular choices.trophies-danceDancecustom-pagetrophies-dance1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498852-311.41234Quick TrophyTrophiesPerpetual Trophies1:14%,3:15%,10:16%"Dance Awards" "Dance Trophies"Find this Perpetual Series Trophy - DancingDiscounted at TrophyCentral. Each Trophy has enough room for 32 names. Ships in just 1-2 days.qtdanceperpDancecustom-pagecustom-pom-poms1muimse1100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Texas" "UPS (FedEx available on request)"7745310-1410.454814.85PepcoSpiritSpirit1Buy these Custom Coupon Handle Poms and other Custom Cheerleader products at TrophyCentral.Spiritcustom-pagequickshiptrophies-cow1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Fabulous Cow Figure 1st, 2nd and 3rd Place Trim Trophies with Free Engraving and Fast 1-2 Day Shipping!qtcowpl08-05-2026custom-pagequickshiptrophies-cow1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%This popular Cow Figure Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!qtcowyr08-05-2026custom-pagequickshiptrophies-cow1trophies498852-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with cow figure discounted at TrophyCentral. Includes free text engraving!cup-cow-p08-05-2026custom-pagequickshiptrophies-cow1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these cow budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtcowscb08-05-2026custom-pagequickshiptrophies-cow1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:26%Find these fabulous Cow Figure Winners Line Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qtcowtt08-05-2026custom-pagequickshiptrophies-cow1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.751434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:28%See this championship trophy with a Cow figure at TrophyCentral. Be sure to see all of our Cow figure awards.qtcowttw08-05-2025custom-pagequickshiptrophies-cow1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:21%,100:24%This popular Cow Figure Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtcowsc08-05-2026custom-pagequickshiptrophies-cow1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.05Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%These quick-ship trophies from TrophyCentral feature a Cow figure, real marble base and marble trophy figure platform, choice of column size and color.08-05-2026custom-pagequickshiptrophies-cow1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Cow figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-cow-scb08-05-2026custom-pagequickshiptrophies-cow1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.41226Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:18%,10:23%Find these fabulous two-tier, 3-column champion Cow Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtcow3c08-05-2026custom-pagequickshiptrophies-cow1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:27%,100:32%Our popular Cow Figure participation trophies feature a real slant-front marble base and free engraving.qtcownc08-06-2026custom-pagenew-trophies-21trophies498551-310.452429Trophies1Find our Cow star column trophy discounted at TrophyCentral. Features a real marble base, 6 inch gold star-shaped column, free engraving and fast shipping.cow-star-column-trophycustom-pagetrophies-livestock-farm-animalsqtcowncqtcowscqtcowplqtcowyrqtcowttqtcowttwqtcow3cqtcowdmmqtcowscbcup-cow-scbcup-cow-p11Find Cow Trophies discounted at TrophyCentral. Each Cow Trophy includes engraving. Fast 1-2 day shipping.cow trophies, cow trophy, cow awards, cow trophies and awards

Shop With Confidence at TrophyCentral

We offer a huge selection, discounted prices and top-rated customer service. Do you need help with some ideas or with ordering? Yes, we sell online, but we have real people who would love to help you! Feel free to call our customer service experts in Michigan, New York and online. TrophyCentral - delivering smiles since 1999!


]]>
quickshiptrophies-bull quickshiptrophies-chickenCow
custom-pageplaques1plaques498552-41JDSPlaques1Find this cowboy plaque discounted at TrophyCentral. Our cowboy mascot plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Mascotcustom-pagemascotinserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsMascots1Buy these quality Cowboys Mascot Medal Inserts at TrophyCentral. Each Cowboys Insert can be used to create a unique plaque, medal or trophy.489944Mascot
employee-resource-hub11Award title ideas and recognition language for board chairs, committee leaders, retiring members, and ceremonial honorees -- organized by role with presentation tips.custom-pageblog-trophycentral11Discover prom award ideas beyond King and Queen. From Best Dressed to Most Creative Promposal, explore 15 categories that make spring formal memorable for all students.11Explore creative trophy display ideas to showcase awards in schools, offices and homes. Learn how to design eye-catching arrangements that highlight achievements.custom-pagefree-school-certificate-templates1"Download Only"free-academic49855011TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Creative Writing Award template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Creative-Writing-Award-Certificatecreative-writingWriting, Academiccustom-pagetrophies-cricket1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular cricket figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!qtcrickplCricket, 1st / 2nd / 3rd / Etc.custom-pagetrophies-cricket1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%This popular Cricket Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!qtcrickyrCricketcustom-pagetrophies-cricket1trophies498852-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with cricket figure discounted at TrophyCentral. Includes free text engraving!cup-crick-pCricketcustom-pagetrophies-cricket1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these cricket budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtcrickscbCricketcustom-pagetrophies-cricket1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous two-tier Cricket Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtcrickttCricketcustom-pagetrophies-cricket1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.2115Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%See this championship trophy with a Cricket figure at TrophyCentral. Be sure to see all of our Cricket figure awards.qtcrickttwCricketcustom-pagetrophies-cricket1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%Find these popular Cricket single column trophies discounted and with free personalization at TrophyCentral.qtcrickscCricketcustom-pagetrophies-cricket1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451623.65Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%Find This Popular Cricket Deluxe Platform Series Trophies Discounted at TrophyCentral. Real Marble Base; Free Personalization!qtcrickdmCricketcustom-pagetrophies-cricket1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Cricket figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-crick-scbCricketcustom-pagetrophies-cricket1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-311.4118Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous Cricket Champions Line 3-column Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qtcrick3cCricketcustom-pagetrophies-cricket1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%,25:23%,50:29%,100:34%Our popular Cricket participation trophies feature a real slant-front marble base and free engraving.Cricketcustom-pagenew-trophies-21trophies498551-310.452429Trophies1Find our Cricket star column trophy discounted at TrophyCentral. Features a real marble base, 6 inch gold star-shaped column, free engraving and fast shipping.cricket-star-column-trophycustom-pageaward-medalsqtcrickncqtcrickscqtcrickdmqtcrickyrqtcrickplqtcrickttqtcrickttwqtcrick3cmqtcrickscbcup-crick-scbcup-crick-p1trophies1See our great selection of cricket trophies. Each cricket trophy include free engraving!TrophyCentral has been supplying cricket clubs, schools, and leagues with quality awards since 1999. All cricket trophies include up to three lines of free engraving. Need awards in a hurry? Orders typically ship in just 1-2 business days. Browse our complete trophies collection for additional styles and designs.

]]>
Cricket
custom-pagereligioustrophies1trophies498551-310.452429Trophies1Find this popular Cross trophy discounted at TrophyCentral. Features a real marble base, stylish 4-inch gold cup, free engraving and fast shipping.cross-cup-place-trophycustom-pagetrophies-track-fieldplastic-pinbox-t10498551-30.5200040.5TrophyCentralLapel Pins11:22%,25:24%,100,27%,500:30%Find this Cross Country Gold Enamel lapel pin discounted at TrophyCentral. Fast 1-2 day shipping.cross-country-u-pbcustom-pagetrophies-track-fieldplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsSports, Hobby, Org, Livestock1:22%,50:30%,100:33%,500:47%"Cross Country Awards" "Track Pins"Cross Country Letter Pins: EC Series Cross Country Lapel Pins feature a high-quality enameled finish and ship in just 1-2 business days!ec23custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Cross Country Male Inserts (Litho) at TrophyCentral. Each Cross Country Male Insert can be used to create a unique plaque, medal or trophy.502711
custom-pagetrophies-track-fieldplastic-pinbox-t5lapel pins498551-20.550040.5TrophyCentralLapel Pins11:22%,25:24%,100,27%,500:30%Find this Cross Country Gold Enamel lapel pin discounted at TrophyCentral. Features a clutch-pin back for easy attachment to clothing.. Fast 1-2 day shipping.cross-country-u-pbcustom-pagetrophies-cross-country-skiing1trophies498551-310.452429Trophies1Find this popular Cross Country Skiing trophy discounted at TrophyCentral. Features a real marble base, stylish 4-inch gold cup, free engraving and fast shipping.cross-country-skiing-cup-place-trophycustom-pagetrophies-cross-country-skiing1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%"Skiing Trophies" "Skiing Trophy" "Skier Trophies" "Ski Trophies"Find this popular cross country figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!qtskiccplSkiing (Cross Country), 1st / 2nd / 3rd / Etc., Sportscustom-pagetrophies-cross-country-skiing1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%"Skiing Trophies" "Skiing Trophy" "Skier Trophies" "Ski Trophies"This popular Cross Country Skiing Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!qtskiccyrSkiing (Cross Country), Sportscustom-pagetrophies-cross-country-skiing1trophies498852-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with cross country skiing figure discounted at TrophyCentral. Includes free text engraving!cup-skicc-pSkiing (Cross Country), Sportscustom-pagetrophies-cross-country-skiing1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these cross country skiing budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtskiccscbSkiing (Cross Country), Sportscustom-pagetrophies-cross-country-skiing1trophies498551-310.453633.4Trophies1Find this budget cross country skiing award trophy discounted at TrophyCentral. Features a real marble base and plastic skiing figure. Engraving is free. Fast 1-2 day shipping.Skiing (Cross Country), Sportscustom-pagetrophies-cross-country-skiing1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%"Skiing Trophies" "Skiing Trophy" "Skier Trophies" "Ski Trophies"Find these fabulous two-tier Cross Country Skiing Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtskiccttSkiing (Cross Country), Sportscustom-pagetrophies-cross-country-skiing1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-411.2115Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%"Skiing Trophies" "Skiing Trophy" "Skier Trophies" "Ski Trophies"See this championship trophy with a Cross Country Skiing figure at TrophyCentral. Be sure to see all of our Cross Country Skiing figure awards.qtskiccttwSkiing (Cross Country), Sportscustom-pagetrophies-cross-country-skiing1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:28%"Skiing Trophies" "Skiing Trophy" "Skier Trophies" "Ski Trophies"This popular Cross Country Skiing Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtskiccscSkiing (Cross Country), Sportscustom-pagetrophies-cross-country-skiing1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.451622.05Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:15%"Skiing Trophies" "Skiing Trophy" "Skier Trophies" "Ski Trophies"These quick-ship trophies from TrophyCentral feature a Cross Country Skiing figure, real marble base and marble trophy figure platform, choice of column size and color.qtskiccdmSkiing (Cross Country), Sportscustom-pagetrophies-cross-country-skiing1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Cross Country Skiing figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-skicc-scbSkiing (Cross Country), Sportscustom-pagetrophies-cross-country-skiing1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-411.4118Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%"Skiing Trophies" "Skiing Trophy" "Skier Trophies" "Ski Trophies"Find these fabulous two-tier, 3-column champion Cross Country Skiing Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtskicc3cSkiing (Cross Country), Sportscustom-pagetrophies-cross-country-skiing1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:28%"Skiing Trophies" "Skiing Trophy" "Skier Trophies" "Ski Trophies"Our popular Cross Country Skiing participation trophies feature a real slant-front marble base and free engraving.qtskiccncSkiing (Cross Country), Sportscustom-pagetrophies-cross-country-skiing1trophies498551-310.452429Trophies1Find our Cross Country Skiing star column trophy discounted at TrophyCentral. Features a real marble base, 6 inch gold star-shaped column, free engraving and fast shipping.cross-country-skiing-star-column-trophycustom-pagetrophies-snowmobileqtskiccncqtskiccscqtskiccyrqtskiccplqtskiccttqtskiccttwqtskicc3cacrylic-triangle-allqtskiccdmmqtskiccscbcup-skicc-pcup-skicc-scbbdg-skicccross-country-skiing-cup-place-column-trophycross-country-skiing-cup-place-trophycross-country-skiing-star-column-trophy1trophies1Shop for Cross Country Skiing Trophies at TrophyCentral. Skiing Trophies Include Free Engraving!Cross Country Skiing Awards

TrophyCentral has a great selection of cross country skiing trophies and awards for races, club events, and team recognition. Our popular single column cross country skiing trophies are available in several sizes and column colors, and our place trophies come with a choice of 1st, 2nd, or 3rd place trim. Every cross country skiing trophy includes free personalized engraving with up to three lines of text, with larger trophies accommodating additional lines at no extra cost.

Shop Cross Country Skiing Awards with Confidence at TrophyCentral

With over 2,300 five-star reviews and trusted by leagues and clubs since 1999, TrophyCentral delivers quality awards at guaranteed lowest prices. Most orders ship in just 1-2 business days and free economy shipping is available on orders over $99. Explore our full collection of trophies and awards for even more designs and styles.

]]>
trophies skiingmedals trophies-downhill-skiingSkiing (Cross Country)
custom-pagewalnut-insert-plaques1"3-6 business days with engraving, Without engraving: 1-3 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"plaques105503-610.4511222.05Classic MedallicsPlaquesInsert1:22%,3:23%,5:24%"School Products"Genuine Walnut Cross Plaque with 2 Inch Insert and Free Engraving.49-3581Religiouscustom-pagereligioustrophies1trophies498551-310.452429Trophies1Find our Cross star column trophy discounted at TrophyCentral. Features a real marble base, 6 inch gold star-shaped column, free engraving and fast shipping.cross-star-column-trophycustom-pagemedallion-inserts-general-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these quality Crossed American Flags Inserts (Litho) at TrophyCentral. Each Crossed American Flags Insert can be used to create a unique plaque, medal or trophy.491771Flags
custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-31130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Crossed Bats Baseball (507390) Litho Medal Insert. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.507390Baseball / T-Ball, Sports
custom-pagetrophies-marksman-shooting-rifle112-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "Sports Medals" "Shooting Medals"These inexpensive 1 1/4 inch Crossed Rifle medals offer a high quality, but low price for those on a tight budget.crossedrifles08-30-2018
custom-pageglass-crystal-awards1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"general410187-1012418JcharlesCrystal Awards1:22%,25:24%"crystal awards" "Retirement Awards" "Retirement Plaques, Awards and Gifts" "Golf Trophies" "Golf Awards"This high-quality crystal Accolade Plate offers free personalization. Turn your message into an eye-catching design! Two sizes available - plate stand included!See our complete selection of:Leadership, Golf, Tennis, Sportscustom-pageteacher-appreciation11105503-610.4511626.05Classic MedallicsCrystal Awards1:30%"Teacher Awards"Find this Crystal Apple on black base award discounted at TrophyCentral. Price includes free engraving.Apple, Teacher's Award, Academiccustom-pageglass-crystal-awards"7-10 business days" "Kentucky" "UPS (FedEx and Post Office Priority Mail may be available on request)"personalized gifts410187-1010.45624.45JcharlesGiftsCrystal Gifts1:22%,25:22%"personalized gifts"Our crystal clear biscuit barrel is the way to display all your favorites. Superb, hand-blown crystal with unlimited usage. Holds 28 ounces.116Crystal Giftscustom-pageglass-crystal-awards11general105505-1010.45145.25Classic MedallicsCrystal Awards1:22%"Minuteman" "Crystal Awards"Simulating a wave, in pure crystal, this unique award is a perfect way to celebrate a milestone. With the blue accents and engraving, employees or loved ones will feel honored to receive this award.11-05-2013Leadershipcustom-pageglass-crystal-awards1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"personalized gifts410187-1010.45452.45JcharlesGiftsCrystal Gifts1:22%,25:25%"personalized gifts"Find These Beautiful Foundation Series Crystal Bookends Discounted At TrophyCentral. Price Includes Engraving!Crystal Giftscustom-pagecrystalcups11"10-12 business days w/engraving" "Mt. Vernon, NY" "UPS (FedEx available on request)"general105505-1010.451422.45Classic MedallicsCrystal Awards1:22%,5:22%Shop for Crystal Bowl Trophies from TrophyCentral. Great Selection of Crystal Trophies.05-01-2012Leadership, Golf, Tennis, Sportscustom-pageglass-crystal-awards1"14 business days" "Erlanger, KY" "UPS"general410187-1010.451 2 3 4 5 6 7 8 9424.45JcharlesTrophies1:22%,25:24%Find these fabulous Chroma Recognition Awards discounted at TrophyCentral. TrophyCentral is known for its top-rated customer servicecustom-pageglass-crystal-awards1"10 business days" "Aliquippa, PA" "UPS"general1500110-1410.451236.45Glass AmericaCrystal Awards1:22%,10:25%Flag Standing Disk Glass Awards from TrophyCentral.custom-pageglass-crystal-awards1"10-15 business days w/engraving" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"general105505-1010.451420.45Classic MedallicsCrystal Awards1:22%,25:24%Find this crystal figure trophy discounted at TrophyCentral. Each trophy includes engraving and a gift box.Leadership1personalized-gifts1Find crystal gifts discounted at TrophyCentral. Each crystal gift includes engraving and a gift box.

Engraved Crystal Gifts - Premium Personalized Gifts for Special Occasions and Milestones

Engraved crystal gifts occupy the premium tier of personalized gift giving, combining the visual brilliance and weight of optical crystal with laser engraving that etches a name, message, or dedication permanently into the material with a frosted precision that stands out against the clear crystal surface. The result is a gift that communicates thoughtfulness and quality at a glance, making crystal gifts the right choice when the occasion calls for something that goes beyond a practical desk item or a standard recognition award. Our crystal gift collection includes crystal vases and bowls suited for home display, crystal paperweights and bookends appropriate for executive desks and professional offices, crystal photo frames that pair personalized engraving with a cherished photograph, and keepsake crystal shapes including hearts, stars, and arches that work for personal milestone gifts across a wide range of occasions. Every crystal gift arrives in a presentation gift box ready to give, with free engraving personalizing each piece before it ships.

Frequently Asked Questions About Engraved Crystal Gifts

What occasions are engraved crystal gifts best suited for?

Engraved crystal gifts work best for occasions where the quality and elegance of the gift itself needs to match the significance of the moment being recognized. Retirement gifts are among the most popular crystal gift occasions because the brilliance and weight of optical crystal communicates the gravity of a career milestone in a way that lighter or more casual gift materials do not, and a personalized engraving documenting years of service and a heartfelt message turns a beautiful object into a permanent memento of the occasion. Wedding and anniversary gifts suit crystal vases and bowls particularly well, where the traditional association between crystal and silver or crystal anniversaries adds natural symbolic resonance. Executive and corporate recognition gifts use crystal paperweights and desk pieces to signal the prestige of the accomplishment being acknowledged, appropriate for top performer awards, client appreciation gifts, and leadership recognition at annual gala events. Personal milestone celebrations including graduations, confirmations, milestone birthdays, and new home gifts all suit engraved crystal keepsakes when the giver wants to present something that will be kept and displayed rather than consumed or used up. The common thread is that crystal gifts are chosen when the occasion deserves a gift with lasting presence and the personalized engraving makes it specific to the recipient and the moment.

What should I engrave on a crystal gift?

Crystal gift engraving benefits from a slightly different approach than trophy or plaque engraving because the gift is personal rather than institutional, and the engraving should reflect the relationship between the giver and recipient as much as the occasion itself. For retirement gifts, a combination of factual detail and personal warmth works best: Robert Callahan, 28 Years of Dedicated Service, Meridian Financial Group, Retired May 2025, followed by a brief sentiment such as Your Legacy Endures or With Gratitude and Best Wishes for the Road Ahead. Wedding and anniversary gifts suit a couple's names, wedding date, and a meaningful phrase or quote relevant to the relationship. Executive recognition gifts should lead with the award title and recipient name in the largest engraving, followed by company name and year, keeping the tone formal and the layout clean. For personal milestone keepsakes like graduation or confirmation gifts, the recipient's name, occasion, and year are the essential elements, with a brief message from the giver adding a personal layer that transforms the gift from a beautiful object into a meaningful memento. Because laser engraving on crystal produces a frosted white finish against the clear surface, keeping the layout balanced with appropriate spacing between lines produces the most visually elegant result. Avoid cramming too much text onto a small crystal surface, as white space in crystal engraving is what gives the finished piece its refined, premium appearance.

What is the difference between crystal gifts and crystal awards?

Crystal gifts and crystal awards are made from the same optical crystal material and share the same laser engraving process, but they are designed for different purposes and display contexts. Crystal awards are shaped and sized specifically for recognition presentations, featuring designs like towers, stars, and obelisks that sit on bases and communicate achievement in the visual language of a formal award program. They are appropriate for employee of the year presentations, sales achievement recognition, and championship events where the award's appearance needs to signal prestige within an organizational context. Crystal gifts are designed as personal keepsakes and decorative objects, with shapes and forms including vases, bowls, photo frames, paperweights, and sculptural pieces that integrate naturally into a home or office environment without the formal award aesthetic. A crystal paperweight on an executive's desk reads as a refined personal item rather than a competitive achievement marker, making it appropriate for client gifts, personal milestone recognition, and occasions where the recipient will display the piece in a home setting rather than a professional awards case. Many recognition programs use both formats together, presenting a crystal award at the formal ceremony for its visual impact and following up with a crystal keepsake gift that the recipient can display at home, creating a complete recognition experience that honors the achievement in both professional and personal spaces. See our complete collection of crystal awards and trophies for formal recognition options that complement crystal gifts in a complete presentation.

If you need more information before deciding, see our expert resource section:
]]>
glass-crystal-awards
custom-pagetrophies-golf1"10 business days" "Aliquippa, PA" "UPS"trophies1500110-1410.45412.45Glass AmericaCrystal Awards1:22%,10:25%Crystal Golf Ball on Black Glass Base Desk Award. Ideal for leagues, schools, and tournaments. Fast shipping.Golf, Sportscustom-pagetrophies-golf19x14x4picpla holorfigplaq"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"trophies410181510.45515.45JcharlesTrophies1:22%,25:31%"General Recognition Awards" "Golf Awards"Crystal Golf Driver Award. Ideal for leagues, schools, and tournaments. Fast shipping.Golf, Sportscustom-pagetrophies-golf1"10 business days" "Aliquippa, PA" "UPS"trophies1500110-1410.45824.45Glass AmericaCrystal Awards1:22%,10:25%Crystal Golf Tower Award. Ideal for leagues, schools, and tournaments. Fast shipping.Golf, Sportscustom-pageglass-crystal-awards11general105503-610.4511818.45Classic MedallicsCrystal Awards1:22%,6:31%"Volunteer Products"Shop for Crystal Heart (Pink or Blue) from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.custom-pageglass-crystal-awards11"5-10 business days w/engraving" "Mt. Vernon, NY" "UPS (FedEx available on request)"general105505-1010.451838.85Classic MedallicsCrystal Awards1:30%,25:34%Find this crystal scroll award discounted at TrophyCentral. This fabulous award features free engraving and a gift box.05-07-2008custom-pageglass-crystal-awards11key-insert-plaque"4-8 business days w/engraving" "Mt. Vernon, NY" "UPS (FedEx available on request)"general105503-610.4513636.45Classic MedallicsCrystal Awards1:22%Find key to the city awards discounted at TrophyCentral. Each key to the city award features free personalization. This elegant crystal key is a perfect way to honor leaders and volunteers.Key, Key to the City, Crystal Keycustom-pageglass-crystal-awards11"5-10 business days w/engraving" "Mt. Vernon, NY" "UPS (FedEx available on request)"general105505-1010.451816.45Classic MedallicsCrystal Awards1:30%,5:28%Find this fabulous Optical Cut Octagon Award discounted at TrophyCentral. TrophyCentral is known for its top-rated customer servicecustom-pageglass-crystal-awards1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"general410187-1010.45628.05JcharlesCrystal Awards1:22%,25:25%"crystal awards" "sales awards" "service awards" "corporate sales awards" "corporate service awards" "sales award" "service award" "corporate sales award" "corporate service award"Perspective Awards from TrophyCentral. Discounted Trophies, Awards and Promotional Products.Leadershipcustom-pageglass-crystal-awards11"7-10 business days w/engraving" "Kentucky" "UPS (FedEx available on request)"general410187-1010.45442.45JcharlesTrophies1:22%,25:24%"New Products"Crystal Planet Trophy From TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.12-20-2023Generalcustom-pageglass-crystal-awards1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"personalized gifts410187-1010.45448.45JcharlesGiftsCrystal Gifts1:22%,25:24%"personalized gifts"Find Radii Bookends discounted at TrophyCentral. Made of solid optical crystal, this radiant set rests on a sleek base to insure your books stay in place.Crystal Giftscustom-pageservicepins11plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.371150030.37Classic MedallicsLapel PinsBusiness1:30%,50:34%,100:38%Find this Crystal Rhinestone Service pin discounted at TrophyCentral. Each pin features a beautiful gold finish and clutch back that your employees will love.servicepins3Service / Retirementcustom-pageglass-crystal-awards11"5-10 business days w/engraving" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"general105505-1010.4511242.45Classic MedallicsCrystal AwardsHero1:22%,5:22%"Crystal Globe Awards" "Engraved Crystal Awards" "Crystal Star Awards" "Optical Crystal Awards" "Etched Crystal Awards" "Crystal Awards" "Corporate Crystal" "Crystal Award Section" "Crystal Trophy Section" "Crystal Corporate Gifts" "Crystal Corporate Awards" "Crystal Corporate Award Section"Find these Crystal Shield Awards discounted at TrophyCentral. Each crystal award features free engraving and a gift box.custom-pagefloating-plaquesglassarch1912ptesminimfrcbxxblwacrdicrawice700xjaglscopcutcrocopcutcydiawft300379xchromacr262cr261insttosuopcutcrsh8x6fusionglass65x95x710064x665842x72xreesaw100xmythic42xwprizma0580xglassapexcr209cr258rectangleglasscr259diamondglassdomeglassacrylicawardcr2576x8fusionglasscr260cr177smdicronblba92756447541121163912901040318843thjaglqucl61crheporblcrkeytoci9721606899x899x400globalawardcr246opcrglcr2072006xatlas200070x959xveteaw1040x083x812827xtorchier7x390opticaalergriaintrigue050x400070xacrobat-awardcompositionsirija1trophies1Custom Crystal and Glass Awards - Recognize Every Achievement with Lasting Elegance

Crystal and glass awards bring a level of sophistication and permanence to recognition that no standard trophy can match, making them the preferred choice for moments that truly deserve to stand apart. From corporate employee of the year ceremonies where a beautifully etched optical crystal piece sits on a recipient's desk for decades, to sales achievement galas where top performers receive jade glass awards engraved with their name and annual numbers, from volunteer appreciation dinners honoring years of selfless community service, to retirement presentations marking long and distinguished careers, from nonprofit and association leadership awards recognizing board members and executive directors, to real estate milestone awards, academic excellence recognition, and golf tournament champion presentations, quality crystal and glass awards communicate the weight and significance of the achievement they represent. Our versatile selection includes jade glass plaques and scroll awards in classic green and clear finishes, optical crystal pieces in diamond, arch, wave, and shield designs that catch and refract light from every angle, globe and world awards ideal for international and humanitarian recognition, high-end art glass sculptures for the most prestigious occasions, acrylic awards providing a more budget-friendly alternative with a similarly polished appearance, and crystal gifts including paperweights, bookends, and clocks that double as lasting desk displays. Every award includes free engraving personalized with recipient name, title, organization, and occasion.

Frequently Asked Questions About Crystal Awards

What is the difference between crystal, glass, jade glass, and acrylic awards?

Optical crystal awards are made from the highest quality lead-free crystal with exceptional clarity and weight, producing brilliant light refraction that gives them a premium look and feel suited for the most prestigious recognition occasions. Glass awards offer a similar elegant appearance at a more accessible price point, with a wide range of artistic shapes including bent glass and iceberg designs. Jade glass awards feature a distinctive green-tinted glass with a polished finish that has become a classic in corporate and executive recognition programs. Acrylic awards provide a lightweight, shatter-resistant alternative with a clear polished appearance at a significantly lower price, making them ideal for larger recognition programs or budget-conscious events where visual impact still matters.

What details should crystal award engraving include?

Essential elements include recipient name, award title, organization or company name, and year. For corporate recognition, adding the specific achievement such as Top Sales Representative or 25 Years of Service adds meaningful context. Volunteer and nonprofit awards benefit from including the program or event name. Retirement presentations gain warmth from a brief phrase acknowledging years of service. Keep text concise and readable, prioritizing the most meaningful details when the engraving area requires choices.

Can I add a logo to a crystal or glass award?

Yes, many of our crystal and glass awards support logo engraving or sandblasting, allowing you to add a company, organization, or event logo alongside the recipient's name and award details. Logo capability varies by award style and size. Contact us to confirm logo options for a specific award before ordering, and have your logo file ready in a high-resolution vector format for the best engraving results.

]]>
custom-pagemedallion-inserts-government-agencies-and-logos12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%"Award Medals" "Award Medals - All Subjects" "Medals - All Others"Buy these high-quality Cuban Shield Inserts at TrophyCentral. Each Cuban Shield Insert can be used to create a unique plaque, medal or trophy.517419Flags
custom-pagetrophies-cooking-culinary20498552-40.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful Culinary 2" Epoxy-covered insert decal discounted at TrophyCentral. Fast 1-2 day shipping.Cooking / Culinarycustom-pagetrophies-cooking-culinaryculinary-pbculinary-u-pbcocuarlapin11Find culinary and cooking pins discounted at TrophyCentral. Each cooking and culinary lapel pin features a clutch back for easy attachment to clothing.Shop with Ease at TrophyCentral Find cooking lapel pins and awards at discounted prices, fast shipping and great customer service. Yes, we sell online, but we have really people waiting to help you!]]>custom-pagetrophies-cooking-culinary1medals498552-30.525033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this Chef Hat 2 1/4" Antique Gold Medal Discounted at TrophyCentral. Each medal features a free ribbon. Fast shipping!Cooking / Culinarycustom-pagemedallion-inserts-occupational-subjects12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these high-quality Culinary Arts Award Inserts at TrophyCentral. Each Culinary Arts Award Insert can be used to create a unique plaque, medal or trophy.51863412-20-2020Cooking / Culinary
custom-pagemedallion-inserts-occupational-subjects12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Culinary Arts Inserts (Litho) at TrophyCentral. Each Culinary Arts Insert can be used to create a unique plaque, medal or trophy.50165404-15-2017Cooking / Culinary
custom-pagetrophies-cooking-culinary12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,100:28%,500:34%,1000:45%These inexpensive 1 1/4 inch Culinary Arts (Cooking) Medals offer a high quality, but low price for those on a tight budget.e913506022018Cooking / Culinary
custom-pagefreeawardcertificates1trophies-cooking-culinary"Download Only"free-cooking49855011TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Culinary Award template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Culinary-Award-Certificateculinary-award-freeCooking / Culinarycustom-pagetrophies-cooking-culinary1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Culinary Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Cooking / Culinarycustom-pagetrophies-cooking-culinary1trophies498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Culinary insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-Culinary-InsertCooking / Culinarycustom-pagetrophies-cooking-culinary1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Culinary single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - CulinaryCooking / Culinarycustom-pagetrophies-cooking-culinary1trophies498551-311821.06TrophyCentralTrophies1Cooking / Culinarycustom-pagecooking-pinsplastic-pinbox-t10498551-30.5200040.5TrophyCentralLapel Pins11:22%,25:24%,100,27%,500:30%Find this Culinary Excellence Gold Enamel lapel pin discounted at TrophyCentral. Fast 1-2 day shipping.culinary-u-pbCooking / Culinarycustom-pagecooking-pinsplastic-pinbox-t5lapel pins498551-20.525040.5TrophyCentralLapel Pins11:22%,25:24%,100,27%,500:30%Find this Culinary Excellence Gold Enamel lapel pin discounted at TrophyCentral. Features a clutch-pin back for easy attachment to clothing.. Fast 1-2 day shipping.culinary-u-pbCooking / Culinarycustom-pagetrophies-cooking-culinary1trophies498551-310.71217.38Trophies1Cooking / Culinarycustom-pagetrophies-cooking-culinary1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Culinary Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Cooking / Culinarycustom-pagetrophies-cooking-culinary1medals498552-30.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this Colorful Culinary insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Cooking / Culinarycustom-pagetrophies-cooking-culinary1medals498552-40.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this Culinary insert medal With A Personalized Front Rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Cooking / Culinarycustom-pageplaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these culinary insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Cooking / Culinarycustom-pagetrophies-cooking-culinary1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our culinary insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - CulinaryCooking / Culinarycustom-pagetrophies-cooking-culinary1perpetual trophies498551-314134TrophyCentralTrophiesPerpetual Trophies1Find this Perpetual Culinary Trophy Discounted at TrophyCentral. Each Trophy has enough room for 32 names. Ships in just 1-2 days.custom-pagetrophies-cooking-culinary1plaques498552-41JDSPlaques1Find this Culinary Plaque discounted at TrophyCentral. Our culinary plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Cooking / Culinarycustom-pagetrophies-cooking-culinary1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Culinary Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Cooking / Culinarycustom-pagepickleball-trophiessilver-cup-trophiescrystalcupschampion-perpetual-trophiescuptrophies1noname42comsoonintroqtcupncqtcupscqtcupdmqtcupyrqtcupplqtcupttqtcupttwqtcup3cmqtcupscbchamp-cup-tc1trophies1Discover premium trophy cups and bowls with free custom engraving. Choose from metal or plastic, all sizes, and styles perfect for any event. Order yours now.cup-trophies-large-and-small

🏆 Custom Cup Trophies & Championship Bowls - Classic Symbols of Victory

Cup trophies represent the most prestigious and traditional form of recognition for championship achievements across sports tournaments, corporate competitions, academic excellence, and special events requiring exceptional celebration. As timeless symbols of victory dating back centuries, trophy cups and championship bowls provide elegant, displayable awards that winners treasure as centerpiece decorations in trophy cases, offices, and homes for generations. These quality cup trophies feature durable construction in multiple materials including silver-plated metal cups, gold-finished brass cups, crystal championship bowls, and budget-friendly plastic cup trophies, along with customizable bases, handles in traditional loving cup style, and free personalized engraving. Available in sizes from compact 6-inch desktop cups to impressive 24-inch championship presentation pieces, trophy cup awards accommodate every budget and recognition level while maintaining classical elegance. Perfect for recognizing tournament champions, golf competition winners, fantasy league victors, sales achievement leaders, employee recognition awards, team championships, or any accomplishment deserving prestigious celebration, these cups create memorable championship moments that honor excellence and inspire continued success in sports, business, and competitive endeavors.

Expand your recognition program: Explore Place Trophies and Explore Perpetual Trophies for year-after-year recognition. Learn more: Trophy History and Traditional Significance.

Frequently Asked Questions About Cup Trophies

What is the difference between plastic and metal cup trophies?

Plastic cup trophies offer budget-friendly recognition perfect for youth sports leagues, recreational competitions, and large tournaments requiring multiple awards at affordable prices. These lightweight trophies feature gold or silver metallic finishes that look impressive while keeping costs low for bulk trophy orders. Metal cup trophies including brass cups, silver-plated cups, and pewter cups provide premium weight, superior durability, and authentic metallic finishes ideal for championship events, corporate recognition, golf tournaments, and prestigious competitions where traditional elegance matters. Crystal and glass championship bowls offer the highest level of sophistication for executive awards, major tournament champions, and lifetime achievement recognition with beautiful clarity and premium engraving capabilities.

What size cup trophy should I choose for my event?

For youth sports and participation recognition, 6-inch to 10-inch cup trophies provide appropriate sizing that young athletes can easily handle and display. For high school and recreational adult leagues, 10-inch to 14-inch cups offer substantial presence without overwhelming display spaces or budgets. Championship tournaments, corporate sales competitions, and major golf events typically feature 14-inch to 20-inch premium cup trophies that command attention and convey prestige. For ultimate recognition like league championships, grand finals, or annual company awards, 20-inch to 24-inch large championship cups create unforgettable presentation moments. Consider display location when selecting size - desk and shelf displays work best with smaller cups while lobby cases and executive offices accommodate larger statement pieces.

How should I clean and maintain silver and metal cup trophies?

For silver-plated cup trophies, use a quality silver polishing cloth or silver polish cream to remove tarnish and restore shine, working in small circular motions and avoiding harsh scrubbing that damages plating. Brass and gold-plated cups benefit from warm water with mild dish soap applied with soft cloths, followed by thorough drying to prevent water spots and oxidation. Never use abrasive cleaners, steel wool, or harsh chemicals that scratch finishes or remove protective coatings. For crystal and glass championship bowls, use glass cleaner or warm soapy water with lint-free cloths for streak-free clarity. Store trophy cups in display cases or covered locations away from direct sunlight to prevent fading and minimize tarnish buildup. Regular gentle cleaning maintains the prestigious appearance of championship cup awards for decades of proud display.

]]>
custom-pagecup-trophies-large-and-small1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophies1:14%,10:18%,50:22%,100:25%Find this popular cup figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at trophyCentral. Ships in a fast 1-2 days!qtcupplGeneral, 1st / 2nd / 3rd / Etc.custom-pagecrystalcups1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"general410187-1010.45434.45JcharlesCrystal Awards1:22%,25:24%Cup Adirondack from TrophyCentral. See our great selection of engraved and personalized gifts!custom-pagecup-trophies-large-and-small1trophies498552-312421.33Trophies1Find these cup budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtcupscbGeneralcustom-pagecup-trophies-large-and-small1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75219Quick TrophyTrophies1:14%,3:19%,10:27%Find these fabulous two-tier Cup Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtcupttGeneralcustom-pagecup-trophies-large-and-small1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.2115Quick TrophyTrophies1:14%,3:19%,10:28%See this championship trophy with a Cup figure at TrophyCentral. Be sure to see all of our Cup figure awards.qtcupttwGeneralcustom-pagecup-trophies-large-and-small1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophies1:14%,10:18%,50:24%,100:28%This popular Cup Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtcupscIn addition to our plastic cups, we have a great selection metalcup-trophies-large-and-smallGeneral, Academiccustom-pagecup-trophies-large-and-small1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451623.65Quick TrophyTrophies1:14%,10:18%,50:24%,100:28%Find Our Cup Deluxe Platform Series Trophies Discounted at TrophyCentral. Real Marble Base; Free Personalization!qtcupdmSee all of ourcup-trophies-large-and-smallGeneralcustom-pagecup-trophies-large-and-small1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophies1:14%,10:18%,50:22%,100:25%This popular Cup Figure trophy features a real marble base, column, figure and trim indicating year of award. Includes up to three lines of free engraving!qtcupyrGeneralcustom-pagecup-trophies-large-and-small1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.4118Quick TrophyTrophies1:14%,3:19%,10:24%Find These Fabulous Champions Line Cup Trophies Discounted At TrophyCentral. Fast 1-2 Day Shipping!qtcup3cGeneralcustom-pagecup-trophies-large-and-small1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453636.45TrophyCentralTrophies1:14%,10:17%,25:23%,50:29%,100:34%Our popular Cup participation trophies feature a real slant-front marble base and free engraving.qtcupncBe sure to see our fabulous selection ofcup-trophies-large-and-smallGeneralcustom-pagecrystalcups1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"general410187-1010.45436.45JcharlesCrystal Awards1:22%,25:24%"crystal awards" "Golf Trophies"The popular Cup Ranier from TrophyCentral ships in just 4-6 business days.Cupcustom-pagenew-trophies-21trophies498551-310.452429Trophies1Find our Cup star column trophy discounted at TrophyCentral. Features a real marble base, 6 inch gold star-shaped column, free engraving and fast shipping.cup-star-column-trophycustom-pagetrophies-curling1trophies498551-310.452429Trophies1Find this popular Curling trophy discounted at TrophyCentral. Features a real marble base, stylish 4-inch gold cup, free engraving and fast shipping.curling-cup-place-trophycustom-pagetrophies-curling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular curling figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at trophyCentral. Ships in a fast 1-2 days!qtcurlplCurling, 1st / 2nd / 3rd / Etc., Sportscustom-pagetrophies-curling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%This popular Curling trophy features a real marble base, column, figure and trim indicating year of award. Includes up to three lines of free engraving!qtcurlyrCurling, Sportscustom-pagetrophies-curling1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with curling figure discounted at TrophyCentral. Includes free text engraving!cup-curl-pCurling, Sportscustom-pagetrophies-curling1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these curling budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtcurlscbCurling, Sportscustom-pagetrophies-curling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous two-tier Curling Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtcurlttCurling, Sportscustom-pagetrophies-curling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.2115Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%See this championship trophy with a Curling figure at TrophyCentral. Be sure to see all of our Curling figure awards.qtcurlttwCurling, Sportscustom-pagetrophies-curling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%This popular Curling Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtcurlscCurling, Sportscustom-pagetrophies-curling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451623.65Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%These quick-ship trophies from TrophyCentral feature a Curling figure, real marble base and marble trophy figure platform, choice of column size and color.qtcurldmCurling, Sportscustom-pagetrophies-curling1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Curling figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-curl-scbCurling, Sportscustom-pagetrophies-curling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.4118Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous Curling Champions Line 3-column Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qtcurl3cCurling, Sportscustom-pagetrophies-curling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%,25:23%,50:29%,100:34%Our popular Curling participation trophies feature a real slant-front marble base and free engraving.qtcurlncCurling, Sportscustom-pagetrophies-curling1trophies498551-310.452429Trophies1Find our Curling star column trophy discounted at TrophyCentral. Features a real marble base, 6 inch gold star-shaped column, free engraving and fast shipping.curling-star-column-trophycustom-pageaward-medalsqtcurlncqtcurlscqtcurldmqtcurlyrqtcurlplqtcurlttqtcurlttwqtcurl3cmqtcurlscbcup-curl-scbcup-curl-pcurling-cup-place-column-trophycurling-cup-place-trophycurling-star-column-trophy1trophies1Curling Trophies from TrophyCentral. Most Trophies Ship in 1-2 Days and Include Engraving!TrophyCentral has been supplying curling clubs, leagues, and tournaments with quality trophies since 1999. All curling trophies include up to three lines of free engraving. Browse our complete sports trophies collection for additional styles and designs.

Curling Trophy FAQ

What types of curling trophies does TrophyCentral carry?

TrophyCentral carries a selection of curling trophies suitable for club competitions, bonspiels, and league play. Each trophy is available in multiple sizes and includes free engraving.

Can I personalize a curling trophy with player and team information?

Yes. Every curling trophy includes up to three lines of free engraving. Common engraving examples include "2025 Club Champion - John Smith" or "Lakeside Curling Club - Most Improved."

How quickly will my curling trophies ship?

Orders typically ship in 1-2 business days and sometimes the same day, depending on time of year and when the order is placed.

Are curling trophies available in bulk for a full league or bonspiel?

Yes. TrophyCentral offers quantity discounts on trophy orders. The more you order, the lower the per-unit price. Discounted pricing is shown on each product page.

What is a bonspiel trophy?

A bonspiel is a curling tournament, and bonspiel trophies are awarded to the winning team or top finishers. TrophyCentral's curling trophies work well for bonspiels of any size, from small club events to large invitational tournaments.

]]>
Curling
custom-pageaward-ribbons-rosettes1verprin1proof215"1-2 business days" "Topeka, Indiana" "UPS (Post Office Priority Mail may also be available)"465714-61 263.0010010.36Tower RibbonRibbonsRosette Ribbons1:22%,200:35%Custom 3-Streamer Rosettes and Award Ribbons at TrophyCentral. Great Selection of Ribbons and Rosettes.rosetteReturn to mainsection for more great choices!rosetteribbonsBlue Ribboncustom-pageblank-medals10medals498552-3116029.8TrophyCentralLapel Pins11:22%,25:24%,100,27%,500:30%These 2 3/4 inch insert medals feature your artwork in black on a gold flexibrass insert for a fabulous look. The price includes a neck ribbon and Fast 1-2 day shipping.custom-pagecustommedals1100"Standard Service: 8 Business Days from Receipt of Artwork, Rush Service (Extra Charge): 3 Business Days from Receipt of Artwork" "Oxnard, CA" "UPS (FedEx available on request)"medals930338-910.630033.6Simba CalMedalsGeneral1:22%,300:34%,500:49%,1000:58%"Custom Medals" "Medals, Custom" "Custom Award Medals"Find Quality 1 1/2" Custom Awards Medals at TrophyCentral.Custom Medalscustom-pageaward-ribbons-printed1proof2100"5-7 business days" "Topeka, Indiana" "UPS (FedEx available on request)"ribbons4657114-211 260.36Tower RibbonRibbonsCustom Ribbons1:22%,250:30%,500:38%"Custom Award Ribbons"Find custom badge ribbons discounted at TrophyCentral. Each custom badge ribbon is personalized with your text and artwork.cucoricustom-pagesoccerwaterbottles1150"7 business days from receipt of camera-ready artwork" "Oxnard, California" "UPS (FedEx available on request)"930307-810.45367.65PLPromotional ProductsWater Bottles1Find this 26 oz car water bottle discounted at TrophyCentral. Great pricing and fast shipping!Sports / Water Bottlescustom-pagecertificates11"6-8 business days" "Columbia, South Carolina" "UPS (FedEx available on request)"certificates290636-81 2 3 230.45618.45Certificate SourceCertificates1:22%,10:45%"Award Certificates and Diploma Covers" "Award Certificates and Diploma Holders" "Award Certificates and Diploma Frames" "Award Certificate and Diploma Holders" "Certificate and Diploma Holders" "Certificates and Frames" "Certificates and Diploma Holders" "Diploma Covers and Certificates" "Diploma Covers and Award Certificates" "Diploma Covers, Frames and Holders" "Diploma Covers, Frames, Holders and Certificates"Find a great selection of custom and personalized certificates - all discounted - at TrophyCentral! Buy online in bulk for large discounts.custom-pagepersonalizedleather-leathergifts1"4-7 w/initials or name, 10-14 w/logo , 3-5 business days for stock items, (rush service available for additional charge - please call)" "Secaucus, NJ" "UPS (FedEx available on request)"498554-710.452014.45JDS IndustriesGiftsLeather Gifts1"Leather Gifts" "Executive Gifts"Find this personalized clipboard at TrophyCentral. Each clipboard features choice of color and free custom engraving!custom-pagepersonalizedleather-leathergifts1"4-7 w/initials or name, 10-14 w/logo , 3-5 business days for stock items, (rush service available for additional charge - please call)" "Secaucus, NJ" "UPS (FedEx available on request)"498554-710.451611.65JDS IndustriesGiftsLeather Gifts1"Leather Gifts" "Executive Gifts" "Leather Portfolio Cases" "Portfolio Cases" "Leather Portfolio Case"Find these custom coaster sets discounted at TrophyCentral. Each coaster is personalized with your message!custom-pagepersonalizedleather-leathergifts1"4-7 w/initials or name, 10-14 w/logo , 3-5 business days for stock items, (rush service available for additional charge - please call)" "Secaucus, NJ" "UPS (FedEx available on request)"personalized gifts498554-710.451035.45JDS IndustriesGiftsLeather Gifts1"Leather Gifts" "Executive Gifts" "Corporate Gifts" "Custom Gifts" "Promotional Gifts" "Unique Holiday Gifts" "Unique Personalized Gifts" "Unique Custom Gifts" "Leather Portfolio Cases" "Portfolio Cases" "Leather Portfolio Case"Find these customer coasters discounted at TrophyCentral. Each coaster can be custom engraved with your artwork. Makes a great personalized gift.Bridesmaids / Groomsmencustom-pagenamebadges111240162-31Roanoke1If you are adding a logo to your custom badges a setup charge is required. The charge is based on the number of colors in you logo or artwork.1custom-pageaward-ribbons-printed11"5-7 business days" "Topeka, Indiana" "UPS (FedEx available on request)"ribbons4657114-211 260.4512040.45Tower RibbonRibbons1:22%This continuous ribbon roll is perfect for your ribbon-cutting ceremony. IF you are breaking new ground, this custom ribbon roll is just what you need!custom-pagerosetteribbonsproof1verprin125"5-7 business days, 14 business days with custom logo" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"4657114-211 260.3636014.76Tower RibbonRibbonsRosette Ribbons1:22%,50:29%,100:36%,200:41%"Custom Ribbons" "Custom Rosettes" "Custom Award Ribbons"custom-pageacademic-general-medals150"PT1=Medals" "PC11=105502-510.7513009.75Classic MedallicsMedals1:22%,100:33%,300:41%Custom Economy School Medal: Visit TrophyCentral to see this and similar Trophies and AwardsAcademiccustom-pagecustomlapel1150"4 - 6 Weeks" "Mt. Vernon, N.Y." "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins1055028-4210.451200020.45Classic MedallicsLapel PinsGeneral1:30%,5000:66%These photo etched brass lapel pins have a soft enamel and clear epoxy dome. Price includes up to 4 colors.custom-pagecorporatepins1plasticpinboxvelapinbox25105504-71Lapel Pins1Buy These Custom Fire Department Pins discounted at TrophyCentral. Each pin features a custom imprint with your fire department name!12262019Fire Department, Herocustom-pagecustomlapel1250"14 Business Days from Receipt of Artwork" "Charlotte, NC or Oxnard, CA" "UPS (FedEx available on request)"lapel pins9303314-1510.46Simba CalLapel PinsGeneral1:22%,500:29%,1000:38%,2500:46%"Custom Lapel Pins" "Lapel Pins, Custom" "Custom Trading Pins"Find Special Shaped pins discounted at TrophyCentral. Choose your shape - house, state, ice cream cone - whatever you need!fucocushpiCustom PinsColor Custom Shape Pinscustom-pagecustommedals1100"Standard Service: 8 Business Days from Receipt of Artwork, Rush Service (Extra Charge): 3 Business Days from Receipt of Artwork" "Oxnard, CA" "UPS (FedEx available on request)"medals930338-910.3730033.37Simba CalMedalsGeneral1:22%,300:40%,500:51%,1000:54%"Quick-Ship Items" "Custom Medals" "Medals, Custom" "Custom Award Medals"Quality 2 1/2" Full Color Medals - Quick Ship at TrophyCentral.custom-pagepersonalizedleather-leathergifts1"4-7 w/initials or name, 10-14 w/logo , 3-5 business days for stock items, (rush service available for additional charge - please call)" "Secaucus, NJ" "UPS (FedEx available on request)"personalized gifts498554-710.453610.53JDS IndustriesGiftsLeather Gifts1Find this custom ID holder and keychain discounted at TrophyCentral. Features choice of color and free engraved personalization.custom-pagecustommedals1100"Standard Service: 8 Business Days from Receipt of Artwork, Rush Service (Extra Charge): 3 Business Days from Receipt of Artwork" "Oxnard, CA" "UPS (FedEx available on request)"medals930338-910.4530033.45Simba CalMedalsGeneral1:22%,300:32%,500:45%,1000:57%"Custom Medals" "Medals, Custom" "Custom Award Medals"Find Quality 1 1/2" Medals with Your Custom Artwork. TrophyCentral Has a Huge Selection of Medals and Awards That Ship in Just a Few Business Days.Custom Medalscustom-page1498554-610.450.4511custom-pagegold-pins-lapelexclpiecculapifucocushpidiestbrpi5coculapidiestpobrlapphetbrlapidiestbrlapiengraveablepin1lapel-award-pins1Create unique custom pins featuring your logo or design. Perfect for branding, schools, clubs, and organizations looking for a personalized touch. Also find blank pins for engraving.

Custom Lapel Pins - Your Logo, Your Design, Your Brand

Custom lapel pins are one of the most versatile and cost-effective recognition and branding tools available, combining a small footprint with a lasting impression that recipients wear, collect, and keep for years. From corporate organizations ordering branded employee recognition pins that reinforce company culture and reward milestones like years of service, sales achievement, and perfect attendance, to school booster clubs producing spirit pins featuring a beloved mascot for fundraising campaigns, from youth baseball and softball leagues where custom trading pins are a cherished tournament tradition that players collect and swap with competitors from across the country, to nonprofit associations, civic groups, and volunteer programs where a custom pin honors service and builds community identity, quality custom lapel pins deliver a personal touch that generic awards cannot replicate. Our selection covers the full range of production styles including fast-ship cloisonart pins for time-sensitive orders, die-struck brass and brass finish pins for a classic polished look suited to corporate and leadership recognition, full-color and special shape pins capable of reproducing complex logos and detailed artwork with precision, four-color photo pins for photographic imagery and portraits, custom trading pins for sports tournaments, and custom enamel pins for a vibrant finished product that holds up to years of wear. Pricing drops significantly with quantity, making custom pins an affordable choice for programs of any size.

Frequently Asked Questions About Custom Lapel Pins

What is the difference between the custom pin styles available?

Cloisonart pins are the fastest option, shipping quickly with a personalized design, and are ideal when turnaround time matters more than production complexity. Die-struck brass pins are made from stamped metal with a recessed design and a premium traditional appearance well suited to corporate recognition, service awards, and formal organizational use. Full-color and special shape pins use a printing process that reproduces detailed logos, gradients, and photography with high accuracy, making them the right choice when artwork complexity or a custom outline shape is important. Custom trading pins are larger and more decorative, designed specifically for the youth sports tournament trading tradition. Custom enamel pins combine colored fill with a metal border for a vibrant, durable finished product popular for brand merchandise, school spirit, and event keepsakes.

How long does it take to produce custom lapel pins?

Production time varies by pin style. Our fast-ship cloisonart pins are the quickest option for personalized orders with shorter lead times. Standard custom pin styles including die-struck, full-color, enamel, and trading pins typically require several weeks from artwork approval to delivery, as they are manufactured to order. It is best to look at each product's details for estimated turnaround times. We recommend ordering as early as possible for event-specific deadlines, and contacting us if you have a firm date so we can confirm whether your timeline is achievable before you place your order.

What file format do I need to submit for custom pin artwork?

For the best results, vector artwork files in AI, EPS, or PDF format are preferred, as they scale without loss of quality and allow our production team to work with clean, precise lines and colors. High-resolution raster files such as PNG or JPEG at 300 DPI or higher are acceptable for photo pins and full-color designs. Low-resolution images pulled from websites typically do not produce good results. If you only have a low-resolution file, contact us before ordering and we can advise whether your artwork is suitable or suggest alternatives.

If you need more information before deciding, see our expert resource section:
]]>
custommedals
custom-pagepersonalizedleather-leathergifts1"4-7 w/initials or name, 10-14 w/logo , 3-5 business days for stock items, (rush service available for additional charge - please call)" "Secaucus, NJ" "UPS (FedEx available on request)"498554-710.451611.65Royce LeatherGiftsLeather Gifts1"Leather Gifts" "Executive Gifts"Find these personalized photo frames discounted at TrophyCentral. Features choice of color and free custom engraving!custom-pagepersonalizedleather-leathergifts1"4-7 w/initials or name, 10-14 w/logo , 3-5 business days for stock items, (rush service available for additional charge - please call)" "Secaucus, NJ" "UPS (FedEx available on request)"personalized gifts498554-710.452014.45JDS IndustriesGiftsLeather Gifts1"Leather Gifts" "Executive Gifts"Find this custom passport holder discounted at TrophyCentral. Leatherette holder features choice of color and free custom engraving!11Learn how to choose the perfect custom medals for your event or tournament. Explore different styles, designs, and customization options to make your awards unique and memorable.custom-page50"4-6 weeks" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"medals1055028-4210.75130039.75Medals1:22%,500:24%Visit TrophyCentral for a great selection of insert medals and stock award medals in a variety of styles.custom-pagerunning-trophiesqushcumemedals1medals211fucocumeqcm-20qcm-28qcm-3qcm-31qcm-38qcm-48qcm-53qcm-8m155m155sm155bm163gm163sm163bm157gm157sm157bm156gm156sm156bm162gm162sm162bm163bamewri1award-medals1Design your own custom medals at TrophyCentral. Choose from many popular styles. Each custom medal features a free neck ribbon.

Custom Medals - Personalized Awards for Sports, Schools, and Organizations

Custom medals transform a standard award into a personalized keepsake that recipients connect directly to their specific achievement, team, or event. Where stock medals offer a generic design that works for any occasion, custom medals feature your organization's logo, your event name, your team colors, or your own artwork on the face of the medal, creating something participants will keep and display long after the competition ends. TrophyCentral offers multiple custom medal formats to fit different budgets, timelines, and design goals, from fast-shipping mylar insert medals ideal for leagues that need a quick turnaround to full color printed medals and die-cast options featuring your complete custom artwork. Every custom medal includes a free neck ribbon, and gold, silver, and bronze finishes allow programs to present a complete podium set with consistent branding across all three levels of recognition.

Frequently Asked Questions About Custom Medals

What is the difference between the custom medal options?

Custom mylar insert medals are the fastest and most affordable option, featuring a printed paper or mylar disc inserted into a standard medal frame. You submit your logo, artwork, or event design and it prints in full color on the insert, making this style ideal for leagues and tournaments that need a personalized medal quickly and in volume. Full color custom medals print your design directly onto the medal surface in vibrant color, producing a more polished finished product appropriate for events where presentation quality matters. Custom artwork medals use your submitted design to create a medal where the imagery is cast or etched into the medal itself rather than printed, resulting in a more premium, dimensional look suited for flagship events, championships, and corporate recognition programs. Custom ring medals take a different approach, featuring a sport-specific design on the medal face with your school, team, or organization name printed around the outer ring, making them a great middle-ground option that adds personalization without requiring a full custom design submission. Choosing between these formats comes down to budget, timeline, and how prominently your branding needs to appear on the finished medal.

What artwork or information can I include on a custom medal?

Custom medals accommodate a wide range of personalization depending on the format selected. Logo-forward designs work well for organizations that want their crest, mascot, or brand mark as the centerpiece of the medal, making the award immediately identifiable as belonging to a specific league, school, or company. Event-specific designs incorporate the tournament or competition name, year, and location, turning the medal into a commemorative piece that captures a specific moment rather than a generic achievement. Sport or activity imagery combined with organization text suits multi-division tournaments where the same medal design is used across age groups, with consistent branding tying the full event together. For the back of the medal, optional engraving adds individual recipient names, place finishes, or division details that make each medal specific to the person receiving it. When submitting artwork, high-resolution vector files produce the sharpest results, though most custom medal options accept standard image formats. If you do not have a logo or finished design, our team can assist with basic layout to get your event information formatted correctly for production.

How far in advance should I order custom medals?

Custom mylar insert medals ship within 3 to 8 business days after order placement and artwork approval, making them practical even for events planned on a shorter timeline. Full color custom medals typically require 8 business days of production time after artwork is approved. Custom artwork medals with cast or etched designs involve a longer production window, so ordering several weeks ahead is advisable for those styles, particularly for large quantities. For any custom medal order, the artwork approval step is the most important factor in hitting your deadline: submitting clean, print-ready files at the time of ordering eliminates back-and-forth and keeps production on schedule. Ordering 3 to 4 weeks before your event date provides a comfortable buffer for most custom styles while still allowing time to address any artwork questions. For very large orders or events with fixed dates like championship weekends or graduation ceremonies, reaching out early gives you the most options in terms of medal style, quantity, and any special requests.

If you need more information before deciding, see our expert resource section:
]]>
customlapel
custom-pageaward-ribbons-rosettes1customlogoproof225"5-7 business days" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"4657114-211 260.3636014.76Tower RibbonRibbons1:22%,3:24%,100:27%Find these custom mini rosette ribbons at TrophyCentral. Add your own text and artwork to these mini rosettes!mini rosettes, mini rosette ribbons, custom mini-rosettes, custom mini rosette ribbonsClick here to see our mainsection and for more fabulous choices!custom-pagecustommedals1100"Standard Service: 8 Business Days from Receipt of Artwork, Rush Service (Extra Charge): 3 Business Days from Receipt of Artwork" "Oxnard, CA" "UPS (FedEx available on request)"medals930338-910.37Simba CalMedalsGeneral1:22%,300:40%,500:50%,1000:60%"Quick-Ship Items" "Custom Medals" "Medals, Custom" "Custom Award Medals" "New Product" "New Products"Shop for Medals - Mylar at TrophyCentral. Fast 1-2 Day Shipping on Medals!Custom Medalscustom-pagepersonalizedleather-leathergifts1"4-7 w/initials or name, 10-14 w/logo , 3-5 business days for stock items, (rush service available for additional charge - please call)" "Secaucus, NJ" "UPS (FedEx available on request)"personalized gifts498554-710.451611.65JDS IndustriesGiftsLeather Gifts1"Leather Gifts" "Executive Gifts"Find this personalized note jotter discounted at TrophyCentral. Each jotter features choice of color, pen and free custom engraved message!custom-pageaward-ribbons-printed1proof2100"5-7 business days" "Topeka, Indiana" "UPS (FedEx available on request)"ribbons4657114-211 260.36100030.36Tower RibbonRibbons1Quality Overlay Award Ribbons from TrophyCentral. Discounted Trophies, Awards and Promotional Products.Red White Blue, Patrioticcustom-pagesashes12ribbons1sashes"5-7 business days (rush available on request)" "Topeka, Indiana" "UPS (Post Office Priority Mail also available)"4657114-211 260.51008.5Tower RibbonSpiritSashes1:22%,25:24%"Homecoming Sashes" "Sashes" "Homecoming Sash" "School Sashes" "Pageant Sashes" "Custom Sashes" "Beauty Pageant Sashes" "Graduation Sashes" "Pageant Sash" "Prom Sashes" "Prom Sash"Find these Custom Children's Pageant Sashes Discounted at TrophyCentral. Each Children's Sash Features Choice of Color, Event Name and More! Fabulous Prices.sashescustom-pagesacsi12ribbons1trophies-beauty-queen sacsi"5-7 business days (rush available on request)" "Topeka, Indiana" "UPS (Post Office Priority Mail also available)"4657114-211 260.551008.55Tower RibbonSpirit1:22%,25:26%"School Products" "Homecoming Sashes" "Sashes" "Homecoming Sash" "School Sashes" "Pageant Sashes" "Custom Sashes" "Beauty Pageant Sashes" "Graduation Sashes" "Pageant Sash" "Prom Sashes" "Prom Sash"Find Custom Parade, Homecoming, and Pageant Sashes Discounted At TrophyCentral. Each Sash Features Your Choice of Color and Imprint. Great Prices!sashescustom-pagetrophies-cheerleading-spirit1muim250award-ribbons-rosettes"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Texas" "UPS (FedEx available on request)"ribbons774537-1410.4510020.45PepcoSpiritSpirit1:14%,250:24%,500:37%,1000:48%Root for the home team! Custom pennants from Trophy Central ensure you're always showing your team colors. Order your personalized pennants today!Spirit11Your complete guide to buying custom pennants! Learn about materials, sizes, designs, and budget tips for schools, sports teams, and special events. Expert advice from TrophyCentral.11Get expert answers on custom pennants for teams and schools. Learn about sizes, materials, customization options, minimums, and funding strategiescustom-pagecustomlapel1100"4 - 6 Weeks" "Mt. Vernon, N.Y." "UPS (FedEx available on request)"lapel pins1055028-4210.451200020.45Classic MedallicsLapel PinsGeneral1:22%,1000:67%"Custom Lapel Pins" "Custom Trading Pins"Die Struck, Soft Epoxy Enameled Pins (brass or copper base). TrophyCentral is a Top-Rated Yahoo Merchant.diestpobrlapCustom Pinscustom-pageribbons1sohapopompomrooterpoms11Find custom pom poms discounted at TrophyCentral. Each cheer pom pom can be personalized with a school logo or text.seatcushions ribbons1-tiaras ribbons1-crownsgifts-desk-general11Find Leather Padfolios at TrophyCentral. Custom Padfolios Include Your Initials or Monogram. Each Padfolio includes a note pad.custom-pageaward-ribbons-printed1verprinproof2100"5-7 business days, 14 business days with custom logo (Rush service may be available)" "Topeka, Indiana" "UPS (Post Office Priority Mail may also be available)"ribbons4657114-211 260.36Tower RibbonRibbons1:22%,500:31%,1000:45%,5000:60%Find These Fabulous Custom Event Card Ribbons Discounted At TrophyCentral. Choice of Fishtail or Flat Top. Includes Your Text And Logo!Custom-Ribbons-Event-CardRed White Blue, Patriotic, Red Ribbon, Blue Ribbon1award-ribbons-rosettes1Design custom ribbons for schools, events and competitions. Personalized ribbons with fast shipping, bulk pricing and easy ordering from TrophyCentral.Shop for Personalized Award Ribbons with Your Text & Artwork TrophyCentral has an industry-leading selection of custom ribbon awards to meet all of your needs. If you are looking for quality ribbons that you design, you have come to the right place! Each custom order features your choice of ribbon size, color, wording and graphics! Be sure to see our customer favorites including: Ribbons with Card & String and Custom Flat Ribbons. We also have a great selection of Badge Ribbons, perfect for your next conference or event.

Shop with Confidence at TrophyCentral!

Our top-rated representatives are happy to assist you with all of your custom ribbon needs. Our experts in New York and Michigan have been providing suggestions and guidance since 1999! To start shopping, click on an image above, or for personal service, call us toll-free at 1-888-809-8800.]]>
11Custom Award Ribbons: Custom Ribbons Proof Also see our great selection of engraved and personalized gifts!1custom-pagecusminwfunbu1114-2111 2 3 4 5 6 7 8 9Tower RibbonsRibbonsRosette Ribbons1:0%Have a proof sent to you either by email or fax prior to printing your custom rosette ribbons. A proof will ensure wording and formatting meets your requirements.111Buy these unique custom ring medals at TrophyCentral. Each medal has a personalized outer ring and a neck ribbon!1custom-pagecustom-pom-poms1muimse1100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Texas" "UPS (FedEx available on request)"7745310-1410.453611.25PepcoSpiritSpirit1Find these Rooter Poms at TrophyCentral. Poms may be personalized.Spiritcustom-pagecusrossinstr114657114-211 2611 2 3 4 5 6 7 8 9Tower RibbonRibbons1:0%This Feature Allows You to Add a Custom Button to your Rosette Ribbon for a Small Charge. TrophyCentral is a Top-Rated Yahoo Merchant.111Buy custom rubber stamps discounted at TrophyCentral. Each rubber stamp includes your custom text.Choose from our stock rubber stamps or custom rubber stamps.

]]>
custom-pageaward-ribbons-rosettes1proof2adcharforcusverprin125"5-7 business days, 14 business days with custom logo" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"ribbons4657114-211 261.005013.5Tower RibbonRibbons1:22%,50:28%,100:32%"Black Ribbons" "Customized Ribbons" "Pink Ribbons" "Red Ribbons" "Yellow Ribbons" "Blue Ribbons" "Custom Award Ribbons" "Rosette Ribbons" "Custom Ribbons" "Printed Ribbons" "Ribbon Awards" "Award Ribbon"Find a great selection of single streamer rosettes at TrophyCentral. Add your own artwork, logo and text to this custom 1-streamer rosette ribbon.custom-pagesoccerwaterbottles1150"7 business days from receipt of camera-ready artwork" "Oxnard, California" "UPS (FedEx available on request)"930307-810.45367.65PLPromotional ProductsWater Bottles1:14%,250:28%,500:47%Custom Soccer Water Bottles. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Sports / Water Bottlescustom-pageribbons112x12x1vicu14sq11thvicu14sq2thvicu14sq21thvicuvichco11

Shop For Custom Sports Seat Cushions With Confidence at TrophyCentral

We offer a huge selection, discounted prices and great custom service. Do you need help with some ideas or with ordering? Yes, we sell online, but we have real people who would love to help you! Feel free to call our customer service experts in Michigan, New York and online. TrophyCentral - delivering smiles since 1999!


]]>
custom-pagecustomlapel1300"4 - 6 Weeks" "Mt. Vernon, N.Y." "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins1055028-4210.451200080.45Classic MedallicsLapel PinsGeneral1:30%,1000:63%"Custom Lapel Pins" "Lapel Pins, Custom" "Custom Trading Pins"Find these soft epoxy enameled custom designed pins discounted at TrophyCentral. Each custom designed pin includes your choice of artwork and colors.ecculapi11Shop custom trophies, plaques, and medals in New York. Free engraving, fast shipping, and trusted service for schools, sports teams, and businesses.custom-pageofficesigns11240162-310.55183.43RoanokeSpirit1Find Versa date stamps and custom rubber stamps at TrophyCentral.com. Discounted prices on all custom stamps.custom-pagepersonalized-giftscospwabobottles-albottles-stecspbowinebibocardrinkbottlespwaboheduwabobottles2bottles12480xgla190xgla7200xgla11Find Custom Water Bottles discounted at TrophyCentral. Perfect for Baseball, Soccer and any sports player! Each Custom Water Bottle Includes a Logo.

Custom Sports Water Bottles - Personalized Team Bottles for Every Sport and Event

Custom sports water bottles have become one of the most popular team gifts and participant awards in youth and recreational sports because they solve a recognition problem that trophies and medals cannot: every player on the team gets something they will use every single day rather than display on a shelf. A water bottle with a team logo, player name, or season details travels with the athlete to every practice, game, and school day, turning a practical item into a rolling advertisement for team pride and a daily reminder of the season. Our custom water bottle collection covers the three materials that coaches, league directors, and event coordinators reach for most often: stainless steel for teams that want a premium feel and long-term durability, aluminum for a lightweight option that balances quality with budget-friendly pricing, and plastic for large volume orders where maximum affordability across a full roster or event participant list is the priority. Each bottle can be customized with a team logo, player name, team name, and season year, making end of season banquets, tournament participant gifts, and league opening day giveaways more memorable with a personalized item every recipient will actually use.

Frequently Asked Questions About Custom Sports Water Bottles

What is the difference between stainless steel, aluminum, and plastic custom water bottles?

Stainless steel water bottles are the premium option, offering superior durability, double-wall insulation that keeps drinks cold for hours, and a substantial feel that communicates quality when a team gift needs to impress. They hold up to the daily abuse of a sports bag and look great after a full season of use, making them the right choice when the bottle is meant to be a keepsake gift rather than just a functional item. Laser engraving on stainless steel produces a permanent, high-contrast mark that will not fade, scratch off, or peel the way printed or pad-printed decoration sometimes does with heavy use. Aluminum water bottles offer a lightweight alternative with a similar premium metallic appearance at a lower price point, making them popular for teams that want a quality team gift without the full cost of stainless. They are suitable for engraving and produce a clean, professional finished product appropriate for end of season gifts, tournament awards, and coach appreciation presents. Plastic water bottles are the practical choice for large volume orders where the goal is to put a customized team bottle in every player's hands at an accessible per-unit cost. They work well for registration day giveaways, fundraiser items, and youth programs where the bottle will be used hard and replaced regularly rather than kept as a long-term keepsake. Custom printing on plastic bottles allows for full color team logos and artwork that stainless and aluminum engraving cannot replicate, making plastic the better choice when color accuracy and logo fidelity matter more than the premium feel of metal.

What sports and events are custom water bottles most commonly used for?

Custom water bottles work across virtually every youth and recreational sport because hydration is universal and a personalized bottle travels with the athlete everywhere the sport takes them. Soccer, baseball, softball, basketball, swimming, track and field, lacrosse, and volleyball teams all use custom bottles as end of season team gifts and tournament participation awards, with the bottle serving as a practical complement to trophies and medals that stays useful long after the season ends. School athletic programs use custom water bottles as welcome gifts for new team members at the start of the season, creating immediate team identity and ensuring every athlete has a quality bottle for practice and games. Fundraising programs use custom bottles as premium merchandise items that supporters purchase to show team or school spirit, generating revenue while putting branded items in the community. Run and walk events, charity tournaments, and multi-sport field days use custom bottles as participant gifts because they are gender-neutral, universally useful, and travel home from the event in a backpack rather than requiring special carrying accommodations. Corporate sports teams, adult recreational leagues, and company wellness programs also use custom water bottles as team gifts that reinforce group identity and encourage the healthy habits the program is designed to promote.

Should I customize water bottles with a team logo, player names, or both?

The choice between team logo, individual player names, or a combination depends on your budget, the purpose of the bottle, and how personal you want the gift to feel. Team logo customization alone produces a clean, professional result that works well for large orders where individual personalization would significantly increase cost and production time, and where the primary goal is team identity rather than individual recognition. This approach suits registration gifts, fundraiser merchandise, and event participant giveaways where the bottle represents the team or event rather than a specific individual. Adding individual player names transforms the bottle from a team item into a personal keepsake, which increases both the cost and the emotional value of the gift. Player-named bottles are most appropriate for end of season team gifts and tournament awards where the goal is genuine individual recognition and the budget accommodates the additional personalization. A practical middle ground is to combine a team logo on one side of the bottle with the player number or jersey number on the other, creating a personalized feel without requiring a unique name text for every bottle in the order. Season year and team name engraved beneath the logo adds context that makes the bottle a dated keepsake of a specific season rather than a generic team item, which increases its value as a gift without requiring individual name customization. See our complete collection of engraved gifts and trophies and awards for additional team recognition options that pair well with custom water bottles at end of season celebrations.

If you need more information before deciding, see our expert resource section:
]]>
Water Bottles
custom-pagetagsbadgesnamebadges-rectnamebadges-sqrnamebadges-rndnamebadges-rndnnamebadges-ovlnamebadges-heartnamebadges-starnamebadges-pumkinnamebadges-classofnamebadges-sunnamebadges-stopnamebadges-applenamebadges-booknamebadges-housenamebadges-bulbnamebadges-toothnamebadges-texasnamebadges-usnamebadges-votenamebadges-pennantnamebadges-footballnamebadges-basketballnamebadges-golfnamebadges-footbball2namebadges-megaphonenamebadges-class11Find custom-shaped badges ideal for fundraisers and school spirit. Each badge can be personalized and features a pin back.custom-pagerosecx11498554-611 2 3 4 5 6 7 8 9TrophyCentral1:0%Use this option to request a proof of your artwork and text layout for your custom ribbons and rosettes. TrophyCentral can fax or email proof per your request.1custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these high-quality Customer Service Inserts at TrophyCentral. Each Customer Service Insert can be used to create a unique plaque, medal or trophy.51779112-20-2020Business
custom-pagecrystalcups11"15 business days w/engraving" "Mt. Vernon, NY" "UPS (FedEx available on request)"general1055015-16121426Classic MedallicsCrystal Awards1:30%,5:33%Find Crystal Vases discounted at TrophyCentral. Each cut crystal vase includes text engraving.Leadership, Golf, Tennis, Sportscustom-pagecrystalcups1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"general410187-1010.45432.45JcharlesCrystal Awards1:22%,25:25%"crystal awards" "Golf Trophies"Find the Myriad Award discounted at TrophyCentral. This beautiful award is hand-blown, hand cut and polished,custom-pagetrophies-bicycle-cycling1trophies498551-310.452429Trophies1Find this popular Cycling trophy discounted at TrophyCentral. Features a real marble base, stylish 4-inch gold cup, free engraving and fast shipping.cycling-cup-place-trophycustom-pagetrophies-bicycle-cycling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular bicycle (bike) figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at trophyCentral. Ships in a fast 1-2 days!qtbikeplBicycling / Cycling, 1st / 2nd / 3rd / Etc.custom-pagetrophies-bicycle-cycling20medals498554-Feb0.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful Cycling 2" Epoxy-covered insert decal discounted at TrophyCentral. Fast 1-2 day shipping.Bicycling / Cycling, Sportscustom-pagetrophies-bicycle-cycling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular cycling year trim trophy discounted at trophyCentral. Available in multiple sizes and includes free personalization.qtbikeyrSee morechoices for your team and event needs.trophies-bicycle-cyclingBicycling / Cycling, Sportscustom-pagetrophies-bicycle-cycling1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with biker figure discounted at TrophyCentral. Includes free text engraving!cup-bike-pBicycling / Cycling, Sportscustom-pagefree-sports-templates1"Download Only"free-sports4985501Trophy CentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Cycling template is free and designed exclusively for Trophy Central. Cycling certificate templates measure 11" x 8 1/2" and can be easily downloaded and printed.cycling-certificatecycling-frCyclingcustom-pagetrophies-bicycle-cycling1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Cycling Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Bicycling / Cycling, Sportscustom-pagetrophies-bicycle-cycling1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these bicycle budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtbikescbBicycling / Cycling, Sportscustom-pagetrophies-bicycle-cycling1trophies498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Cycling insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-Cycling-InsertBicycling / Cycling, Sportscustom-pagetrophies-bicycle-cycling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous Bicyclist Winners Line Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qtbikettBicycling / Cycling, Sportscustom-pagetrophies-bicycle-cycling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.2115Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%See this championship trophy with a Bicycle figure at TrophyCentral. Be sure to see all of our Bicycle figure awards.qtbikettwBicycling / Cycling, Sports11Recognition ideas for bike clubs, youth programs, and racing teams with 30+ award categories celebrating riders, volunteers, and skill development.custom-pagetrophies-bicycle-cycling1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Cycling single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - CyclingBicycling / Cycling, Sportscustom-pagetrophies-bicycle-cycling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:32%Find these popular Bicycle single column trophies discounted and with free personalization at TrophyCentral.qtbikesc01-25-2012Bicycling / Cycling, Sportscustom-pagetrophies-bicycle-cycling1trophies498551-311821.06TrophyCentralTrophies1Bicycling / Cycling, Sportscustom-pagetrophies-bicycle-cycling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451623.65Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%These quick-ship trophies from TrophyCentral feature a Bicycle figure, real marble base and marble trophy figure platform, choice of column size and color.qtbikedmBicycling / Cycling, Sportscustom-pagetrophies-bicycle-cycling1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Bicycle figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-bike-scbBicycling / Cycling, Sportscustom-pagetrophies-bicycle-cycling1trophies498551-310.71217.38Trophies1Bicycling / Cycling, Sportscustom-pagetrophies-bicycle-cycling1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Cycling Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Bicycling / Cycling, Sportscustom-pagetrophies-bicycle-cycling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.4118Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous two-tier, 3-column champion Bicycle Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtbike3cBicycling / Cycling, Sportscustom-pagetrophies-bicycle-cycling1medals498553-Feb0.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this colorful Cycling insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Bicycling / Cycling, Sportscustom-pagetrophies-bicycle-cycling1medals498553-Feb0.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this Cycling insert medal with a personalized front rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Bicycling / Cycling, Sportscustom-pageplaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these cycling insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Bicycling / Cycling, Sportscustom-pagetrophies-bicycle-cycling1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our cycling insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - CyclingBicycling / Cycling, Sportscustom-pagetrophies-bicycle-cycling1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%,25:23%,50:29%,100:34%Our popular Bicycle Participation Trophies feature a real slant-front marble base and free personalization. Significant quantity discounts available.qtbikencReturn to ourcategory for more great choices.trophies-bicycle-cycling01-25-2011Bicycling / Cycling, Sportscustom-pagetrophies-bicycle-cycling1plaques498552-41JDSPlaques1Find this Cycling Plaque discounted at TrophyCentral. Our cycling plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Bicycling / Cycling, Sportscustom-pagetrophies-bicycle-cycling1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Cycling Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Bicycling / Cycling, Sportscustom-pagetrophies-bicycle-cycling1trophies498551-310.452429Trophies1Find our Cycling star column trophy discounted at TrophyCentral. Features a real marble base, 6 inch gold star-shaped column, free engraving and fast shipping.cycling-star-column-trophycustom-pagetrophies-bmxcycling-award-plaquecycling-plaque-icycling-ei1trophies1Find a great selection of Bicycle (Cycling) Trophies at TrophyCentral. Each Bicycle Trophy and Award includes free engraving.

Custom Cycling Trophies & Awards - Honor Every Rider and Champion

Cycling trophies celebrate the endurance, strategy, and competitive drive that define one of the world's most demanding and rewarding sports. From youth recreational rides introducing young cyclists to the joy of competition, to club criteriums and road races where every second counts, from charity century rides bringing communities together to amateur stage races where riders push their limits across multiple days, quality cycling awards recognize riders, teams, and organizers across every level of the sport. Our versatile trophies feature dynamic cyclist figurines capturing riders in full sprint and climbing positions, sleek acrylic trophies available in multiple color stripes that complement any team kit, traditional single column and two-tier designs suited to podium presentations and banquet ceremonies, and customizable engraving plates documenting finishing times, race placements, course records, and the season achievements that every cyclist works hard to earn.

Cycling Medals

In addition to trophies, we offer a wide selection of cycling medals perfect for gran fondos, charity rides, multi-category races, and large participation events where every rider deserves recognition. Choose from classic gold, silver, and bronze finishes along with sport-specific designs featuring bicycle imagery, with optional engraving to personalize each award. Every cycling medal includes a free neck ribbon with many offering a choice of ribbon color, making them a practical and budget-friendly choice for clubs, racing series, and community cycling events of any size. Orders without engraving typically ship within one to two business days.

Frequently Asked Questions About Cycling Trophies

What trophy sizes work best for different cycling award categories?

Participation awards for charity rides, gran fondos, and youth events work well as 6-inch to 9-inch economy trophies or medals, providing affordable recognition for every rider who completes the course without straining an event budget. Category placements and division awards such as age group winners, sprint champions, and most improved riders deserve 10-inch to 14-inch single column trophies with cyclist figurines, creating meaningful individual recognition within a larger competitive field. Overall podium finishers and division champions warrant 15-inch to 18-inch premium trophies with substantial presence befitting a strong performance across a full race or series event. Club championships, stage race titles, and end-of-season series winners demand 20-inch to 24-inch multi-column championship trophies with the height and weight that reflect the achievement of winning it all. Acrylic trophies in team colors make a distinctive alternative for clubs seeking a modern award that stands out on any shelf or display case.

What details should cycling trophy engraving include?

Comprehensive engraving preserves race memories beyond fading finish line photos. Essential elements include rider name, award title, event or club name, and year. Examples: Carlos Mendez, Overall Champion, Lakeshore Criterium Series, 2025 or Sarah Whitfield, Women's Age Group Winner, Ridgeline Gran Fondo, Summer 2025. Performance achievements gain impact through specific details like Finishing Time 4:32:18 or Course Record when space permits. Stage race and series championships benefit from noting the number of events completed such as Series Champion, 6-Stage Race. Team awards should include the full team name alongside individual rider recognition. Keep text concise and readable, prioritizing the most meaningful details when space limitations require choices.

How should cycling events structure awards across recreational and competitive riders?

Recreational and charity events benefit from universal finisher recognition where every participant receives a medal or small trophy, celebrating the personal achievement of completing the course and building loyalty to the event year over year. This is especially effective for gran fondos, century rides, and youth cycling programs where the experience of finishing matters as much as placement. Competitive club races and sanctioned events appropriately shift toward merit-based awards with trophies reserved for podium finishers, category winners, and special achievement honors, reflecting the serious nature of the competition. Events serving both recreational and competitive riders in the same day often find the best results by combining finisher medals for all participants with trophies reserved for category and overall winners, maintaining broad inclusivity while ensuring that competitive titles carry the distinction that serious cyclists expect.

If you need more information before deciding, see our expert resource section:
]]>
1st-place-medalsBiking / Cycling
custom-pagebottles-al80"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14142013Glass AmericaPromotional ProductsSports / Water Bottles1:14%,640:35%"Basketball Water Bottles" "Logo Sports Bottles" "Sports Bottles" "Promotional Sports Bottles" "Aluminum Sports Bottles" "Stainless Water Bottles" "Aluminum Water Bottles" "Bike Water Bottles" "Bicycle Water Bottles" "Baseball Water Bottles" "Football Water Bottles" "Promotional Water Bottles" "Soccer Water Bottles"Cyclist Collection Aluminum Water Bottle - White.51060Sports / Water Bottlescustom-pagebottles-al80"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14142013Glass AmericaPromotional ProductsSports / Water Bottles1:14%,640:35%Find These Blue Cyclist Collection Aluminum Water Bottles Discounted At TrophyCentral. Price Includes 1-Color Custom Imprint!51084Sports / Water Bottlescustom-pagebottles-al80"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14142013Glass AmericaPromotional ProductsSports / Water Bottles1:14%,640:35%Find These Green Cyclist Collection Aluminum Water Bottles Discounted At TrophyCentral. Price Includes 1-Color Custom Imprint!51079Sports / Water Bottlescustom-pagebottles-al80"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14142013Glass AmericaPromotional ProductsSports / Water Bottles1:14%,640:35%Find These Red Cyclist Collection Aluminum Water Bottles Discounted At TrophyCentral. Price Includes 1-Color Custom Imprint!51076Sports / Water Bottlescustom-pagebottles-al80"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14142013Glass AmericaPromotional ProductsSports / Water Bottles1:14%,640:35%Find These Silver Cyclist Collection Aluminum Water Bottles Discounted At TrophyCentral. Price Includes 1-Color Custom Imprint!51070Sports / Water Bottlescustom-pagemedallion-inserts-organizations12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsReligious1:22%Buy these high-quality C.Y.O. Inserts at TrophyCentral. Each C.Y.O. Insert can be used to create a unique plaque, medal or trophy.511502Religious
custom-pageletter-shaped-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoName Badges1Find these popular D-shaped custom mascot badges at TrophyCentral. Great for fundraising! TrophyCentral is a top-rated Yahoo merchant.letterbadges-dcustom-pagedancemedals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105502-41130025Classic MedallicsInsertsMusic, Drama, Art, Dance1:22%"Award Medals" "Art / Dance / Drama Medals" "Award Medals - All Subjects" "Dance Awards"Buy these quality Dance (Modern) Inserts (Litho) at TrophyCentral. Each Dance (Modern) Insert can be used to create a unique plaque, medal or trophy.507399Dance
custom-pagetrophies-dance1trophies498551-310.452429Trophies1Find this popular Dance trophy discounted at TrophyCentral. Features a real marble base, stylish 4-inch gold cup, free engraving and fast shipping.dance-cup-place-trophycustom-pagetrophies-dance1trophies498552-311622.85TrophiesMusic, Drama, Art, Dance1Find this popular dance figure award with 1st, 2nd or 3rd place trim, a marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!mqt-dancer-plDance, 1st / 2nd / 3rd / Etc.custom-pagetrophies-dance1medals498551-30.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful Dance 2" Epoxy-covered insert decal discounted at TrophyCentral. Fast 1-2 day shipping.Dancecustom-pagetrophies-dance1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-310.451622.85Quick TrophyTrophiesMusic, Drama, Art, Dance1:14%,10:18%,50:22%,100:25%"Dance Trophy" "Trophies, Dance" "Dancing Trophies" "Trophies, Dancing"This popular Dance Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!qtdanceyrDancecustom-pagetrophies-dance1trophies498552-311821.06TrophiesMusic, Drama, Art, Dance1Find this achievement cup trophy with dance figure discounted at TrophyCentral. Includes free text engraving!cup-dancer-pDancecoaching-teaching-guides1trophies-dance1Creative dance award ideas with engraving examples for recitals and competitions. From Prima Ballerina to Hip Hop Hero, discover 15+ unique ways to recognize dancers with actual trophy wording templates.custom-pagetrophies-dance1medals105502-41130025Classic MedallicsInsertsMusic, Drama, Art, Dance1:22%"Award Medals" "Art / Dance / Drama Medals" "Award Medals - All Subjects" "Dance Awards"Buy these quality Dance Ballet Inserts (Litho) at TrophyCentral. Each Dance Ballet Insert can be used to create a unique plaque, medal or trophy.501241Dancecustom-pagetrophies-dance1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Dance Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Dancecustom-pagetrophies-dance1trophies498552-312421.33TrophiesMusic, Drama, Art, Dance1Find these dance / jazz budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqt-dancer-scbDancecustom-pagetrophies-dance1498552-313633.4TrophiesMusic, Drama, Art, Dance1Find this budget dance / jazz award trophy discounted at Trophy Central. Features a real marble base and plastic dancer figure. Engraving is free. Fast 1-2 day shipping.bdg-dancerDancecustom-pageawardcertificates115qtdancenc"1-3 business days" "Columbia, South Carolina; Marquette, Michigan" "UPS (FedEx available on request)"certificates290631-21 2 3 230.45100020.45Certificate SourceCertificatesAward Certificates1:22%,50:38%,100:42%"Dance Awards"Find these Dance certificates discounted at TrophyCentral. Each Dance certificate measures 8 1/2 x 11 inches and typically ships in 1-2 days.7036Dancecustom-pagetrophies-dance1trophies498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Dance insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-Dance-InsertDancecustom-pagetrophies-dance1trophies498552-31219TrophiesMusic, Drama, Art, Dance1Find these fabulous two-tier Dance Three-Column Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!mqt-dancer-ttDancecustom-pagetrophies-dance1trophies498552-31115TrophiesMusic, Drama, Art, Dance1Find this championship trophy with a Dance figure discounted at TrophyCentral. Fast 1-2 day shipping.mqtdancer-ttwDancecustom-pagetrophies-danceplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsMusic, Drama, Art, Dance1:22%,50:30%,100:38%,500:58%"Dance Awards" "Dance Pins" "Dance Lapel Pins"See these fabulous Dance Clef Pins and other music lapel pins at TrophyCentral. Dance Clef Pins ship in just 1-2 business days!ep84Music / Band / Choruscustom-pagetrophies-dance1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Dance single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - CheerDancecustom-pagefreeawardcertificates1"Download Only"free-dance49855011TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Free Dance Contest Award certificate template (female design) from TrophyCentral. Measures 11 x 8 1/2 inches - perfect for recognizing young dancers.Free-Dance-Contest-Award-femaledance-contest-femaleDancecustom-pagefreeawardcertificates1"Download Only"free-dance49855011TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Free Dance Contest Award certificate template (male design) from TrophyCentral. Measures 11 x 8 1/2 inches - download and print instantly.Free-Dance-Contest-Award-Maledance-contest-maleDancecustom-pagetrophies-dance1trophies498551-311821.06TrophyCentralTrophies1Dancecustom-pagetrophies-dance1trophies498552-311623.65TrophiesMusic, Drama, Art, Dance1These quick-ship trophies from TrophyCentral feature a Dancer figure with a star design, real marble base and marble trophy figure platform, choice of column size and color.mqt-dancer-dmDancecustom-pagedancemedals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105502-41130025Classic MedallicsInsertsMusic, Drama, Art, Dance1:22%"Award Medals" "Art / Dance / Drama Medals" "Award Medals - All Subjects" "Dance Awards"Buy these quality Dance GENERAL Inserts (Litho) at TrophyCentral. Each 2" insert can be used to create a unique plaque, medal or trophy.497673Dance
custom-pagetrophies-dance1trophies498552-311218.84TrophiesMusic, Drama, Art, Dance1Find this unique cup trophy with Dance figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-dancer-scbDancecustom-pagetrophies-dance1trophies498551-310.71217.38Trophies1Dancecustom-pagetrophies-danceplastic-pinbox-t1lapel pins498551-30.5200040.5TrophyCentralLapel Pins11:22%,25:24%,100,27%,500:30%Find this Dance Gold Enamel lapel pin discounted at TrophyCentral. Features a clutch-pin back for easy attachment to clothing.. Fast 1-2 day shipping.Dancecustom-pagetrophies-dance1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Dance Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Dancecustom-pagetrophies-dance1trophies498552-31118TrophiesMusic, Drama, Art, Dance1Find these fabulous two-tier, 3-column champion Dance Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!mqt-dancer-3cDancecustom-pagetrophies-dance1medals498551-30.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this Colorful Dance insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Dancecustom-pagetrophies-dance1medals498551-30.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this Dance insert medal With A Personalized Front Rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Dancecustom-pageplaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these dance insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Dancecustom-pagefreeawardcertificates1"Download Only"free-dance4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our dance marathon template is free and designed exclusively for TrophyCentral. Dance templates measure 11 x 8 1/2 inches. Features female dancer.dance-template-femaledance-female-521Dancecustom-pagefreeawardcertificates1"Download Only"free-dance4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our dance marathon template is free and designed exclusively for TrophyCentral. Dance templates and award certificates measure 11 x 8 1/2 inches.dance-template-maledance-male-521Danceacademic-general-medalse9231tm9975gz9231dance-mcdance-mc-prdance-jigfdance-jibfdance-jisf11Find dance medals discounted at TrophyCentral. Choose from a variety of styles and finishes. Each dance medal includes a neck ribbon.. trophies-dance

🏅 Dance Medals & Awards - Affordable Recognition for Every Dancer

Dance medals provide budget-friendly, portable recognition perfect for competitions, recitals, and conventions where multiple participants deserve acknowledgment across ballet, jazz, tap, hip-hop, contemporary, and lyrical performances. As practical symbols of achievement, custom dance medals and dance competition medals offer lightweight, wearable awards that dancers display with pride on ribbon walls, in memory boxes, and at special celebrations. These quality medals feature durable metal construction with detailed dancer designs, vibrant gold, silver, and bronze finishes, customizable inserts for specific dance styles, and free neck ribbons in multiple colors for immediate presentation. Available in sizes from 1.25-inch economy medals to 2.75-inch premium designs, dance recital medals accommodate large competitions and bulk medal orders while maintaining professional quality. Perfect for recognizing participation in dance festivals, placement awards at regional competitions, category winners, technique excellence, performance quality, or any achievement deserving affordable recognition, these medals create meaningful moments that motivate dancers to continue pursuing their passion.

Expand your recognition program: Explore Ballet Trophies and Explore Dance Trophies for championship recognition. Learn more: Performance Arts and Cultural Heritage.

Frequently Asked Questions About Dance Medals

What medal sizes work best for different age groups and events?

For young dancers ages 5-8, 1.25-inch to 1.5-inch economy medals provide lightweight options that are comfortable to wear and easy for small hands to display. For dancers ages 9-14, 2-inch standard medals offer a balanced size with clear detail visibility and appropriate weight. For teen and adult dancers at competitive events, 2.5-inch to 2.75-inch premium medals deliver substantial recognition with impressive visual impact. Large-scale competitions often use 2-inch medals for participation and category placements while reserving 2.75-inch premium medals for overall winners, grand champions, and special achievement awards to create clear recognition tiers.

Can dance medals be customized for specific dance styles?

Yes, dance medals offer extensive customization for specific dance disciplines. Insert medals allow you to swap center graphics for ballet, modern dance, tap, jazz, or general dance figures to match your event style. Personalized rim medals feature custom text around the medal edge for competition names, event dates, or achievement levels. Ribbon colors are fully customizable - choose traditional blue for first place, red for second place, and white for third place, or select custom colors matching your studio branding or competition theme. Many medals also accommodate neck drape ribbons for formal award ceremonies or standard neck ribbons for regular competitions and dance recital participation awards.

How many dance medals should I order for my competition or recital?

For participation-based recitals where every performer receives recognition, order one medal per dancer plus 5-10 percent extra for last-minute additions or replacements. For competitive events with placement awards, calculate medals based on your award structure - if recognizing top 3 in each category, multiply categories by three and add overall awards. Most competitions order bulk medal packages in quantities of 50, 100, or 250 to take advantage of volume pricing discounts. Consider ordering medal variety packs with gold, silver, and bronze finishes for first, second, and third place recognition, which simplifies ordering and ensures consistent medal quality across all placement levels while staying within your dance studio budget.

]]>
trophies-danceDance
custom-pagetrophies-dance1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our dance insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - CheerDancecustom-pagetrophies-dance1trophies498552-313633.4TrophiesMusic, Drama, Art, Dance1Our dance / jazz participation trophies feature a real slant-front white marble base and free personalization. Significant quantity discounts available.mqt-dancer-ncDancecustom-pagetrophies-dance1perpetual trophies498552-311234TrophiesMusic, Drama, Art, Dance1Find this Perpetual Dance Trophy Discounted at TrophyCentral. Each Trophy has enough room for 32 names. Ships in just 1-2 days.mqt-dancer-perpDance11Find dance pins discounted at TrophyCentral. Choose from a variety of finishes and styles. Each dance pin features a clutch back for easy attachment to clothing.Shop with Confidence at TrophyCentral! If you are looking to buy dance pins online, look no further! TrophyCentral has a great selection that will fit any budget. We also have top-rated customer service. Our experts in New York and Michigan have been providing suggestions and guidance since 1999!]]>trophiesDancecustom-pagetrophies-dance1plaques498552-41JDSPlaques1Find this dance plaque discounted at TrophyCentral. Our dance plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Dance11Celebrate dance recitals with 15+ award categories for technique, performance, and dedication. Budget-friendly recognition for ballet, jazz, tap, and contemporary dancers.custom-pagetrophies-dance1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Dance Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Dancecustom-pagetrophies-dance1trophies498551-310.452429Trophies1Find our Dance star column trophy discounted at TrophyCentral. Features a real marble base, 6 inch gold star-shaped column, free engraving and fast shipping.dance-star-column-trophycustom-pagedance-templates-freedance-plaque-idance-award-plaque7036dance-pbep84cl361trophies1"Trophies" "Dance Awards" "Dance Trophies"

Custom Dance Trophies - Celebrate Every Performance and Champion

Dance trophies celebrate the artistry, discipline, and dedication that define a sport where every performance represents countless hours of rehearsal and an unrelenting pursuit of grace and expression. From recreational studio recitals where young dancers take their first bow on stage, to competitive invitational events where ballet, jazz, tap, hip-hop, lyrical, and contemporary dancers earn placement recognition, from year-end studio banquets honoring every participant in a season's worth of classes, to regional and national competitions where grand champions and overall title winners are crowned, quality dance awards honor performers and instructors across every style and level. Our versatile selection includes participation trophies and budget series awards ideal for recital recognition, single and double column trophies featuring ballet and couples dancing figurines, place trim trophies for 1st, 2nd, and 3rd at competitive events, two-tier and three-column championship trophies for grand champion and overall title winners, insert plaques customizable for any studio or competition name, and medals for larger competitions recognizing multiple categories and age divisions affordably.

Dance Award Ideas for Your Recital or Banquet

Dance combines athleticism, artistry, and expression in ways that captivate audiences and inspire performers. Here are award ideas to recognize your dancers' dedication, talent, and growth - plus engraving examples for each.

Technical Excellence

  • Prima Ballerina / Premier Danseur - Grace and technique that belongs on the world's biggest stages. Poetry in motion.
  • Technique Titan - Perfect form in every movement. Makes the most difficult combinations look effortless.
  • Flexibility Phoenix - Bends in ways that defy anatomy. Their extensions reach the stratosphere.

Style Recognition

  • Hip Hop Hero - Brings the street to the stage. Their moves are fire and their energy is contagious.
  • Jazz Hands Genius - Makes jazz dance sparkle. Energy and precision in perfect harmony.
  • Contemporary Soul - Tells stories without words. Every movement has meaning and emotion.
  • Tap Sensation - Feet faster than lightning. Creates rhythms that make hearts race.

Performance and Stage Awards

  • Stage Presence Star - Commands attention from curtain up to final bow. Natural performer who owns the spotlight.
  • Expression Expert - Face tells the story as beautifully as their body. Acting through movement.
  • Crowd Favorite - Gets the biggest cheers every time. Audience can't take their eyes off them.

Team Spirit and Growth Awards

  • Dance Captain Excellence - Leads by example, helps everyone shine. The heartbeat of the team.
  • Most Supportive Dancer - Always in the wings cheering. Makes everyone feel like a star.
  • Studio Spirit Award - Embodies everything the studio stands for. Positive energy that lifts everyone.
  • Most Improved Dancer - From stumbling to stunning. Their transformation is inspirational.
  • Practice Makes Perfect - First to arrive, last to leave. Lives in the studio and it shows.
  • Rising Star - Young talent with unlimited potential. Future of dance in motion.

Engraving Examples

  • Recital Award: OUTSTANDING PERFORMER / [Dancer Name] / Spring Recital 2025
  • Competition Trophy: FIRST PLACE - SOLO / [Dancer Name] / Regional Dance Competition 2025
  • Studio Award: DANCER OF THE YEAR / [Dancer Name] / [Studio Name] 2024-25

Dance teaches discipline, creativity, and confidence. Celebrate the dancer who helps younger students, the one who conquered stage fright, and the student who never gives up on challenging choreography. Every dancer's journey is unique and valuable.

Frequently Asked Questions About Dance Trophies

What trophy sizes work best for different dance award categories?

Recital participation and end-of-season studio awards benefit from 6-inch to 9-inch trophies ensuring every dancer receives recognition for completing the year, building enthusiasm and encouraging return enrollment. Category placers and individual event winners at invitational competitions deserve 10-inch to 14-inch single column trophies with dancer figurines that distinguish competitive achievement from participation. Overall winners and top finishers across multiple categories warrant 15-inch to 18-inch premium trophies with substantial presence reflecting superior performance. Grand champions and overall title winners at regional or national competitions demand 20-inch to 24-inch two-tier or three-column trophies whose height and weight convey the prestige of the title. Medals work especially well for large competitions recognizing multiple age divisions and dance styles where awarding every placer a trophy is impractical.

What details should dance trophy engraving include?

Essential elements include dancer name, award title, studio or competition name, and year. For competitive events, adding the dance style, age division, and place finish creates a complete record of the achievement. Participation awards gain warmth from titles like Most Improved, Best Stage Presence, or Outstanding Performer. Keep text concise and readable, prioritizing the most meaningful details when space on smaller trophies requires choices.

Do you offer bulk discounts for dance studios and competitions?

Yes, TrophyCentral offers significant bulk discounts on dance trophies and medals that scale with order quantity, keeping award budgets manageable for studios and competitions of any size. Studio owners ordering participation trophies for an entire recital cast, competition directors purchasing medals across multiple age divisions and dance styles, and studios buying year-end banquet awards for all levels all benefit from bulk pricing. Browse our dance medals above for the most budget-friendly option when recognizing large fields.

If you need more information before deciding, see our expert resource section:

Be sure to also browse our complete trophies and awards collection to explore additional designs for every sport and occasion.

]]>
Dance / Ballet
custom-pagekeychains21105502-40.39125035.39Classic MedallicsGiftsKeychains1:22%,10:25%,25:32%,50:39%,100:47%Find these popular Pewter Dancer Key Chains at TrophyCentral; discounted prices!pk106-cmKeychainscustom-pagetrophies-darts1trophies498551-310.452429Trophies1Find this popular Darts trophy discounted at TrophyCentral. Features a real marble base, stylish 4-inch gold cup, free engraving and fast shipping.darts-cup-place-trophycustom-pagetrophies-darts1"1-4 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular darts figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!qtdartsplDarts, 1st / 2nd / 3rd / Etc.custom-pagetrophies-darts20498551-30.5100021TrophyCentralInsertsSports, Hobby, Org, Livestock1Find this colorful Darts 2" Epoxy-covered insert discounted at TrophyCentral. Fast 1-2 day shipping.Dartscustom-pagetrophies-darts1"1-4 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%This popular Darts Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!qtdartsyrDartscustom-pagetrophies-darts1trophies498852-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with darts figure discounted at TrophyCentral. Includes free text engraving!cup-darts-pDartscustom-pagefree-sports-templates1"Download Only"free-sports4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our DartsÊ template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Darts--Certificatedarts-freeDartscustom-pagetrophies-darts1trophies498551-31.520033TrophyCentralMedalsSports, Hobby, Org, Livestock1Find these Darts Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Dartscustom-pagetrophies-darts1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these darts budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtdartsscbDartscustom-pagetrophies-darts1trophies498551-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Darts insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Dartscustom-pagetrophies-darts1"1-4 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous Darts Two Tier Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qtdartsttDartscustom-pagetrophies-darts1"1-4 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-411.2115Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%See this championship trophy with a Darts figure at TrophyCentral. Be sure to see all of our Darts figure awards.qtdartsttwDartscustom-pagetrophies-darts1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Darts single column insert trophy features a choice of column color, a marble base and free trophy engraving.Dartscustom-pagetrophies-darts1"1-4 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%This popular Darts Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtdartsscDartscustom-pagetrophies-darts1"1-4 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.451623.65Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%These quick-ship trophies from TrophyCentral feature a Darts figure, real marble base and marble trophy figure platform, choice of column size and color.qtdartsdmDartscustom-pagetrophies-darts1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Darts figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-darts-scbDartscustom-pagetrophies-darts1trophies498551-31.520033TrophyCentralMedalsSports, Hobby, Org, Livestock1Find these Darts Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Dartscustom-pagetrophies-darts1"1-4 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-411.4118Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous two-tier, 3-column champion Darts Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtdarts3cDartscustom-pageplaques1"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498852-310.45811.6Quick TrophyPlaquesInsert1:14%,3:14%"Darts Awards"See this stunning Darts plaque and other Holographic Plaques at TrophyCentral.qsinplaqdartsDartscustom-pagetrophies-darts1trophies498551-30.525035.5TrophyCentralMedalsSports, Hobby, Org, Livestock1Find this colorful Darts insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Dartscustom-pagetrophies-darts1trophies498551-30.525035.5TrophyCentralMedalsSports, Hobby, Org, Livestock1Find this Darts insert medal with a personalized front rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Dartscustom-pagetrophies-darts1plaques498551-311.11623.5TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these darts insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Dartscustom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Darts Inserts (Litho) at TrophyCentral. Each Darts Insert can be used to create a unique plaque, medal or trophy.493141Darts
custom-pagetrophies-darts1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our darts insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Dartscustom-pagetrophies-darts1"1-4 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%,25:23%,50:29%,100:34%Our popular Darts participation trophies feature a real slant-front marble base and free engraving.qtdartsncDartscustom-pagetrophies-darts1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498852-311.41234Quick TrophyTrophiesPerpetual Trophies1:14%,3:15%,10:16%Find this Perpetual Darts Trophy Discounted at TrophyCentral. Each Trophy has enough room for 32 names. Ships in just 1-2 days.qtdartsperpReturn to oursection for more fabulous choices.trophies-dartsDartscustom-pagetrophies-darts1trophies498551-31.520033TrophyCentralMedalsSports, Hobby, Org, Livestock1Find these Darts Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Dartscustom-pagetrophies-darts1trophies498551-310.452429Trophies1Find our Darts star column trophy discounted at TrophyCentral. Features a real marble base, 6 inch gold star-shaped column, free engraving and fast shipping.darts-star-column-trophycustom-pageaward-medalsdarts-plaque-idarts-ei1trophies1Find a great selection of Darts Trophies at TrophyCentral. Each Darts Trophy includes free personalization. Darts medals include a ribbon. Fast 1-2 day shipping.Dart Recognition Trophies TrophyCentral has a great selection of darts awards to meet all of your award recognition needs. Be sure to see our Dart Participation Trophies with a slant-front marble base, and our 1st through 3rd Place Trophies to recognize multiple levels of achievement. Our 3 Column, Two Tier Trophies are perfect for darts tournament and team winners. Each darts award includes up to three lines of FREE ENGRAVING (larger awards include additional lines).]]>Dartscustom-pagedebate-trophies1498554-Feb0.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful Debate 2" Epoxy-covered insert decal discounted at TrophyCentral. Fast 1-2 day shipping.Debatecustom-pagefree-school-certificate-templates1br588"Download Only"free-academic4985501Trophy CentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Debate Award template is free and designed exclusively for Trophy Central. Debate Award certificate templates measure 11" x 8 1/2" and can be easily downloaded and printed.debate-award-certificatedebate-awardDebate, Academiccustom-pagedebate-trophies1498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Debate Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Debatecustom-pagedebate-trophies1trophies498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Debate insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-Debate-InsertDebatecustom-pagedebate-trophies1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Debate single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - DebateDebatecustom-pagedebate-trophies1trophies498551-311821.06TrophyCentralTrophies1Debatecustom-pagedebate-trophies1trophies498551-310.71217.38Trophies1Debatecustom-pagedebate-trophies1498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Debate Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Debatecustom-pagedebate-trophies1medals498553-Feb0.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this colorful Debate insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Debatecustom-pagedebate-trophies1498553-Feb0.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this Debate insert medal with a personalized front rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Debatecustom-pageplaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these debate insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Debateacademic-general-medals1debate-trophies1Find a great selection of debate pins and debate medals discounted at TrophyCentral. Each debate medal includes a free ribbon.

Shop for Debate Lapel Pins & Medals with Confidence at TrophyCentral!

If you are looking to buy debate lapel pins or medals online, look no further! TrophyCentral has a great selection that will fit any budget. Our top-rated representatives are happy to assist you with all of your needs. Our experts in New York and Michigan have been providing suggestions and guidance since 1999! To find the perfect debate medal or lapel pin, click on an image above, or for personal service, call us toll-free at 1-888-809-8800.

Debate Medals & Pins - Frequently Asked Questions

What types of debate medals and pins do you offer?

Our selection includes gold, silver, and bronze medals, as well as stylish lapel pins designed to recognize excellence in speech and debate competitions.

Can I customize my debate medals?

Yes! Many of our medals allow for custom engraving on the back, so you can add names, competition titles, or special messages.

Do these awards come with ribbons?

Most of our medals include a free neck ribbon, available in various colors to match your school or event theme.

How quickly can I receive my order?

Most debate medals and pins ship within 1-2 business days. Expedited shipping options are available if you need them sooner.

Are there discounts for bulk orders?

Yes! We offer discounts for bulk purchases, making it easy for schools and organizations to order multiple awards at a great price.

What material are the medals and pins made from?

Our debate medals are crafted from high-quality metal with detailed designs, while our pins feature durable enamel finishes.

Do you offer other awards for speech and debate?

Yes! In addition to medals and pins, we have a selection of debate trophies and plaques for top performers.

]]>
debate-trophiesDebate
custom-pagedebate-trophies1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our debate insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - DebateDebatecustom-pagedebate-awardplasticpinboxvelapinbox10debate-award"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"Find these debate pins discounted at TrophyCentral. Each debate pin features a high quality finish and clutch-pin back.br588Debatecustom-pagedebate-trophies1plaques498552-41JDSPlaques1Find this debate plaque discounted at TrophyCentral. Our debate plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.DebateDebatecustom-pagedebate-trophies1498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Debate Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Debatecustom-pageaward-medalsdebate-award-plaquedebate-plaque-idebate-mcdebate-mc-prdebate-jigfdebate-jibfdebate-jisfdebate-part-idebate-single-idebate-champ-idebate-e-part-idebate-e-single-icup-debate-scb-icup-debate-in1trophies-academic1Find debate trophies discounted at TrophyCentral. Each debate trophy features free engraving! Medals include a neck ribbon. Fast 1-2 day shipping.

Custom Debate Trophies and Awards - Honor Every Argument, Round, and Championship

Debate trophies recognize the preparation, critical thinking, and composure under pressure that competitive speech and debate demands at every level. From middle school students competing in their first Lincoln-Douglas rounds to experienced varsity competitors advancing through elimination rounds at invitational tournaments, quality debate awards reinforce the value of the activity and motivate competitors to keep developing their skills. Our debate trophy collection spans economy participation trophies for programs recognizing every competitor who completed the season, single column and cup trophies for category and round winners, and the impressive Champion's Trophy for tournament champions who earned the top podium.

Debate Medals - Affordable Recognition for Every Competitor and Division

Debate medals with free neck ribbons offer an affordable alternative ideal for large tournaments recognizing multiple divisions, while debate plaques provide a wall-mounted recognition option suited for team displays, coach awards, and distinguished alumni recognition. Every trophy includes free engraving personalized with competitor name, school, event, and tournament details, and debate medals feature optional back engraving for the same personalization.

Frequently Asked Questions About Debate Trophies

What debate and forensics events are these trophies appropriate for?

Our debate trophies and awards are designed for the full range of competitive speech and debate formats recognized by middle school, high school, and collegiate forensics programs. Lincoln-Douglas debate, policy debate, public forum debate, parliamentary debate, and congressional debate all use these awards for round winners, bracket champions, and tournament finalists. Speech events including original oratory, extemporaneous speaking, impromptu, dramatic interpretation, humorous interpretation, duo interpretation, and prose and poetry reading are equally well served since the insert design communicates the subject broadly rather than tying the award to a single format. Model United Nations programs, mock trial competitions, and general forensics league championships all use debate-style trophies for their recognition programs. The Speaker's Award lapel pin is a popular complement to trophies for recognizing outstanding speaker points across rounds, providing a wearable award that competitors can display on a lanyard or jacket throughout and after the tournament.

What engraving details should debate trophies include?

Debate trophy engraving should capture the specific achievement and context that makes the award meaningful years later. Essential elements include competitor name, award or placement title, school or team name, tournament name, and year, for example: Sarah Chen, Tournament Champion, Lincoln High School, State Forensics Invitational 2025. For round-specific awards, adding the debate format or event category adds useful context, such as Lincoln-Douglas Finalist or Extemporaneous Speaking, First Place. Speaker awards benefit from noting the specific recognition, such as Top Speaker Award or Best Speaker, Varsity Division. Coach and program awards should include years of service or season record where space allows. Participation trophies for large tournaments can keep engraving concise with competitor name, school, event name, and year, which provides enough context while keeping per-unit engraving costs manageable across large fields of competitors.

Should debate programs use trophies, medals, or plaques for their awards?

Most competitive debate programs benefit from using multiple award formats together, with each format serving a different recognition purpose within the same event. Trophies are the strongest choice for top finishers and tournament champions, where the visual presence of a standing award communicates the significance of the accomplishment and gives competitors something meaningful to display at home or in a school trophy case. Medals with neck ribbons suit large participation fields and multi-division tournaments where the priority is recognizing every competitor affordably and immediately, since medals can be presented on the spot without requiring a separate banquet. Plaques are the best fit for permanent recognition, such as team display cases honoring past champions, coach of the year awards intended for office or classroom display, and alumni recognition programs where the award will hang on a wall rather than sit on a shelf. Many programs combine all three, presenting championship trophies to finalists, medals to all participants across every division, and a plaque to the hosting coach or program director, creating a complete recognition system that honors everyone who contributed to the event.

If you need more information before deciding, see our expert resource section:
]]>
trophies-victoryDebate
custom-pageofficesigns11"2-5 business days" "Lebanon, Ohio" "UPS (FedEx available on request)"450362-510.4510.45GhentOffice Signs1"Dry Erase Boards" "Markerboards"Find DecoVue Snap Frame Dry Erase Boards at Discounted Prices at TrophyCentral.Directional Signscustom-pagemedallion-inserts-general-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these quality Deer Inserts (Litho) at TrophyCentral. Each Deer Insert can be used to create a unique plaque, medal or trophy.505191
custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality Defense Commissary Agency Inserts at TrophyCentral. Each Defense Commissary Agency Insert can be used to create a unique plaque, medal or trophy.518135Military, Hero
custom-pageribbons1-tiaras1"1-3 business days" "Topeka, Indiana" "UPS (Post Office Priority Mail also available)"465711-21 260.8244.4Tower RibbonSpiritTiaras1:22%Find These Delicate 2 1/2" Duchess Homecoming Tiaras Discounted At TrophyCentral! Typically Ship In Just 1-2 Days!rtp66101-20-2022custom-pagetrophies1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)""PT1=Trophies" "PC11=498552-310.451622.85Quick TrophyTrophiesGeneral1:14%,10:18%,50:24%,100:28%Our Paragon Series Trophy Features A Real Marble Base And Figure Platform. Choose From Four Column Sizes And Many Colors. Best Of All, Personalization Is Free!double-trophiescustom-pagegavelplaques11"3-5 business days" "Mount Vernon, NY" "UPS"plaques105503-60.4511248.45Classic MedallicsPlaquesGavels1:22%What is a Gavel? A Gavel is an award for those serving on committees. Quick shipping on Gavels.Gavelcustom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality Department Of Defense Inserts at TrophyCentral. Each Department Of Defense Insert can be used to create a unique plaque, medal or trophy.51531202-28-2020Military, Hero
custom-pagemedallion-inserts-government-agencies-and-logos12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%"Award Medals" "Award Medals - All Subjects" "Medals - All Others"Buy these high-quality Department of Justice medals at TrophyCentral. Each insert can also be used to create a unique plaque or trophy.517640Military, Hero
custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
"PT1=Medals" "PC10=105502-4130025Classic MedallicsInsertsHero1:22%Buy these high-quality Department Of The Air Force Inserts at TrophyCentral. Each Department Of The Air Force Insert can be used to create a unique plaque, medal or trophy.515899Military, Hero, Air Force
custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality Department Of The Army Inserts at TrophyCentral. Each Department Of The Army Insert can be used to create a unique plaque, medal or trophy.515957Military, Hero, Army
custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality Department Of The Navy Inserts at TrophyCentral. Each Department Of The Navy Insert can be used to create a unique plaque, medal or trophy.515968Military, Hero, Navy
custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality Department Of The Navy Sumac Inserts at TrophyCentral. Each Department Of The Navy Sumac Insert can be used to create a unique plaque, medal or trophy.517603Military, Hero, Navy
custom-pagemedallion-inserts-government-agencies-and-logos12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%"Award Medals" "Award Medals - All Subjects" "Medals - All Others"Buy these high-quality Department Of The Treasury Inserts at TrophyCentral. Each Department Of The Treasury Insert can be used to create a unique plaque, medal or trophy.515509Military, Hero
custom-pagemedallion-inserts-government-agencies-and-logos12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%"Award Medals" "Award Medals - All Subjects" "Medals - All Others"Buy these high-quality Dept. Of Veteran Affairs Inserts at TrophyCentral. Each Dept. Of Veteran Affairs Insert can be used to create a unique plaque, medal or trophy.517705Military, Hero
custom-pagegift-certificate-templates1"Download Only"certificates4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Gift Certificate template (design 6) is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.gift-certificate-design-6gift-certificate-a6Gift Certificate, Holidaycustom-pageclocks11"7-10 business days w/engraving" "Chicago, Illinois" "UPS (FedEx available on request)"personalized gifts606307-101 3 230.451648.45RS OwensGiftsClocks1:22%]]>Desk Clock with Photo from TrophyCentral. Also see our great selection of engraved and personalized gifts!12-20-2020Engraved Clockscustom-pageengraved-framesdesblocnamplendeblwcahodesksigns1215deskwedge1tagsbadges1Find desk name plates discounted at TrophyCentral. Each desk name plate can be engraved with a name or title. Choose from several great finishes.Find Custom Desk Name Plates with Ease at TrophyCentral See our fabulous selection of engraved desk plates in a variety of beautiful wood finishes. Choose from a black plate with gold engraving or a gold plate with black engraving. Each desk name plate will be personalized with your text. If you need help, our experts in New York and Michigan would be happy to assist you. ]]>namebadges engraved-framesDesk Name Platescustom-pagename-desk-signs1name-desk-signs"3-4 business days" "Marquette, Michigan" "UPS"plaques498552-410.454838.85TrophyCentralPlaques1:22%,10:44%Beautiful desk name sign with free custom engraving and choice of a black or a Rosewood finish. Fast 1-2 day shipping.custom-pagename-desk-signs11name-desk-signs"3-4 business days" "Marquette, Michigan" "UPS”498552-410.452419.65JDS-SNameplatesEngraved Plaques1:22%,10:32%"Engraving"09-06-2014custom-pageglass-crystal-awards1"10 business days" "Aliquippa, PA" "UPS"general1500110-1410.451236.45Glass AmericaCrystal Awards1:22%,10:25%Find this Diamante Crystal Paperweight discounted at TrophyCentral. Available in 3 sizes.custom-pagecrystalcups1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"general410187-1010.45444.45JcharlesCrystal Awards1:22%,25:25%Diamond Cup Awards from TrophyCentral. See our great selection of engraved and personalized gifts!Leadershipcustom-pageglass-crystal-awards1"1-2 business days" "Marquette, MI" "UPS"general498852-310.45826Quick TrophyCrystal Awards1:14%,10:17%"New Products"Diamond Prestige Glass Award from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.Be sure to see our mainsection for other fabulous choices.glass-crystal-awardsLeadershipcustom-pagetrophies-swimming-diving12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,100:28%,500:34%,1000:45%"Swimming Awards" "Swimming Medals" "Swimming Ribbons"These inexpensive 1 1/4 inch Swimming Medals offer a high quality, but low price for those on a tight budget.e903810-01-2016Swimming / Diving, Sports
custom-pageglass-crystal-awards11general105503-610.451612.45Classic MedallicsCrystal Awards1:30%,3:33%"Crystal Awards"Find this beautiful diamond-shaped crystal award with a stunning black base discounted at TrophyCentral. Price includes engraving on award base.custom-pageglass-crystal-awards11general105503-610.451814.05Classic MedallicsCrystal Awards1:22%,3:21%"Minuteman" Find this diamond-shaped awards discounted at TrophyCentral. Each award features free engraving. Browse all of our awards now!08-01-2016Leadershipcustom-pageap281"1-2 business days" "Columbia, SC"lapel pins292121-31 2 3 230.4150030.4Certificate SourceLapel PinsAcademic1:22%,50:28%,100:32%,500:36%"Honor Roll" "Honor Roll Pins" "Honor Roll Trophies" "School Pins"Find these fabulous Die Cut School Pins discounted at TrophyCentral. TrophyCentral is known for its top-rated customer service05202011Generalcustom-pagecustomlapel1plasticpinboxvelapinbox100"4 - 6 Weeks" "Mt. Vernon, N.Y." "UPS (FedEx available on request)"lapel pins1055028-4210.31150030.3Classic MedallicsLapel PinsGeneral1:30%,2500:78%"Custom Lapel Pins" "Custom Trading Pins"Find These Brass Custom Logo Pins Discounted at TrophyCentral. These Lapel Pins Feature Your Artwork and a Choice of Size.diestbrpiCustom Pinscustom-pagephotoplaques1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"plaques105503-610.451510.45Classic MedallicsPlaques1:22%,10:22%,50:23%,100:23%Shop for Digital Sports Plaques from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.custom-pagefloating-plaques11"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"plaques458221510.45525.45Vision AwardsPlaquesPerpetual Plaques1:22%,6:28%,26:35%Find the elegant Dignity Plaque discounted at TrophyCentral. Fashioned in random-sanded aluminum with a glass front panel declaring your recipients excellence and value.custom-pagegeneral-corporate-awards11"7-10 business days w/engraving" "Kentucky" "UPS (FedEx available on request)"general410187-1010.45429.25JcharlesTrophies1:22%,25:24%Dimensions In Blue from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.04-12-2019custom-pagequickshiptrophies-graduate1certificatescertificates290631-31 2 3 230.45100020.45Certificate SourceCertificatesAward Certificates1:22%,25:24%,100:40%,500:50%"Graduation Award" "Graduation Awards"Find These Printed Diploma Certificates at TrophyCentral. Each Diploma Certificate Measures 8 1/2 x 11.969Academiccustom-pagecertificateplaques10pac6x8dipcper6x8dipcovdiplomacoversoppersamasabbutho2sidperdipcodiplomacefrpresfolcermounperwitgolsta1certificates1

Diploma Covers and Certificate Folders - Present Every Achievement with Pride

A quality diploma cover is the finishing touch that transforms a printed certificate from a document into a keepsake, protecting it from handling damage during the ceremony and giving recipients something they are proud to carry across the stage and display at home. Padded covers with moiré lining and satin corners keep diplomas and certificates looking crisp and flat long after the event, while custom foil-stamped covers branded with your school name or organization logo create a cohesive, professional presentation across every graduate or honoree. Blank covers ship in 1 to 2 business days for coordinators who need to move quickly, while customizable covers are the right choice for graduation ceremonies, professional certification programs, and annual recognition events where branded presentation adds to the significance of the occasion. Our selection includes single-sided padded covers in 6 by 8 inch size for smaller certificates and 8.5 by 11 inch for standard diplomas, two-sided covers that hold two documents and work well for ceremonies that pair a diploma with an award or program, leatherette holders with no minimum order requirement ideal for individual purchases and smaller events, affordable certificate folders for budget-conscious programs, certificate mounts for desk or wall display, and diploma frames for permanent framing of graduation and achievement documents.

Frequently Asked Questions About Diploma Covers

What size diploma cover do I need?

Most school diplomas and award certificates are printed on standard 8.5 by 11 inch paper, making our 8.5 by 11 inch covers the right choice for the vast majority of graduation and recognition programs. If your certificates are smaller, our 6 by 8 inch covers are designed for that size. For programs that present two documents together, such as a diploma paired with a program insert or a second award, our two-sided 8.5 by 11 inch covers hold two full-size documents. When in doubt, measure your printed certificate before ordering to confirm the fit.

Can I personalize diploma covers with my school name or logo?

Yes. Our customizable covers are personalized with your school name, organization name, or logo via foil stamping in a range of colors to coordinate with your school colors or branding. Personalized covers are available in both single-sided and two-sided styles and in both standard sizes. Personalized orders require additional production time beyond our standard 1 to 2 business day blank cover turnaround, so order early when working toward a ceremony date. Contact us with your artwork and we can confirm file requirements and production timeline before you place your order.

Do you offer bulk discounts for graduation ceremonies and large events?

Yes, pricing on both blank and customizable diploma covers drops significantly with quantity, making it affordable for schools and organizations hosting large graduation ceremonies or annual recognition events. Volume pricing is shown on each product page. Orders over $99 qualify for free economy shipping. For schools ordering covers for an entire graduating class or district-wide recognition program, contact us and we can confirm bulk pricing and confirm your timeline before you order.

If you need more information before deciding, see our expert resource section:
]]>
embossed-seals certificateplaques
custom-pagecertificate-diploma-covers11"1-3 business days" "Columbia, South Carolina" "UPS (FedEx available on request)"diploma covers290631-31 2 3 230.551632.55Certificate SourceDiploma CoversAward Certificates1:22%"Award Certificates and Diploma Covers" "Award Certificates and Diploma Holders" "Award Certificates and Diploma Frames" "Award Certificate and Diploma Holders" "Certificate and Diploma Holders" "Certificates and Frames" "Certificates and Diploma Holders" "Diploma Covers and Certificates" "Diploma Covers and Award Certificates" "Diploma Covers, Frames and Holders" "Diploma Covers, Frames, Holders and Certificates"Shop for Certificate Frames at TrophyCentral. Each frame includes a box and ships in just a couple of days.GeneralCertificate Framescustom-pagecertificateplaques1"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"plaques105502-311159Classic MedallicsPlaquesCertificate Plaques1:14%,100:25%"Certificate Plaques" "Certificate Plaque" "Plaques That Hold Certificates" "Certificate Holders" "Plaques For Certificates" "Graduation Plaques" "New Products" "Diploma Holders" "Padded Diploma Covers" "School Diploma Covers" "Diploma Covers" "Custom Diploma Covers"Find diploma drames discounted at TrophyCentral. Each diploma frame features a gold border and choice of green, blue, white or walnut finish.Certificates / Sealscustom-pagename-desk-signs1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"410187-1010.451632.45JcharlesGiftsCrystal Gifts1:22%,25:23%"personalized gifts"Director's Nameplate from TrophyCentral. Discounted Trophies, Awards and Promotional Products.07-20-2015Crystal Giftscustom-pagetrophies-disc-golf1trophies498551-310.452429Trophies1Find this popular Disc Golf trophy discounted at TrophyCentral. Features a real marble base, stylish 4-inch gold cup, free engraving and fast shipping.disc-golf-cup-place-trophycustom-pagetrophies-disc-golf1"1-4 (typically 1-2) business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Our disc golf place trim (1st, 2nd, or 3rd) trophy is Ideal for leagues, schools, and tournaments. Fast shipping. Free engraving.qtdiscplDisc Golf, 1st / 2nd / 3rd / Etc.custom-pagetrophies-disc-golf1"1-4 (typically 1-2) business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find our disc golf year trim trophy discounted at trophyCentral. Ideal for leagues, schools, and tournaments. Fast shipping and free engraving.qtdiscyrDisc Golfcustom-pagetrophies-disc-golf1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Achievement Cup Trophy - Disc Golf. Ideal for leagues, schools, and tournaments. Fast shipping.cup-disc-pDisc Golfcustom-pagetrophies-disc-golf1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Single Column Budget Trophy - Disc Golf. Ideal for leagues, schools, and tournaments. Fast shipping.mqtdiscscbDisc Golfcustom-pagetrophies-disc-golf1"1-4 (typically 1-2) business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Quick-Ship Two-Tier Trophies with Disc Golf Figure. Ideal for leagues, schools, and tournaments. Fast shipping.qtdiscttDisc Golfcustom-pagetrophies-disc-golf1"1-4 (typically 1-2) business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-411.2115Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%Disc Golf Two Tier Championship Trophy with Wood Base. Ideal for leagues, schools, and tournaments. Fast shipping.qtdiscttwDisc Golfcustom-pagetrophies-disc-golf1"1-4 (typically 1-2) business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:28%Single Column Elite Series Trophy - Disc Golf. Ideal for leagues, schools, and tournaments. Fast shipping.qtdiscscDisc Golfcustom-pagetrophies-disc-golf1"1-4 (typically 1-2) business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.05Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:15%Deluxe Platform Trophies - Disc Golf. Ideal for leagues, schools, and tournaments. Fast shipping.qtdiscdmDisc Golfcustom-pagetrophies-disc-golf1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Single Column Cup Trophy - Disc Golf. Ideal for leagues, schools, and tournaments. Fast shipping.cup-disc-scbDisc Golfcustom-pagetrophies-disc-golf1"1-4 (typically 1-2) business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-411.4118Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Quick-Ship Two-Tier 3-Column Trophies - Disc Golf. Ideal for leagues, schools, and tournaments. Fast shipping.qtdisc3cDisc Golfcustom-pagetrophies-disc-golf1"1-4 (typically 1-2) business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.453640.05Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:27%Participation Trophies with Marble Platform - Disc Golf. Ideal for leagues, schools, and tournaments. Fast shipping.qtdiscncDisc Golfcustom-pagetrophies-disc-golf1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.41234Quick TrophyTrophiesPerpetual Trophies1:14%,3:15%,10:16%Find this Perpetual Disc Golf Trophy Discounted at TrophyCentral. Each Trophy has enough room for 32 names. Ships in just 1-2 days.qtdiscgolfperpDisc Golfcustom-pagetrophies-disc-golf1trophies498551-310.452429Trophies1Find our Disc Golf star column trophy discounted at TrophyCentral. Features a real marble base, 6 inch gold star-shaped column, free engraving and fast shipping.disc-golf-star-column-trophycustom-pageaward-medalsqtdiscncqtdiscscqtdiscyrqtdiscplqtdiscttqtdiscttwqtdisc3cqtdisctrqtdiscdmqtdiscgolfperpmqtdiscscbcup-disc-scbcup-disc-pdisc-golf-cup-place-trophydisc-golf-cup-place-column-trophydisc-golf-star-column-trophy1trophies1Shop for Disc Golf Trophies from TrophyCentral. Each Disc and Frisbee Golf Trophy includes Free Personalization. Fast 1-2 Day Shipping!

Custom Disc Golf Trophies & Awards - Honor Every Ace, Birdie, and Champion

Disc golf trophies celebrate the skill, patience, and competitive spirit that define one of the fastest-growing outdoor sports in America. From casual recreational leagues where players of all ages enjoy the game at their local course, to PDGA-sanctioned club tournaments where every stroke counts, from beginner-friendly charity events introducing new players to the sport, to amateur championships where seasoned competitors chase their personal best, quality disc golf awards recognize players and organizers across every level of the game. Our versatile trophies feature dynamic disc golf figurines capturing the follow-through of a perfect drive, resin sculptures depicting fairways and basket designs that disc golfers instantly recognize, traditional column trophies in a range of heights and finishes suited to any event format, and customizable engraving plates documenting round scores, tournament placements, course records, and the ace shots that define a player's season.

Frequently Asked Questions About Disc Golf Trophies

What trophy sizes work best for different disc golf award categories?

Participation awards and closest-to-the-basket prizes work well as 6-inch to 9-inch economy trophies or medals, providing affordable recognition for every player who enters a recreational round or charity scramble without straining a club's event budget. Division winners and category awards such as longest drive, most improved, or best amateur round deserve 10-inch to 14-inch single column trophies with disc golf figurines, creating meaningful individual recognition within a larger field. Overall tournament runner-up and division champion honors warrant 15-inch to 18-inch premium trophies with substantial presence reflecting a strong performance across an entire competitive round or series. Course championships, club titles, and end-of-season series winners demand 20-inch to 24-inch multi-column championship trophies with the height and weight befitting the culmination of a full season of competitive play. Ace pool and special achievement awards benefit from distinctive resin or custom designs that set them apart from standard placement trophies, reflecting the rare and memorable nature of the accomplishment.

What details should disc golf trophy engraving include?

Comprehensive engraving preserves round and tournament memories beyond fading scorecards. Essential elements include player name, award title, event or club name, and year. Examples: Derek Carlson, Tournament Champion, Riverside Disc Golf Club Open, 2025 or Megan Flores, Women's Division Winner, Pinecrest Charity Classic, Spring 2025. Scoring achievements gain impact through specific numbers like Course Record 54 or Round Score -9 when space permits. Series and season championships benefit from noting the number of events played or rounds completed such as Season Champion, 8-Event Series. Ace awards deserve special treatment with hole number, distance, and disc used, for example Ace - Hole 7, 280 Feet, July 2025, turning a once-in-a-season moment into a permanent keepsake. Keep text concise and readable, prioritizing the most meaningful details when space limitations require choices.

How should disc golf clubs structure awards for recreational versus competitive players?

Recreational and beginner-focused events benefit from broad recognition where every participant receives a medal or small trophy, building enthusiasm for the sport and encouraging new players to return for the next event. This is especially effective at charity tournaments, youth introductory clinics, and casual club rounds where growing participation matters as much as crowning a winner. Competitive club events and sanctioned tournaments appropriately shift toward merit-based awards with trophies reserved for podium finishers, division winners, and special achievement categories, reflecting the more serious nature of the competition. Clubs running both recreational and competitive programming throughout the season often find the best results by maintaining separate award structures for each format, using medals for broad recreational recognition and reserving trophies for genuine competitive achievement. This approach keeps all players engaged at every skill level while ensuring that competitive titles carry the weight and distinction that serious players expect.

If you need more information before deciding, see our expert resource section:
]]>
Disc Golf / Frisbee Golf
custom-page111custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsGeneral1:22%Buy these high-quality Distinguished Service Award Inserts at TrophyCentral. Each Distinguished Service Award Insert can be used to create a unique plaque, medal or trophy.51778302-28-2015Military, Hero
custom-pageaward-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic MedallicsMedalsGeneral1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "School Medals"These inexpensive 1 1/4 inch Distinguished Service Medals offer a high quality, but low price for those on a tight budget.e930105-16-2019General, Business, Academic
custom-pagesports-inserts1105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Swimming Awards"Buy these quality Diving (Male) Inserts (Litho) at TrophyCentral. Each Diving (Male) Insert can be used to create a unique plaque, medal or trophy.503081Swimming / Diving, Sportscustom-pagefree-sports-templates1trophies-swimming-diving"Download Only"free-sports49855011TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Diving template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Diving-Certificatediving-freeSwimming / Diving, Sportscustom-pagesports-inserts1105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Swimming Awards"Buy these quality Diving Female Inserts (Litho) at TrophyCentral. Each Diving Female Insert can be used to create a unique plaque, medal or trophy.503891Swimming / Diving, Sports11Learn about trophy figure options for boys and girls soccer teams. Expert guidance on ordering for co-ed teams and ensuring every player feels represented.custom-pagelogoprooflogsetfordipwoyoulipr111custom-pageask-trophy-expert11Most trophies include free engraving up to a certain number of characters. Learn what's included, when extra fees apply, and how to maximize your engraving.custom-pagemedallion-inserts-general-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these quality Dog German Shepherd Inserts (Litho) at TrophyCentral. Each Dog German Shepherd Insert can be used to create a unique plaque, medal or trophy.505131
custom-pagemedallion-inserts-general-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these quality Dog Obedience Inserts (Litho) at TrophyCentral. Each Dog Obedience Insert can be used to create a unique plaque, medal or trophy.505451
custom-pagemedallion-inserts-general-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these quality Dog Show Inserts (Litho) at TrophyCentral. Each Dog Show Insert can be used to create a unique plaque, medal or trophy.503941
custom-pagefreeawardcertificates1"Download Only"certificates4985501Trophy CentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Dogs template is free and designed exclusively for Trophy Central. Dogs certificate templates measure 11" x 8 1/2" and can be easily downloaded and printed.dogs-certificatedogs-frDogscustom-pageglass-crystal-awards1"1-2 business days" "Marquette, MI" "UPS"general498852-310.451032Quick TrophyCrystal Awards1:14%"New Products"Find these Glass Dome Awards discounted at TrophyCentral. Each Dome Award features free engraving.Leadershipcustom-pagebaseballdisplay11"7-10 business days w/Logo, 4-6 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 23 24 2511417Perfect CaseDisplay Cases1:14%,10:29%Double Baseball Glass Display Case. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.basedisplay-dBaseball / T-Ball, Sportscustom-pageracingdisplays1"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 23 24 251111Perfect CaseDisplay Cases11:14%,5:15%Double Nascar 1/24th Glass Display Cases from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.custom-pageglass-crystal-awards1"10-15 business days w/engraving" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"general105505-1010.451420.45Classic MedallicsCrystal Awards1:30%,25:29%Find this fabulous Double Flame Award discounted at TrophyCentral. TrophyCentral is known for its top-rated customer serviceLeadershipcustom-pagehockeypuckdisplays1"7-10 business days w/Logo, 4-6 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 23 24 2511865Perfect CaseDisplay Cases11:14%,5:18%Double Hockey Puck Glass Display Cases from TrophyCentral.hockeydisplay-dHockey, Sports11Shop for these popular double marble achievement series trophies with two real marble bases! These quick-ship trophies include engraving!1custom-pagefootballdisplay11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 23 24 251111Perfect CaseDisplay Cases11:14%,5:15%Double Mini Helmet Display Cases from TrophyCentral.Football, Sportscustom-pagetrophies-downhill-skiing1trophies498551-310.452429Trophies1Find this popular Downhill Skiing trophy discounted at TrophyCentral. Features a real marble base, stylish 4-inch gold cup, free engraving and fast shipping.downhill-skiing-cup-place-trophycustom-pagetrophies-downhill-skiing1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%"Skiing Trophies" "Skiing Trophy" "Skier Trophies" "Ski Trophies"Fabulous Downhill Skiing Place trophy with 1st, 2nd or 3rd Place Gold Trim, Marble Base and Free Engraving. Ships in a fast 1-2 days!qtskidownplSkiing (Downhill), 1st / 2nd / 3rd / Etc., Sportscustom-pageskiingmedals1medals498551-30.5100021TrophyCentralInsertsSports, Hobby, Org, Livestock1Find this colorful Downhill Skiing 2" Epoxy-covered insert sticker discounted at TrophyCentral. Fast shipping, free over $99.Skiing (Downhill), Sportscustom-pagetrophies-downhill-skiing1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%"Skiing Trophies" "Skiing Trophy" "Skier Trophies" "Ski Trophies"This popular Downhill Skiing trophy features a real marble base, column, figure and trim indicating year of award. Includes up to three lines of free engraving!qtskidownyrSkiing (Downhill), Sportscustom-pagetrophies-downhill-skiing1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with downhill skiing figure discounted at TrophyCentral. Includes free text engraving!cup-skidown-pSkiing (Downhill), Sportscustom-pagefree-sports-templates1"Download Only"free-sports49855011TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Downhill Skiing template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Downhill-Skiing-Certificatedownhill-skiingSkiing (Downhill), Sportscustom-pageskiingmedals1medals498551-31.520033TrophyCentralMedalsSports, Hobby, Org, Livestock1Find these Downhill Skiing Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Shipping is free over $99.Skiing (Downhill), Sportscustom-pagetrophies-downhill-skiing1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these downhill skiing budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtskidownscbSkiing (Downhill), Sportscustom-pagetrophies-downhill-skiing1trophies498551-310.453633.4Trophies1Find this budget downhill skiing award trophy discounted at TrophyCentral. Features a real marble base and plastic skiing figure. Engraving is free. Fast 1-2 day shipping.Skiing (Downhill), Sportscustom-pagetrophies-downhill-skiing1trophies498551-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Downhill Skiing insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Skiing (Downhill), Sportscustom-pagetrophies-downhill-skiing1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%"Skiing Trophies" "Skiing Trophy" "Skier Trophies" "Ski Trophies"Find these fabulous two-tier Downhill Skiing Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtskidownttSkiing (Downhill), Sportscustom-pagetrophies-downhill-skiing1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-411.2115Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%"Skiing Trophies" "Skiing Trophy" "Skier Trophies" "Ski Trophies"See this championship trophy with a Downhill Skiing figure at TrophyCentral. Be sure to see all of our Downhill Skiing figure awards.qtskidownttwSkiing (Downhill), Sportscustom-pagetrophies-downhill-skiing1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our downhill skiiing single column insert trophy features a choice of column color, a marble base and free trophy engraving.Skiing (Downhill), Sportscustom-pagetrophies-downhill-skiing1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:28%"Skiing Trophies" "Skiing Trophy" "Skier Trophies" "Ski Trophies"This popular Downhill Skiing Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtskidownscSkiing (Downhill), Sportscustom-pagetrophies-downhill-skiing1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.05Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:15%"Skiing Trophies" "Skiing Trophy" "Skier Trophies" "Ski Trophies"Find Our Downhill Skiing Deluxe Platform Series Trophies Discounted At TrophyCentral. Feature A Real Marble Base And Free Personalization!qtskidowndmSkiing (Downhill), Sportscustom-pagetrophies-downhill-skiing1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Downhill Skiing figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-skidown-scbSkiing (Downhill), Sportscustom-pageskiingmedals1medals498551-31.520033TrophyCentralMedalsSports, Hobby, Org, Livestock1Find these Downhill Skiing Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Shipping is free over $99.Skiing (Downhill), Sportscustom-pagetrophies-downhill-skiing1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-411.4118Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%"Skiing Trophies" "Skiing Trophy" "Skier Trophies" "Ski Trophies"Find these fabulous two-tier, 3-column champion Downhill Skiing Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtskidown3cSkiing (Downhill), Sportscustom-pageskiingmedals1medals498551-30.525035.5TrophyCentralMedalsSports, Hobby, Org, Livestock1Find this colorful Downhill Skiing insert medal discounted at TrophyCentral. Fast shipping, free over $99.Skiing (Downhill), Sportscustom-pageskiingmedals1medals498551-30.525035.5TrophyCentralMedalsSports, Hobby, Org, Livestock1Find this Downhill Skiing insert medal with a personalized front rim discounted at TrophyCentral. Fast shipping, free over $99.Skiing (Downhill), Sportscustom-pagetrophies-downhill-skiing1plaques498551-311.11623.5TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these downhill skiing insert plaques discounted at TrophyCentral. Price includes free engraving. Shipping is free over $99.Skiing (Downhill), Sportscustom-pageskiingmedals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,100:28%,500:34%,1000:45%"Skiing and Snow Sports Medals"These inexpensive 1 1/4 inch Downhill Skiing (Male) Medals offer a high quality, but low price for those on a tight budget.e926604-30-2020Skiing (Downhill), Sports
custom-pagetrophies-downhill-skiing1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our downhill skiing insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Skiing (Downhill), Sportscustom-pagetrophies-downhill-skiing1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:28%"Skiing Trophies" "Skiing Trophy" "Skier Trophies" "Ski Trophies"Our popular Downhill Skiing participation trophies feature a real slant-front marble base and free engraving.qtskidownncSkiing (Downhill), Sportscustom-pageskiingmedals1medals498551-31.520033TrophyCentralMedalsSports, Hobby, Org, Livestock1Find these Downhill Skiing Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Shipping is free over $99.Skiing (Downhill), Sportscustom-pagetrophies-downhill-skiing1trophies498551-310.452429Trophies1Find our Downhill Skiing star column trophy discounted at TrophyCentral. Features a real marble base, 6 inch gold star-shaped column, free engraving and fast shipping.downhill-skiing-star-column-trophycustom-pagetrophies-snowmobileqtskidownncqtskidownscqtskidowndmqtskidownyrqtskidownplqtskidownttqtskidownttwqtskidown3cqtdowntrmqtskidownscbcup-skidown-pcup-skidown-scbbdg-skidownd-skiing-part-id-skiing-single-id-skiing-champ-id-skiing-e-part-id-skiing-e-single-id-skiing-plaque-idownhill-skiing-cup-place-column-trophydownhill-skiing-cup-place-trophydownhill-skiing-star-column-trophy1trophies1Downhill Skiing Trophies from TrophyCentral. Most Skiing Trophies Ship in 1-2 Days and Include Engraving!Downhill Skiing Trophies TrophyCentral carries a large variety of skiing trophies and awards for all of your needs. The section above includes our selection of downhill skiing medals and trophies in a variety of sizes and styles to meet your recognition needs. Whether you want to recognize the ski race winner or participation in ski school, you have come to the right place!
We also have sections for cross country skiing and snowboarding.]]>
skiingmedals trophies-cross-country-skiingSkiing (Downhill)
custom-pagedrama-medals-pins12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105502-40.3713003.37Classic MedallicsInsertsMusic, Drama, Art, Dance1:22%"Award Medals" "Art / Dance / Drama Medals" "Award Medals - All Subjects" "Drama Awards" "Drama Trophies" "Drama Trophy"Buy these quality Mylar drama / theater inserts at TrophyCentral. Each drama decal can be used to create a unique plaque, medal or trophy.489800Drama
custom-pagetrophies-drama1trophies498551-310.452429Trophies1Find this popular Drama trophy discounted at TrophyCentral. Features a real marble base, stylish 4-inch gold cup, free engraving and fast shipping.drama-cup-place-trophycustom-pagetrophies-drama1trophies498551-310.452429Trophies1Find this popular Drama insert trophy discounted at TrophyCentral. Features a real marble base, stylish 4-inch gold cup, free engraving and fast shipping.drama-cup-place-trophy-icustom-pagetrophies-drama1trophies498552-311622.85TrophiesSchool1Find this popular drama figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at trophyCentral. Ships in a fast 1-2 days!mqt-drama-p-plDramacustom-pagetrophies-drama1medals498551-30.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful Drama 2" Epoxy-covered insert decal discounted at TrophyCentral. Fast 1-2 day shipping.custom-pagefreeawardcertificates1"Download Only"certificates4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Drama Award template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Drama-Certificatedrama-freeDrama11Who is the youngest Oscar winner? Not sure? Check out this drama infographic for the answer to this and other music trivia questions.custom-pagetrophies-drama1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Drama Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Dramacustom-pagetrophies1trophies498552-313633.4TrophiesSchool1Find this budget drama award trophy discounted at Trophy Central. Features a real marble base and plastic figure. Engraving is free. Fast 1-2 day shipping.Dramacustom-pagefreeawardcertificates1"Download Only"certificates49855011TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"See this Drama Certificate designed exclusively for TrophyCentral! Drama Certificates can be downloaded for free! Each drama certificate measures 11 x 8 1/2 inches.dramafrDramaDramacustom-pagetrophies-drama1trophies498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Drama insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-Drama-InsertDramacustom-pagetrophies-drama1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Drama single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - CheerDramacustom-pagetrophies-drama1trophies498551-311821.06TrophyCentralTrophies1Dramacustom-pagetrophies-drama1trophies498552-311623.65TrophiesSchool1These quick-ship trophies from TrophyCentral feature a drama mask figure, real marble base and marble platform, choice of column size and color. Fast 1-2 day shipping.mqt-drama-p-dmDramacoaching-teaching-guides1trophies-drama1Find 15+ theatre award ideas with engraving examples for cast parties and ceremonies. From Leading Actor to Triple Threat, recognize every role from spotlight to stage crew. Free engraving on all trophies.custom-pagetrophies-drama1trophies498551-310.71217.38Trophies1Dramacustom-pagetrophies-dramaplastic-pinbox-t10lapel pins498551-30.5200040.5TrophyCentralLapel Pins11:22%,25:24%,100,27%,500:30%Find this Drama Gold Enamel lapel pin discounted at TrophyCentral. Features a clutch-pin back for easy attachment to clothing.. Fast 1-2 day shipping.custom-pagetrophies-drama1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Drama Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Dramacustom-pagetrophies-drama1medals498551-30.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this Colorful Drama Insert Medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Dramacustom-pagetrophies-drama1medals498551-30.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this Drama insert medal With A Personalized Front Rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Dramacustom-pageplaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these drama insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Dramacustom-pagedrama-medals-pins12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105502-41130025Classic MedallicsInsertsMusic, Drama, Art, Dance1:22%"Award Medals" "Art / Dance / Drama Medals" "Award Medals - All Subjects" "Drama Awards"Buy these quality Drama Inserts (Litho) at TrophyCentral. Each Drama Insert can be used to create a unique plaque, medal or trophy.502861Drama
custom-pagetrophies-dramaplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:30%,50:32%,100:35%,500:39%"Drama Lapel Pins" "Drama Pins" "Drama Awards"Find drama mask pins discounted at TrophyCentral. Each drama lapel pin features a quality enamel finish and clutch back. Large quantity discounts.br47407-30-2012Dramacustom-pagetrophies-dramaplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsMusic, Drama, Art, Dance1:22%,50:32%,100:39%,500:46%"Drama Trophies" "Drama Trophy" "Drama Medals and Lapel Pins"Find these Drama Mask Pins discounted at TrophyCentral. Each Drama Mask Pin features a beautiful finish with a clutch-back for easy attachment to clothing.br27606-30-2012Dramaacademic-general-medalstm9800br474e9009z9231drama-mcdrama-mc-prdrama-jigfdrama-jibfdrama-jisf11Find drama medals discounted at TrophyCentral. Perfect for school plays, theater clubs, and drama competitions. Affordable, customizable, and fast shipping!Spotlight your performers with unique drama medals that recognize creativity and stage excellence.

From the lead actor to the stage crew, every role in a production deserves recognition. Our drama medals are designed to honor the passion, dedication, and imagination that bring performances to life. Whether you are celebrating a school play, a community theater production, or a drama competition, these awards provide a meaningful keepsake for participants of all ages.

Choose from a wide range of designs featuring classic theatrical icons such as masks, curtains, and spotlights. Many medals can be personalized to make the award even more special. They are perfect for award ceremonies, cast parties, or as tokens of appreciation for students and volunteers who put their hearts into the stage.

With fast shipping, affordable prices, and high-quality designs, our drama medals and pins are the perfect way to keep the applause going long after the curtain falls.

]]>
star-pinsDrama
custom-pagetrophies-drama1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our drama insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - CheerDramacustom-pagetrophies-drama1trophies498552-313633.4TrophiesSchool1Our drama participation trophies feature a real slant-front white marble base and free personalization. Significant quantity discounts available. Fast 1-2 shipping.mqt-drama-p-ncDrama1lapel-award-pins1Find theater and drama pins discounted at TrophyCentral. Each drama pin features a drama mask design and clutch back for easily attaching to clothing.Shop for Drama Lapel Pins with Confidence at TrophyCentral! If you are looking to buy drama mask pins online, look no further! TrophyCentral has a great selection that will fit any budget. We also have top-rated customer service. Our experts in New York and Michigan have been providing suggestions and guidance since 1999!

Frequently Asked Questions (FAQ)

🎭 What are drama lapel pins used for?

Drama lapel pins are a great way to recognize actors, directors, and crew members for their contributions to theater productions. They serve as collectible keepsakes for school plays, drama clubs, and theater competitions.

🏆 Do you offer different designs for theater pins?

Yes! Our drama pins come in a variety of designs, including the classic comedy and tragedy masks, director's clapboards, and musical theater symbols. These stylish pins make a perfect award for any performer.

🎖 Can I personalize my drama lapel pins?

No, but some of our drama medals do allow for customization, such as adding a year or school name. We also have blank lapel pins that can be customized as well.

🚚 How quickly can I receive my drama pins?

Most theater lapel pins ship within 1-2 business days. If you need them urgently, expedited shipping options are available at checkout.

]]>
Drama
custom-pagetrophies-drama1plaques498552-41JDSPlaques1Find this drama mask plaque discounted at TrophyCentral. Our plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Dramacustom-pagetrophies-drama1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Drama Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Dramacustom-pagetrophies-drama1trophies498551-310.452429Trophies1Find our Drama star column trophy discounted at TrophyCentral. Features a real marble base, 6 inch gold star-shaped column, free engraving and fast shipping.drama-star-column-trophydramatrophiesschooltrophies12drmatrtm9800e9009br474br587cl13br27611Find Drama Trophies at TrophyCentral. Each Drama Trophy includes free engraving. Most Drama Trophies Ship in 1-2 Days! Recognize the star of your play now!drama trophies, drama trophy, theater trophiesDrama Awards & Trophies Our skilled experts have crafted drama trophies that will take center stage at any ceremony. Our workmanship and dedication show in our custom engraving for your drama and theater club awards. Every performance is unique, and so are our exceptional designed awards to honor your stars. Check out our best-selling drama mask trophy and also our star performer trophy. If you do not see a drama trophy that meets your needs, try looking through other sections, including Insert Trophies. Also, do not hesitate to call us at the above number, we would be thrilled to help you find just the right item for your needs!

Get a standing ovation at your next practice by sharing our fun infographics. You can share this graphic on your website as long as you include attribution to http://www.trophycentral.com/trophies-drama.html with the graphic. Thanks!

Drama Awards Facts & Trivia



Shop with Confidence at TrophyCentral!

If you are looking to buy drama trophies online, look no further! TrophyCentral has a great selection that will fit any budget. Our top-rated representatives are happy to assist you with all of your drama trophy and award needs. Our experts in New York and Michigan have been providing suggestions and guidance since 1999! To find the perfect drama award, click on an image above, or for personal service, call us toll-free at 1-888-809-8800.
]]>
Drama / Theater
custom-pagetrophies-musicdrama-plaque-idrama-award-plaque1063star-performer-eidrama-eibr276cl13br587drama-pb1trophies1Shop drama trophies, medals and plaques for every event and performance. Hundreds of styles to recognize your theater star. Free engraving. Fast shipping.

Custom Drama Trophies - Celebrate Every Performance

Drama trophies honor the creativity, courage, and dedication that define the performing arts. From elementary school holiday pageants where every child gets their moment in the spotlight to competitive high school theater productions vying for district recognition, from community playhouse opening nights to middle school improv showcases, quality drama awards recognize the performers, directors, and crew members who bring stories to life on stage. Our versatile drama awards feature classic comedy and tragedy mask designs that instantly communicate theatrical achievement, column trophies with performer figurines and dramatic trim, medals with free ribbons perfect for large cast recognition, engraved plaques ideal for director and crew honors, and fully customizable engraving plates that capture production names, performance dates, and the individual roles that made the show memorable.

Drama Award Ideas for Your End-of-Year Ceremony

Theatre transforms students into storytellers, bringing characters and worlds to life on stage. From the method actor to the technical wizard, here are award ideas to recognize every student's talent and dedication - plus engraving examples for each.

Performance Excellence

  • Leading Actor/Actress - Commands the stage in every scene. Makes the audience forget they are watching a performance.
  • Scene Stealer Award - Supporting role with leading impact. Every entrance is memorable.
  • Character Chameleon - Transforms completely for every role. From Shakespeare to sitcom with ease.
  • Comedy Genius - Timing so perfect it hurts. Makes audiences laugh until they cry.
  • Dramatic Excellence - Brings tissues to every performance. Emotional depth that moves audiences.
  • Triple Threat Award - Acts, sings, and dances with equal brilliance. The complete package.

Technical Theatre

  • Lighting Designer Excellence - Paints with light. Creates mood and magic with every cue.
  • Sound Engineer Superstar - Perfect levels every performance. Makes everyone heard without feedback.
  • Set Design Visionary - Builds worlds from wood and paint. Makes black boxes feel like Broadway.
  • Stage Manager MVP - The glue that holds it all together. Calls every cue perfectly.
  • Costume Creator - Transforms thrift store finds into period pieces. Makes every actor look the part.
  • Props Master - Never a missing prop on their watch. Creates magic from everyday objects.

Ensemble and Special Recognition

  • Best Ensemble Member - Makes everyone better. The ultimate team player who never misses rehearsal.
  • Most Improved Performer - From stage fright to spotlight ready. Growth that inspires the entire cast.
  • Rising Star Award - First-year student with senior talent. Born for the stage.

Engraving Examples

  • Lead Role: BEST ACTOR / [Student Name] / "Hamlet" - Spring 2025
  • Technical Award: TECHNICAL EXCELLENCE / Stage Management / [Name] - 2024-25 Season
  • Season Award: DRAMA STUDENT OF THE YEAR / [Student Name] / [School Name] Theatre 2025

Theatre teaches empathy, confidence, and collaboration like no other activity. Recognize the student who memorizes everyone's lines, the one who mentors nervous freshmen, and the performer who stays late to strike the set. Every role matters - from lead to lights.

Frequently Asked Questions About Drama Trophies

What drama trophy styles work best for different types of awards?

Participation trophies for large casts work best as economy column trophies or medals with ribbons, keeping per-unit costs low while ensuring every performer receives tangible recognition for completing the production. Lead role and individual performance awards deserve 10- to 14-inch single column trophies with mask designs, creating a meaningful distinction between cast-wide and individual honors. Director, choreographer, and technical crew awards are well suited to engraved plaques or resin pieces that feel more professional and desk-appropriate than a traditional trophy column. For competitive theater programs and festival awards, champion-style cups or two-tier trophies convey the prestige the achievement deserves.

What should drama trophy engraving include?

Great engraving turns a trophy into a keepsake. At minimum, include the recipient's name, the award title, and the production or season year. For production-specific awards, adding the show title can make the trophy more meaningful decades later. For school programs, the school name and grade level help place the award in context. Keep wording concise - shorter lines engrave more cleanly and remain readable - and prioritize the details that will matter most when someone rediscovers the trophy in a box twenty years from now.

Should drama programs give awards to the entire cast or only standout performers?

Most successful theater programs do both, and for good reason. Universal participation recognition - a medal or small trophy for every cast and crew member - reinforces that theater is a team effort where every role contributes to the whole. This is especially important for younger students in their first productions, where the experience of receiving a tangible award can spark a lasting love of the performing arts. At the same time, maintaining a set of merit-based awards for outstanding performance, most improved, best supporting role, and director's choice teaches students that exceptional effort earns special recognition. The two approaches complement rather than undermine each other.

If you need more information before deciding, see our expert resource section:

Do not hesitate to call us at the above number - we would be thrilled to help you find just the right item for your needs!

]]>
star-trophiesDrama / Theater
custom-pagetrophies-drama10br474 schooltrophies12 e90092-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
trophies105503-60.37115021.37Classic MedallicsMedalsAcademic1:22%,25:24%,50:30%,100:36%,500:42%"Drama Medals and Lapel Pins" "School Medals" "School Award Medals" "Scholastic Medals" "Scholastic Award Medals" "Academic Medals" "Academic Award Medals" "Medals, School"Your students will love these colorful Mylar Drama, Visual Arts Medals from TrophyCentral. Each Drama, Visual Arts medal includes a neck ribbon!tm9800Drama
custom-pagemusicartpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsMusic, Drama, Art, Dance1:22%,50:30%,100:33%,500:45%"Music Lapel Pins" "Band Lapel Pins" "Music Pins"Find These Drum Pins Discounted at TrophyCentral. Each Drum Pin Features a Clutch-Pin Back and Fast 1-2 Day Shipping!mp11Music / Band / Choruscustom-pagetrophies-golf1"10 business days" "Aliquippa, PA" "UPS"trophies1500110-1410.451236.45Glass AmericaCrystal AwardsSports, Hobby, Org, Livestock1:22%,10:25%Durham Golf Tower. Ideal for leagues, schools, and tournaments. Fast shipping.Golf, Sportscustom-pagetrophies-music1cl46 ap22 ep81 comsoonecsch2-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic MedallicsMedalsMusic, Drama, Art, Dance1:22%,100:28%,500:34%,1000:45%"Band Awards" "Music Awards" "Award Medals - All Subjects" "School Medals" "Music Medals"These inexpensive 1 1/4 inch E-Series Band Medals offer a high quality, but low price for those on a tight budget.e900807-30-2021Music / Band / Chorus
custom-pageletter-shaped-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoName Badges1Find these popular E-shaped custom mascot badges at TrophyCentral. Great for fundraising! TrophyCentral is a top-rated Yahoo merchant.letterbadges-ecustom-pageplaques11plaques105503-610.4511216.05Classic MedallicsPlaques1:22%"Achievement Award" "Achievement Awards" "Graduation Award" "Graduation Awards" "Patriotic Awards" "Military Awards" "Leadership Recognition" "Plaques" "Trophies and Plaques" "Plaques and Trophies"custom-pagemedallion-inserts-general-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsGeneral1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these quality Eagle (502138) Inserts (Litho) at TrophyCentral. Each Eagle (502138) Insert can be used to create a unique plaque, medal or trophy.50213806-30-2017General, Eagle
custom-pagemedallion-inserts-general-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsGeneral1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these quality Eagle (507409) Inserts (Litho) at TrophyCentral. Each Eagle (507409) Insert can be used to create a unique plaque, medal or trophy.507409Eagle
custom-pagegeneral-corporate-awards1"1-2 business days" "Marquette, MI" "UPS"trophies498552-310.451611.65Quick TrophyCrystal Awards1:14%"New Products"Find this Eagle Award with a weighted black base discounted at TrophyCentral. Price includes personalization. Fast 1-2 day shipping!Leadership, Herocustom-pagegeneral-corporate-awards11"7-10 business days w/engraving" "Chicago, Illinois" "UPS (FedEx available on request)"trophies606307-101 3 230.45618.45RS OwensTrophies1:22%Eaglecustom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceSealsEmbosser Seals1:22%,3:28%,5:31%Find these Eagle Certificate Seals discounted at TrophyCentral. Seals are easy to apply with a pressure-sensitive backing.803eagEaglecustom-pagemascotpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:22%,50:30%,100:33%,500:47%"Mascot Awards"Find these Eagle Lapel Pins and other colorful mascot pins at TrophyCentral. Fast 1-2 day shipping!em1402-16-2011Mascotcustom-pagegeneral-corporate-awards11trophies105503-610.451423.65Classic MedallicsTrophiesGeneral1:22%Shop for Eagle Leadership Awards from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.01-15-2018Leadership, Herocustom-pagegeneral-corporate-awards11trophies105503-610.45112144.45Classic MedallicsTrophies1:22%Find this Eagle Leadership Award with Insert discounted at TrophyCentral. Includes up to 3 lines of engraving.09-15-2017Eagle, Leadershipcustom-pagemascot-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoName Badges1Find These Custom Eagle Mascot Badges Discounted At TrophyCentral.mascotbadges-eaglecustom-pageplaques1plaques498552-41JDSPlaques1Find this eagle plaque discounted at TrophyCentral. Our eagle mascot plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Mascotcustom-pagegeneral-corporate-awards1"4-6 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511016.25Classic MedallicsTrophiesAcademic1:22%,5:24%,10:28%,50:32%"Mascot Awards"Buy this Eagle mascot trophy and other mascot awards at TrophyCentral.mt2010Mascotcustom-pageeagle-medals11"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"medals498852-30.3716021.6Quick TrophyMedalsSports, Hobby, Org, Livestock1:14%,10:25%,100:36%"Award Medals - All Subjects" "General Award Medals"Find these 2 inch quick-ship Eagle medals discounted online at TrophyCentral. Medals include ribbon and ship fast - just 1-2 days!eaglemedalsGeneral, Eagle, LeadershipEaglecustom-pageaward-medalseaglemedalse9133e9075tm9924g11Find eagle medals discounted at TrophyCentral. Each eagle medal features a free neck ribbon. Most award medals ship in just a few days withShop with Ease at TrophyCentral TrophyCentral offers a huge selection of award medals, all discounted. We also off low prices for bulk quantity orders. If you need help, our sales reps in New York, Michigan and online would be happy to assist you!]]>eagle-plaques-awards corporatepinscustom-pageeagle-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic MedallicsMedalsGeneral1:22%,100:28%,500:34%,1000:45%"General Award Medals" "Patriotic Awards" "Award Medals - All Subjects" "School Medals"These inexpensive 1 1/4 inch Eagle Medals offer a high quality, but low price for those on a tight budget.e913302-14-2013General
insert-trophies-awards1plaques1Find eagle plaques Discounted at TrophyCentral. Each eagle plaque features free engraving.eagle-trophiesEagle1general-corporate-awards1Find eagle trophies discounted at TrophyCentral. Each eagle trophy features free engraving and fast 1-2 day shipping.eagle-plaques-awardsEaglecustom-pagemedallion-inserts-general-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsGeneral1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these quality Eagle With Torch Inserts (Litho) at TrophyCentral. Each Eagle With Torch Insert can be used to create a unique plaque, medal or trophy.50741606-30-2017Eagle
custom-pageeagle-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic MedallicsMedalsGeneral1:22%,100:28%,500:34%,1000:45%"General Award Medals" "Patriotic Awards" "Award Medals - All Subjects" "School Medals"These inexpensive 1 1/4 inch Eagle with Torch Medals offer a high quality, but low price for those on a tight budget.e907505-30-2019General, Eagle
custom-pagemascotinserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsMascots1Buy these quality Eagles Mascot Medal Inserts at TrophyCentral. Each Eagles Insert can be used to create a unique plaque, medal or trophy.489924Mascot
custom-pagefree-school-certificate-templates1"Download Only"certificates4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Earth Day Recognition Award template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Earth-Day-Recognition-Award-Certificateearth-day-recognition-awardEarth Day, Academiccustom-pageblog-trophycentral11custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Eastern Star Litho Inserts at TrophyCentral. Each Eastern Star Insert can be used to create a unique plaque, medal or trophy.491921
custom-pagetrophies-basketballplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsSports, Hobby, Org, Livestock1:22%,50:30%,100:33%,500:47%"Basketball Lapel Pins" "Basketball Pins"EC Series Pins: Basketball. Ideal for leagues, schools, and tournaments. Fast shipping.ec0207-20-2012Basketball, Sportscustom-pagehonorrollpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:22%,50:30%,100:33%,500:47%"Honor Roll" "Honor Roll Pins" "Honor Roll Trophies" "School Pins"EC Series Honor Roll Lapel Pins feature a high-quality enameled finish and ship in just 1-2 business days! Bulk discounts. ec68Honor Roll, Academiccustom-pagehonorrollpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:22%,50:30%,100:33%,500:47%"Honor Roll" "Honor Roll Pins" "Honor Roll Trophies" "School Pins"Honor Student Letter Pins: EC Series Honor Student Lapel Pins feature a high-quality enameled finish and ship in just 1-2 business days!ec67Honor Roll, Academicplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic Medallicslapel-award-pinsSports, Hobby, Org, Livestock1:22%,50:30%,100:33%,500:47%"Track Awards" "Track Pins" "Track Lapel Pins"Track Letter Pins: EC Series Track Lapel Pins feature a high-quality enameled finish and ship in just 1-2 business days!ec10custom-pagegeneral-corporate-awards1"14 business days" "Erlanger, KY" "UPS"general410187-1010.451 2 3 4 5 6 7 8 9416.45JcharlesTrophies1:22%,25:24%Eclipse Recognition Awards from TrophyCentral. Discounted Trophies, Awards and Promotional Products.01-15-2024custom-pagetrophies-ice-hockey1"1-3 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.45144.45Tower RibbonTrophies1:14%Eco Starz Series Hockey Trophies Measure 5 Inches Tall and Include Free Engraving.wes567Hockey, Sportscustom-pageplace-trophies1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy 4th Place insert participation trophy features a white marble base, 2 inch epoxy insert and free personalization. Significant quantity discounts available.1st / 2nd / 3rd / Etc., Sportscustom-pageart-trophies1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy art insert participation trophy features a white marble base, 2 inch epoxy insert and free personalization. Significant quantity discounts available.Art, Academiccustom-pagecitizenship-awards1498551-210.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy citizenship excellence insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Citizenshipcustom-pagetrophies-coach1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy coach insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Coach, Sportscustom-pagetrophies-downhill-skiing1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy downhill skiing insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Skiing (Downhill), Sportscustom-pagemvp-trophies1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy MVP insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.MVP, Sportscustom-pagetrophies-weightlifting-power1trophies498551-210.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy weightlifting excellence insert participation trophy features a white marble base, 2 inch Epoxy insert and free personalization. Significant quantity discounts available.Weightlifting, Sportscustom-pagephotography-trophies-and-awards1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our economy photography insert participation trophy features a white marble base, 2 inch epoxy insert and free personalization. Significant quantity discounts available.Photographycustom-pagegeneral-corporate-awards1"14 business days" "Erlanger, KY" "UPS"general410187-1010.451 2 3 4 5 6 7 8 9661JcharlesTrophies1:22%,25:25%Edge and Promotional Products from TrophyCentral.custom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 93lfbs-bz-cd.93lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 48"W x 20"D. Model: 94lfbs-bz-cd.94lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 93lfbs-sn-cd.93lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 48"W x 20"D. Model: 94lfbs-sn-cd.94lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 93lfco-bz-cd.93lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 48"W x 20"D. Model: 94lfco-bz-cd.94lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 93lfco-sn-cd.93lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 48"W x 20"D. Model: 94lfco-sn-cd.94lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 93lfhb-bz-cd.93lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 93lfhb-sn-cd.93lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 48"W x 20"D. Model: 94lfhb-sn-cd.94lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 93lfsl-bz-cd.93lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 48"W x 20"D. Model: 94lfsl-bz-cd.94lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 93lfsl-sn-cd.93lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 48"W x 20"D. Model: 94lfsl-sn-cd.94lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 93lfwh-bz-cd.93lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 48"W x 20"D. Model: 94lfwh-bz-cd.94lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 93lfwh-sn-cd.93lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 48"W x 20"D. Model: 94lfwh-sn-cd.94lfbs-bz-bkFloor-Standingcustom-pagedisplaycases11display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 93lfbs-bz-bk.93lfbs-bz-bkFloor-Standingcustom-pagedisplaycases11display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 48"W x 20"D. Model: 94lfbs-bz-bk.94lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 93lfbs-sn-bk.93lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 48"W x 20"D. Model: 94lfbs-sn-bk.94lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 93lfco-bz-bk.93lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 48"W x 20"D. Model: 94lfco-bz-bk.94lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 93lfco-sn-bk.93lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 48"W x 20"D. Model: 94lfco-sn-bk.94lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 93lfhb-bz-bk.93lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 48"W x 20"D. Model: 94lfhb-bz-bk.94lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 93lfhb-sn-bk.93lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 48"W x 20"D. Model: 94lfhb-sn-bk.94lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 93lfsl-bz-bk.93lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 48"W x 20"D. Model: 94lfsl-bz-bk.94lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 93lfsl-sn-bk.93lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 48"W x 20"D. Model: 94lfsl-sn-bk.94lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 93lfwh-bz-bk.93lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 48"W x 20"D. Model: 94lfwh-bz-bk.94lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 93lfwh-sn-bk.93lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 48"W x 20"D. Model: 94lfwh-sn-bk.94lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 93lfbs-bz-fw.93lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 48"W x 20"D. Model: 94lfbs-bz-fw.94lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 93lfbs-sn-fw.93lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 48"W x 20"D. Model: 94lfbs-sn-fw.94lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 93lfco-bz-fw.93lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 48"W x 20"D. Model: 94lfco-bz-fw.94lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 93lfco-sn-fw.93lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 48"W x 20"D. Model: 94lfco-sn-fw.94lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 93lfhb-bz-fw.93lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 48"W x 20"D. Model: 94lfhb-bz-fw.94lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 93lfhb-sn-fw.93lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 48"W x 20"D. Model: 94lfhb-sn-fw.94lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 93lfsl-bz-fw.93lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 48"W x 20"D. Model: 94lfsl-bz-fw.94lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 93lfsl-sn-fw.93lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 48"W x 20"D. Model: 94lfsl-sn-fw.94lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 93lfwh-bz-fw.93lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 48"W x 20"D. Model: 94lfwh-bz-fw.94lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 93lfwh-sn-fw.93lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 48"W x 20"D. Model: 94lfwh-sn-fw.94lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 91lfbs-bz-cd.91lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 91lfbs-sn-cd.91lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 91lfco-bz-cd.91lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 91lfco-sn-cd.91lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 91lfhb-bz-cd.91lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 91lfhb-sn-cd.91lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 91lfsl-bz-cd.91lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 91lfsl-sn-cd.91lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 91lfwh-bz-cd.91lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 91lfwh-sn-cd.91lfbs-bz-bkFloor-Standingcustom-pagedisplaycases11display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 91lfbs-bz-bk.91lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 91lfbs-sn-bk.91lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 91lfco-bz-bk.91lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 91lfco-sn-bk.91lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 91lfhb-bz-bk.91lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 91lfhb-sn-bk.91lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 91lfsl-bz-bk.91lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 91lfsl-sn-bk.91lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 91lfwh-bz-bk.91lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 91lfwh-sn-bk.91lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 91lfbs-bz-fw.91lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 91lfbs-sn-fw.91lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 91lfco-bz-fw.91lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 91lfco-sn-fw.91lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 91lfhb-bz-fw.91lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 91lfhb-sn-fw.91lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 91lfsl-bz-fw.91lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 91lfsl-sn-fw.91lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 91lfwh-bz-fw.91lfbs-bz-bkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Edge lighted floor display case discounted at TrophyCentral. This high quality display is made in the US. Measures: 76"H x 24"W x 20"D. Model: 91lfwh-sn-fw.91lfbs-bz-bkFloor-Standing11Find Edge Series display cases discounted at TrophyCentral. Made in the US by Waddell. Browse our fabulous selection of school and office displays now!displaycases1floor-standing-challenger floor-standing-colossuscustom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these high-quality Educational Achievement Award Inserts at TrophyCentral. Each Educational Achievement Award Insert can be used to create a unique plaque, medal or trophy.51778507-10-2013Academic
custom-pagebaseballdisplay11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 23 24 251112Perfect CaseDisplay Cases11:14%,5:15%Eight Baseball Glass Display Case. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.basedisplay-8Baseball / T-Ball, Sportscustom-pagefree-school-certificate-templates1"Download Only"certificates49855011TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Elementary School Diploma template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Elementary-School-Diploma-Certificateelementary-diplomaDiploma, Academic, Graduationcustom-pagetrophies-dance1trophies498551-310.452429Trophies1Find our elite Dance place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.dance-cup-place-column-trophycustom-pagetrophies-academic1trophies498551-310.452429Trophies1Find our elite Academic Lamp place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.academic-lamp-cup-place-column-trophycustom-pagetrophies-archery1trophies498551-310.452429Trophies1Find our elite Archery place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.archery-cup-place-column-trophycustom-pageart-trophies1trophies498551-310.452429Trophies1Find our elite Art place trim insert trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.art-cup-place-column-trophy-icustom-pagetrophies-badminton1trophies498551-310.452429Trophies1Find our elite Badminton place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.badminton-cup-place-column-trophycustom-pagetrophies-dance1trophies498551-310.452429Trophies1Find our elite Ballet place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.ballet-cup-place-column-trophycustom-pageplace-trophies1trophies498551-310.452429Trophies1Find our elite Baseball place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.baseball-cup-place-column-trophycustom-pagetrophies-baseball1trophies498551-310.452429Trophies1Find our elite Baseball Glove place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.baseball-glove-cup-place-column-trophycustom-pageplace-trophies1trophies498551-310.452429Trophies1Find our elite Basketball place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.basketball-cup-place-column-trophycustom-pagetrophies-bass-fishing1trophies498551-310.452429Trophies1Find our elite Bass Fish place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.bass-fish-cup-place-column-trophycustom-pagetrophies-beauty-queen1trophies498551-310.452429Trophies1Find our elite Beauty Queen place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.beauty-queen-cup-place-column-trophycustom-pagetrophies-beer-pong1trophies498551-310.452429Trophies1Find our elite Beer Pong place trim insert trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.beer-pong-cup-place-column-trophy-icustom-pagetrophies-billiards1trophies498551-310.452429Trophies1Find our elite Billiards place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.billiards-cup-place-column-trophycustom-pagetrophies-bmx1trophies498551-310.452429Trophies1Find our elite BMX place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.bmx-cup-place-column-trophycustom-pagetrophies-bocce-ball1trophies498551-310.452429Trophies1Find our elite Bocce Ball place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.bocce-ball-cup-place-column-trophycustom-pagetrophies-bowling1trophies498551-310.452429Trophies1Find our elite Bowling place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.bowling-cup-place-column-trophycustom-pagetrophies-boxing1trophies498551-310.452429Trophies1Find our elite Boxing place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.boxing-cup-place-column-trophycustom-pagetrophies-car-truck1trophies498551-310.452429Trophies1Find our elite Camaro place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.camaro-cup-place-column-trophycustom-pagetrophies-campers1trophies498551-310.452429Trophies1Find our elite Camp place trim insert trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.camp-cup-place-column-trophy-icustom-pagetrophies-cards-poker1trophies498551-310.452429Trophies1Find our elite Cards / Poker place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.cards-poker-cup-place-column-trophycustom-pagetrophies-cheerleading-spirit1trophies498551-310.452429Trophies1Find our elite Cheerleader place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.cheerleader-cup-place-column-trophycustom-pagetrophies-chess1trophies498551-310.452429Trophies1Find our elite Chess place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.chess-cup-place-column-trophycustom-pagetrophies-chess1trophies498551-310.452429Trophies1Find our elite Chess place trim insert trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.chess-cup-place-column-trophy-icustom-pagetrophies-cooking-culinary1trophies498551-310.452429Trophies1Find our elite Cooking place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.cooking-cup-place-column-trophy-icustom-pagetrophies-cornhole1trophies498551-310.452429Trophies1Find our elite Cornhole place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.cornhole-cup-place-column-trophycustom-pagetrophies-cornhole1trophies498551-310.452429Trophies1Find our elite Cornhole place trim insert trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.cornhole-cup-place-column-trophy-icustom-pagereligioustrophies1trophies498551-310.452429Trophies1Find our elite Cross place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.cross-cup-place-column-trophycustom-pagetrophies-cross-country-skiing1trophies498551-310.452429Trophies1Find our elite Cross Country Skiing place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.cross-country-skiing-cup-place-column-trophycustom-pagetrophies-curling1trophies498551-310.452429Trophies1Find our elite Curling place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.curling-cup-place-column-trophycustom-pagetrophies-bicycle-cycling1trophies498551-310.452429Trophies1Find our elite Cycling place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.cycling-cup-place-column-trophycustom-pagetrophies-darts1trophies498551-310.452429Trophies1Find our elite Darts place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.darts-cup-place-column-trophycustom-pagetrophies-disc-golf1trophies498551-310.452429Trophies1Find our elite Disc Golf place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.disc-golf-cup-place-column-trophycustom-pagetrophies-downhill-skiing1trophies498551-310.452429Trophies1Find our elite Downhill Skiing place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.downhill-skiing-cup-place-column-trophycustom-pagetrophies-drama1trophies498551-310.452429Trophies1Find our elite Drama place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.drama-cup-place-column-trophycustom-pagetrophies-drama1trophies498551-310.452429Trophies1Find our elite Drama place trim insert trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.drama-cup-place-column-trophy-icustom-pagetrophies-equestrian-horse1trophies498553-Jan10.452429Trophies1Find our elite Equestrian place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.equestrian-cup-place-column-trophycustom-pagetrophies-figure-skating1trophies498551-310.452429Trophies1Find our elite Figure Skating place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.figure-skating-cup-place-column-trophycustom-pagequickshiptrophies-fireman1trophies498551-310.452429Trophies1Find our elite Firefighter place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.firefighter-cup-place-column-trophycustom-pageplace-trophies1trophies498551-310.452429Trophies1Find our elite Football place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.football-cup-place-column-trophycustom-pagetrophies-go-kart1trophies498551-310.452429Trophies1Find our elite Go Kart place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.go-kart-cup-place-column-trophycustom-pagequickshiptrophies-goat1trophies498551-310.452429Trophies1Find our elite Goat place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.goat-cup-place-column-trophycustom-pagetrophies-golf1trophies498551-310.452429Trophies1Find our elite Golf place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.golf-cup-place-column-trophycustom-pagetrophies-gymnastics1trophies498551-310.452429Trophies1Find our elite Gymnastics place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.gymnastics-cup-place-column-trophycustom-pagetrophies-ice-hockey1trophies498551-310.452429Trophies1Find our elite Hockey place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.hockey-cup-place-column-trophycustom-pagetrophies-karate-martial-arts1trophies498551-310.452429Trophies1Find our elite Karate place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.karate-cup-place-column-trophycustom-pagetrophies-lacrosse1trophies498551-310.452429Trophies1Find our elite Lacrosse place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.lacrosse-cup-place-column-trophycustom-pagetrophies-marksman-shooting-rifle1trophies498551-310.452429Trophies1Find our elite Marksman place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.marksman-cup-place-column-trophycustom-pagetrophies-marlin-fishing1trophies498551-310.452429Trophies1Find this elite Marlin Fish place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.marlin-fish-cup-place-column-trophycustom-pagetrophies-math1trophies498551-310.452429Trophies1Find our elite Math place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.math-cup-place-column-trophy-icustom-pagetrophies-motocross1trophies498551-310.452429Trophies1Find our elite Motocross place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.motocross-cup-place-column-trophycustom-pagetrophies-music1trophies498551-310.452429Trophies1Find our elite Music place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.music-cup-place-column-trophycustom-pagetrophies-paintball1trophies498551-310.452429Trophies1Find this popular Paintball place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.paintball-cup-place-column-trophycustom-pagephotography-trophies-and-awards1trophies498551-310.452429Trophies1Find our elite Photography place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.photography-cup-place-column-trophy-icustom-pagetrophies-car-truck1trophies498551-310.452429Trophies1Find our elite Pick-up Truck place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.pick-up-truck-cup-place-column-trophycustom-pagepickleball-trophies1trophies498551-310.452429Trophies1Find our elite Pickleball place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.pickleball-cup-place-column-trophy-icustom-pagetrophies-pinewood-derby-scouts1trophies498551-310.452429Trophies1Find our elite Pinewood Derby place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.pinewood-derby-cup-place-column-trophycustom-pagetrophies-sailing-boat1trophies498551-310.452429Trophies1Find our elite Sailing place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.sailing-cup-place-column-trophycustom-pagescienceawards1trophies498551-310.452429Trophies1Find our elite Science place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.science-cup-place-column-trophy-icustom-pagetrophies-trap-skeet-shooting1trophies498551-310.452429Trophies1Find our elite Skeet Shooting place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.skeet-shooting-cup-place-column-trophycustom-pagetrophies-snowboarding1trophies498551-310.452429Trophies1Find our elite Snowboarding place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.snowboarding-cup-place-column-trophycustom-pageplace-trophies1trophies498551-310.452429Trophies1Find our elite Soccer place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.soccer-cup-place-column-trophycustom-pagetrophies-softball1trophies498551-310.452429Trophies1Find our elite Softball place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.softball-cup-place-column-trophycustom-pagetrophies-softball1trophies498551-310.452429Trophies1Find our elite Softball Glove place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.softball-glove-cup-place-column-trophycustom-pagequickshiptrophies-spelling1trophies498551-310.452429Trophies1Find our elite Spelling place trim insert trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.spelling-cup-place-column-trophy-icustom-pagequickshiptrophies-spelling1trophies498551-310.452429Trophies1Find our elite Spelling place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.spelling-cup-place-column-trophycustom-pagetrophies-car-truck1trophies498551-310.452429Trophies1Find our elite Street Rod place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.street-rod-cup-place-column-trophycustom-pagetrophies-swimming-diving1trophies498551-310.452429Trophies1Find our elite Swimming place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.swimming-cup-place-column-trophycustom-pagetrophies-t-ball1trophies498551-310.452429Trophies1Find our elite T-Ball place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.t-ball-cup-place-column-trophycustom-pagetrophies-table-tennis-ping-pong1trophies498551-310.452429Trophies1Find our elite Table Tennis place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.table-tennis-cup-place-column-trophycustom-pagetrophies-tennis1trophies498551-310.452429Trophies1Find our elite Tennis place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.tennis-cup-place-column-trophycustom-pagetrophies-track-field1trophies498551-310.452429Trophies1Find our elite Track place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.track-cup-place-column-trophycustom-pagequickshiptrophies-tractor1trophies498551-310.452429Trophies1Find our elite Tractor place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.tractor-cup-place-column-trophycustom-pagetrophies-victory1trophies498551-310.452429Trophies1Find our elite Victory place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.victory-cup-place-column-trophycustom-pagetrophies-volleyball1trophies498551-310.452429Trophies1Find our elite Volleyball place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.volleyball-cup-place-column-trophycustom-pagetrophies-weightlifting-power1trophies498551-310.452429Trophies1Find our elite Weightlifting place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.weightlifting-cup-place-column-trophycustom-pagetrophies-wrestling1trophies498551-310.452429Trophies1Find our elite Wrestling place trim trophy discounted at TrophyCentral. Features a real marble base, choice of column size and color, stylish 4-inch gold cup, and free engraving.wrestling-cup-place-column-trophycustom-pagemedallion-inserts-fraternal-organizational-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "Clubs, Organizations, Charities"Buy these quality Elks Litho Inserts at TrophyCentral. Each 2 inch insert can be used to create a unique plaque, medal or trophy.491503
custom-pageperplaq1"4-6 business days "Marquette, MI" "UPS"plaques498553-610.45318.45JDS-SPlaquesPerpetual Plaques1:22%"New Products"This Elliptical Walnut finish perpetual plaque features 18 nameplates and is perfect for your school, business or organization. The price includes engraving for the top plate and one nameplate.epp1809-06-2014Perpetual, Name Platecustom-pageperplaq1"4-6 business days "Marquette, MI" "UPS"plaques498553-610.45321.45JDS-SPlaquesPerpetual Plaques1:22%"New Products"This Elliptical Walnut finish perpetual plaque features 24 nameplates and is perfect for your school, business or organization. The price includes engraving for the top plate and one nameplate.epp24Not what you are looking for? See other greatin a large number of styles and sizes.perplaq09-06-2014Perpetual, Name Platecustom-pageperplaq1"4-6 business days "Marquette, MI" "UPS"plaques498553-610.45315.45JDS-SPlaquesPerpetual Plaques1:22%"New Products"This Elliptical Walnut finish perpetual plaque features 12 nameplates and is perfect for your school, business or organization. The price includes engraving for the top plate and one nameplateepp1209-06-2014Perpetual, Name Platecustom-pageglass-crystal-awards1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"general410187-1010.45648.45JcharlesCrystal Awards1:22%,25:25%"crystal awards" "sales awards" "service awards" "corporate sales awards" "corporate service awards" "sales award" "service award" "corporate sales award" "corporate service award"The Elliptico Crystal Sales/Service Award design shows off the gratitude expressed in your messaging. Available in three sizes - personalization is free!12-31-2019Leadershipcustom-pageacrylicawards11"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"general105503-610.451 2 3 4 5 6 7 8 91515.45Classic MedallicsCrystal Awards1:22%Find This Elongated Oval Shaped Acrylic Trophy Discounted at TrophyCentral. Available in Several Styles. Price Includes Free Engraving!1"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"105501-21500301"Mascot Awards"Find a great selection of Mascot Pins at TrophyCentral. Subjects include Panther, Bull Dog, Eagle and many more!1em-series-mascot-pinscustom-pageembossed-seals1500"1-3 business days" "Columbia, South Carolina" "UPS (FedEx available on request)""PC60=290631-31 2 3 230.45400040.45Certificate SourceSealsEmbosser Seals1:22%,1000:23%Find these Embossed Foil Seals at TrophyCentral. Embossed Seals are a Great Addition to Your Certificates.111custom-pagefreeawardcertificates1"Download Only"certificates4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Employee Excellence Award template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Employee-Excellence-Award-Certificateemployee-excellence-awardEmployee, Appreciationcustom-pagefreeawardcertificates1"Download Only"certificates4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Employee of the Month template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Employee-of-the-Month-Certificateemployee-of-the-month-freeEmployee, Appreciationcustom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these high-quality Employee Of The Month Inserts at TrophyCentral. Each Employee Of The Month Insert can be used to create a unique plaque, medal or trophy.517836Occupations
custom-pageperplaq11"1-2 business days w/engraving" "Marquette. MI" "UPS"plaques498552-310.45835TrophyCentralPlaques1:22%Find employee of the month plaques discounted at TrophyCentral. Each employee of the month plaque features free engraving and a spot for a 4"x6" photo!plaque with photo, photo plaque, perpetual plaque with photo, perpetual photo plaque, plaque with namescustom-pageperplaq11comingsoon8"3-5 business days w/engraving" "Marquette, MI" "UPS (FedEx available on request)"plaques498553-510.45838TrophyCentralPlaquesPerpetual Plaques1:22%Find this perpetual employee plaque with photo holder at Troph Central. Nameplates are attached by an exclusive magnetic release feature.custom-pagecorporatepinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsBusiness1:30%,50:32%,100:35%,500:39%"Meeting or Exceeding Goals" "Employee Lapel Pins" "Corporate Lapel Pins"Find Employee of the Month pins discounted at TrophyCentral. Each Employee of the Month pin features a clutch-back. Large quantity discounts.br34503-15-2014Business, Generalcustom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these high-quality Employee Performance Award Inserts at TrophyCentral. Each Employee Performance Award Insert can be used to create a unique plaque, medal or trophy.51779012-20-2020Occupations
custom-pageperplaq11comingsoon8"7-10 business days w/engraving" "Chicago, Illinois" "UPS (FedEx available on request)"606307-101 3 230.451 2 3 4 5 6 7 8 918.45RS OwensPlaques1:22%Find this employee recognition plaque discounted at TrophyCentral. Plaque price includes engraving of header and first name plate!11Workplace recognition strategies that motivate performance. Learn when to use awards vs. acknowledgment for employees, volunteers, and professionals. Budget tips included.custom-pagefreeawardcertificates1"Download Only"certificates49855011TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Employee Safety Award template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Employee-Safety-Award-Certificateemployee-safetySafety, Employeevolunteer-service-awardsrecognizing-donorsguide-to-employee-awardsguide-to--the-history-of-service-pinsguide-to-service-pin-etiquettehow-to-recognize-retireesfederal-service-pin-use-and-selectioncreative-awards-for-board-membersmilitary-veterans-guidehealthcare-worker-guidereligious-faith-guideretirement-service-guidecase-study-happiness-and-smiles11Your complete guide to employee recognition and corporate awards. From building effective recognition programs to selecting meaningful awards, discover expert insights for transforming workplace culture and celebrating outstanding performance.custom-pagequickshiptrophies-fireman1plaques498552-41JDSPlaques1Find this EMS Plaque discounted at TrophyCentral. Our EMS plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.EMScustom-pagefreeawardcertificates1"Download Only"certificates4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our EMT template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-EMT-Certificateemt-freeHero, EMTcustom-pagemedallion-inserts-occupational-subjects12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality EMT Inserts at TrophyCentral. Each EMT Insert can be used to create a unique plaque, medal or trophy.51854507-01-2017Occupations
custom-pageschool-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsGeneral1:22%,50:30%,100:33%,500:42%"School Pins" "School Lapel Pins"Find Achievement (AP Series) pins at TrophyCentral. Each AP Series Achievement pin includes a clutch back.ap63Academic, Generalcustom-pagemusicartpins1plasticpinboxvelapinbox1"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsMusic, Drama, Art, Dance1:22%,50:30%,100:40%,500:46%"Music Lapel Pins" "Band Lapel Pins" "Band Awards" "School Pins"Find Band Award Pins discounted at TrophyCentral. Each Band Award Lapel Pin features a clutch-pin back. Fast 1-2 day shipping.br574Music / Band / Choruscustom-pagemusicartpins1plasticpinboxvelapinbox1"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsMusic, Drama, Art, Dance1:30%,50:34%,100:38%"Music Lapel Pins" "Band Lapel Pins" "Band Awards" "School Pins"Find these orchestra pins discounted at TrophyCentral. Each orchestra award pin features a clutch back for safe and easy attachment to clothing.br570Music / Band / Chorus11Complete guide for coaches planning end-of-season recognition ceremonies. Covers the recognition pyramid strategy and creative award categories.custom-pagegeneral-corporate-awards1"14 business days" "Erlanger, KY" "UPS"general410187-1010.451 2 3 4 5 6 7 8 9661JcharlesTrophies1:22%,25:24%Find these fabulous Endeavor Recognition Awards discounted at TrophyCentral. TrophyCentral is known for its top-rated customer servicecustom-pageacademic-general-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic MedallicsMedalsAcademic1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "School Medals"These inexpensive 1 1/4 inch English Arts Medals offer a high quality, but low price for those on a tight budget.e991406-30-2008English
custom-pagefree-school-certificate-templates1"Download Only"free-academic4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our English Award template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-English-Award-Certificateenglish-award-freeEnglish. Writing, Academiccustom-pageschool-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:22%,50:30%,100:35%,500:48%"School Pins" "School Lapel Pins"Find these popular English Language Lapel HP Series Award Pins Discounted at TrophyCentral. Fast 1-2 Days Shipping!hp0606-08-2009Englishcustom-pageschool-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:22%,50:28%,100:32%,500:42%"School Pins" "School Lapel Pins"Find English pins discounted at TrophyCentral. Each English language lapel pin includes a clutch back.ap80Englishcustom-pagenoindexed-items1"3-4 business days" "Medina, MN" "UPS (FedEx available on request)""PT3=553404-710.728.7JDSGiftsBridesmaids / Groomsmen1:22%"Gifts"Engraved Baseball Bat. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.pebabat12-20-2020Bridesmaids / Groomsmencustom-pageclocks11"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"personalized gifts498552-310.452016.45TrophyCentralPlaques1:22%"Coach Awards" "Employee Gifts" "Executive Gifts" "Retirement Gifts" "Service Gifts" "Custom Gifts" "Holiday Gifts" "Personalized Holiday Gifts" "Personalized Christmas Gifts" "Cheap Personalized Gifts" "Unique Gifts" "Personalized Gifts" "Men's Gifts" "Unique Men's Gifts" "Gifts For Men" "Personalized Men's Gifts" "Gifts For Him" "Business Gifts" "Executive Business Gifts" "Business Holiday Gifts" "Corporate Business Gifts" "Corporate Christmas Gifts" "Corporate Holiday Gifts" "Business Christmas Gifts" "Select Holiday Gifts" "New Products"This beautiful engraved clock holds your favorite photo. Features free engraving to make it a memorable gift. Fast 1-2 day turnaround.custom-pagepersonalized-giftsclockwphotoswivalclockdeclwiphquicrosebcloretserclocmideclariidecl8x10rosewoodclock10x13rosewoodclockaluminumclock10x13blackpianoclockpn5823bookclocksboclwhocaptainsclock1clockpenset191712-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
498555-8.52We offer engraved clocks that make great desk and office gifts. Our clock gifts are a professional and unique way to show your appreciation for someone.

Engraved Clocks - Personalized Gifts for Retirement, Milestones, and Service Recognition

Engraved clocks occupy a unique place in the recognition gift category because they combine symbolic meaning with genuine daily usefulness in a way that plaques and trophies alone cannot. A clock presented at retirement or a years of service milestone carries the natural message that time has been well spent, making the gift both emotionally resonant and practically relevant to the recipient's next chapter. Our collection spans traditional walnut and rosewood desk clocks with solid brass engraving plates suited for executive offices and formal retirement presentations, contemporary brushed metal and piano finish styles appropriate for modern workspaces, and compact desk clocks that work equally well as employee recognition gifts, volunteer appreciation awards, coach gifts, and personal milestone keepsakes. Every engraved clock arrives in a gift box ready to present, with personalized engraving documenting recipient name, occasion, organization, and date so the gift carries full context as a lasting memento rather than a generic timepiece.

Frequently Asked Questions About Engraved Clocks

What occasions are engraved clocks most commonly used for?

Retirement gifts are by far the most popular use for engraved clocks, where the symbolism of time combined with a personalized message from colleagues and the organization creates a genuinely meaningful keepsake that recipients display in home offices and living spaces for years. Years of service milestones at 10, 15, 20, and 25 years are another primary occasion, where an engraved clock communicates appreciation for a specific tenure investment in a way that a generic gift card or certificate cannot. Coach appreciation gifts at the end of a sports season use engraved clocks to honor the time coaches invest in developing athletes, making the clock symbolism particularly fitting. Teacher appreciation, volunteer recognition, and board officer gifts at the conclusion of a term of service all suit engraved clocks well for the same reason. Corporate recognition programs use them for employee of the year honors, executive gifts, and client appreciation where a desk item of obvious quality and personal meaning makes a stronger impression than a generic branded promotional item.

What should I engrave on a clock gift?

Clock engraving works best when it captures the specific relationship and occasion rather than relying on generic phrases that could apply to any recipient. For retirement gifts, include the recipient's full name, years of service, organization name, and retirement date, for example: Robert Callahan, 32 Years of Dedicated Service, Riverside School District, Retired June 2025. A brief sentiment such as Time Well Spent or Your Time to Shine adds warmth without taking up excessive space. For years of service milestones, lead with the milestone number prominently: 20 Years of Excellence, followed by name, company, and year. Coach appreciation clocks benefit from noting the sport and season: Thank You Coach, Lincoln Varsity Soccer, Fall 2025, Jennifer Walsh. Teacher gifts work well with the subject or grade level included: Mrs. Patterson, Third Grade, Oakwood Elementary, Thank You for Everything, 2025. Keep engraving concise enough to remain legible at the font size the plate accommodates, prioritizing name, occasion, and organization as the essential three elements when space is limited.

How do engraved clocks compare to plaques and trophies as recognition gifts?

Engraved clocks, plaques, and trophies each serve different recognition purposes and display contexts, and the right choice depends on where the gift will live and what the recognition is meant to communicate. Clocks are the strongest choice when the recipient is transitioning out of a role, such as retirement, term completion, or a move to a new position, because the functional nature of the gift fits naturally into their next chapter rather than looking backward like a trophy on a shelf. They are also the better choice when the gift will be displayed in a home setting where a working timepiece integrates naturally with the living environment. Plaques are stronger when the recognition should be permanently wall-mounted in an office or institutional setting, when the award is for ongoing service within an organization rather than a departure, or when a form]]>Clocks1498552-31See Our Engraved Dog Tags - All Discounted - At TrophyCentral!Shop for Sports Dog Tags at TrophyCentral. Each Sports Tag Can Be Engraved.1dog-tags-allcustom-pageclocks11"7-10 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)" "Father's Day Gifts"personalized gifts498554-610.451216.05AirflyteGiftsEngraved Gifts1:22%Engraved Gift Clock w/Photo Holders from TrophyCentral.Engraved Giftscustom-pageindexclockspersonalizedleather-leathergiftsgifts-desk-generalteacher-appreciationsoccerwaterbottleskeychains2lmfxxxpewterframesmpegofr704-5wrpastainsteelorststta1index1Find engraved gifts discounted at TrophyCentral. Each gift is personalized with initials or a monogram for a special touch. Browse our personalized gifts now.personalized-giftsEngraved Gifts for Every Occasion It's simple. Browse our huge selection of unique gifts. Click on a product image for more details and then select the options. Your personalized gift will be sent directly to you. If there are any issues with your order a rep will email or call you.

Shop with Ease at TrophyCentral

We offer discounted prices with large quantity price breaks. We also feature an industry-leading selection and free engraving. If you are looking for gift ideas, we can assist you. TrophyCentral has been helping customers since 1999. We would be thrilled to help you, too. Start shopping now!]]>custom-pageengraved-framesbuscarholgiftboxgiftwhistlecherfinhargorokebox8x10photo9x12photoststwicoapclawcocobocceramicmugssteelflasksmeboopkeychmebucahomafinopensetgavelset6962niplmoclengravablemugpencasemaplepencaserosewood11Find a great selection of engraved office gifts discounted at TrophyCentral. Personalize your gift for a special touch and recognize outstanding employees!

Engraved Office Gifts - Personalized Desk Gifts for Employees, Clients, and Colleagues

Engraved office gifts combine professional quality with personal meaning in a format that sits on a desk or shelf where the recipient sees it every single workday. Where a plaque on the wall acknowledges a formal achievement and a trophy communicates competitive success, a personalized desk gift occupies a different and equally important space in a recognition program, serving as a daily reminder of appreciation from a specific person, team, or organization. Our engraved office gift collection covers the full range of professional gifting needs, from classic pen and pen set gifts that project sophistication and daily usefulness to business card holders, paperweights, and desk accessories that complement any professional workspace. Each gift can be personalized with a recipient name, a short personal message, or a company logo, making it appropriate for employee appreciation programs, client relationship gifts, retirement presents, administrative professionals day, boss gifts, and any workplace occasion where a thoughtful personalized item communicates more than a generic store-bought alternative.

Frequently Asked Questions About Engraved Office Gifts

What occasions are engraved office gifts most appropriate for?

Engraved office gifts work across a broader range of workplace occasions than most recognition formats because the practical nature of the items makes them welcome in professional settings where a trophy or plaque might feel too formal or too casual depending on the context. Employee appreciation events and employee of the month programs use personalized desk gifts to provide recognition that recipients keep and use rather than store in a closet. Client appreciation gifts and business relationship milestones benefit from engraved pen sets and desk accessories that stay visible in a client's workspace and reinforce the professional relationship every time they reach for them. Retirement gifts suit engraved office items when the recipient is moving into a home office setting and will appreciate a quality desk piece that transitions naturally from workplace to personal space. Administrative Professionals Day, Boss Appreciation Day, and work anniversary milestones all suit engraved office gifts when the goal is something personal and professional without the formality of a full recognition award program. New employee welcome gifts and farewell gifts for departing colleagues are two additional occasions where a personalized office item communicates thoughtfulness that a gift card alone cannot match.

What engraving should I put on an office gift?

Office gift engraving works best when it is concise, personal, and appropriate for a professional setting where the item will be visible to colleagues and visitors. For individual employee or colleague gifts, the recipient name alone is the cleanest option for items with limited engraving surface such as pens and small accessories, while larger items like paperweights and business card holders can accommodate a name plus a short message or occasion. For example: Sarah Mitchell, Employee of the Year, Horizon Marketing, 2025, or Thank You for Everything, Dr. James Carroll, Retiring After 30 Years. Corporate client gifts often work best with the recipient's name and company name rather than a personal message, keeping the tone professional while still personalizing the item. Company logo engraving alongside a name suits branded corporate gift programs where consistent visual identity across all gifts is a priority. Avoid generic phrases like Thank You for Your Hard Work in favor of something specific to the person or occasion, since specificity is what distinguishes a memorable personalized gift from a forgettable one. When space is limited, name plus year is always a clean and sufficient choice that will remain meaningful to the recipient long after the occasion has passed.

How do engraved office gifts compare to plaques and crystal awards for employee recognition?

Engraved office gifts, plaques, and crystal awards each serve different purposes within an employee recognition program, and the most effective programs use all three formats at different levels and occasions rather than treating them as interchangeable alternatives. Crystal and glass awards occupy the premium tier of formal recognition, appropriate for annual gala presentations, executive honors, and distinguished achievement programs where the material itself communicates the caliber of the accomplishment. Plaques are the right choice when the recognition should be permanently wall-mounted in an office or institutional setting, building a visible record of achievement that future employees and visitors will see for years. Engraved office gifts fill the everyday recognition tier where the goal is a personal, practical token of appreciation that does not require a formal ceremony to present and works equally well for a team lead thanking a direct report as for an HR department running a monthly recognition program. The key advantage of office gifts in a recognition strategy is that they are appropriate at any time of year without the ceremony planning that formal award programs require, making them practical for spot recognition, project completion gifts, and relationship-building occasions that fall outside the annual awards calendar. See our complete collections of award plaques, crystal awards, and engraved clocks for recognition options that pair well with office gifts in a complete employee appreciation program.

If you need more information before deciding, see our expert resource section:
]]>Office Giftscustom-pageplaquesdesksigns1wasireplwallsigns1countersigns1tentsignscorridorsignsdesnfrbomagneticsignsyardsignsxstamperxscurostxpcustdatestamprubberstamps1wallsigns1tagsbadges1Find custom office signs discounted at TrophyCentral. Each custom office sign features your text!Each medal includes a neck ribbon. Fast 1-2 day shipping.

Custom Office Signs

This section features a wide variety of custom made signs for just about any office location, including walls, corridors and even table tops! Each sign is available in many colors and features your own text or image. You can even choose the size and type (font) of your lettering. If you are unsure what you need, don't worry, our experts are here to help and can guide you through the process. We also carry Yard Signs which are perfect for political campaigns and business advertising / promotions. Our Custom Desk Signs make a great gift and addition to any office!

]]>engraved-framescustom-pagepersonalized-gifts1"3-5 business days" "Marquette, MI" "UPS"personalized gifts498553-510.45167.81JDS-SGiftsEngraved Frames1:22%"New Products" "Groomsmen Gifts" "Bridesmaid Gifts"Shop for Engraved Picture Frames from TrophyCentral. Great selection of Engraved Frames.Engraved Frames1"4-7 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)""PT1=Plaques" "SC3=105503-610.45150015.451:14%"Engraving"Find replacement plates for plaques discounted at TrophyCentral. Each plaque plate features beautiful custom engraving. Fast shipping, free over $99.custom-pageproduct-engraving-resource-hub111How many characters fit on a trophy plate? What fonts are available? Expert answers to common engraving questions, plus wording ideas for sports, corporate, and school awards.custom-pageblank-medals1medals105502-40.81 2 3 4 5 6 7 8 9110024.8Classic MedallicsMedals1:22%Shop for Engraved Medals and TrophyCentral.com. Medal Includes Neck Ribbon. Fast Shipping on Engraved Medals.engraved medals, blank medals, blank engraved medals, blank award medals, medals engraved, medals engravingReturn to oursection for more great choices.Blank, GeneralBlank Engraving Medaltrophy-engravingengraving-faqsatlossforwordsguide-to-presenting-a-trophyfunny-trophy-personalization-ideastrophies-wording-samples1trophy-award-guides1Master professional trophy engraving, award personalization, and recognition presentation with expert guides. Free engraving tips, wording examples, and ceremony planning strategies from TrophyCentral's specialists.custom-pagefreeawardcertificates1"Download Only"certificates49855011TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Entrepreneurship Award template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Entrepreneurship-Award-Certificateentrepreneurship-freeEntrepreneurshipcustom-pagegeneral-corporate-awards1"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"458221511233Vision AwardsTrophies1:22%,3:24%Find Envision Business Awards with Free Engraving at TrophyCentral!Business, Generalcustom-pagemedallion-inserts-organizations12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsReligious1:22%Buy these high-quality Episcopal Inserts at TrophyCentral. Each Episcopal Insert can be used to create a unique plaque, medal or trophy.517386Religious
custom-pagetrophies-equestrian-horse1trophies498551-310.452429Trophies1Find this popular Equestrian trophy discounted at TrophyCentral. Features a real marble base, stylish 4-inch gold cup, free engraving and fast shipping.equestrian-cup-place-trophycustom-pagetrophies-equestrian-horse1"1-4 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular equestrian figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!qtequestplEquestrian, 1st / 2nd / 3rd / Etc., Sportscustom-pagetrophies-equestrian-horse1"1-4 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%This popular Equestrian Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!qtequestyrEquestrian, Sportscustom-pagetrophies-equestrian-horse1trophies498852-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with equestrian figure discounted at TrophyCentral. Includes free text engraving!cup-equest-pEquestrian, Sportscustom-pagetrophies-equestrian-horse1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these equestrian budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtequestscbEquestrian, Sportscustom-pagetrophies-equestrian-horse1498852-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Find this budget equestrian award trophy discounted at Trophy Central. Features a real marble base and plastic equestrian figure. Engraving is free. Fast 1-2 day shipping.bdg-equestrianEquestrian, Sportscustom-pagetrophies-equestrian-horse1"1-4 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous two-tier Equestrian Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtequestttEquestrian, Sportscustom-pagetrophies-equestrian-horse1"1-4 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-411.2115Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%Find this awesome Equestrian (Horse) two-tier championship trophy discounted, and with free engraving, at TrophyCentral!qtequestttwEquestrian, Sportscustom-pagetrophies-equestrian-horse1"1-4 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:26%This popular Equestrian Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtequestscEquestrian, Sportscustom-pagetrophies-equestrian-horse1"1-4 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.451622.05Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:15%These quick-ship trophies from TrophyCentral feature a Horse figure, real marble base and marble trophy figure platform, choice of column size and color.qtequestdmEquestrian, Sportscustom-pagetrophies-equestrian-horse1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Equestrian figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-equest-scbEquestrian, Sportscustom-pagetrophies-equestrian-horse1"1-4 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-411.4118Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous two-tier, 3-column champion Equestrian Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtequest3cEquestrian, Sportscustom-pagetrophies-equestrian-horse1"1-4 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:28%Our Equestrian participation trophies feature a real slant-front white marble base and free engraving.qtequestncEquestrian, Sportscustom-pagetrophies-equestrian-horse1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498852-311.41234Quick TrophyTrophiesPerpetual Trophies1:14%,3:15%,10:16%Find this Perpetual Series Trophy - EquestrianDiscounted at TrophyCentral. Each Trophy has enough room for 32 names. Ships in just 1-2 days.qtequesperpReturn to thesection for other fabulous choices and styles.trophies-equestrian-horseEquestrian, Sportscustom-pagetrophies-equestrian-horse1trophies498551-310.452429Trophies1Find our Equestrian star column trophy discounted at TrophyCentral. Features a real marble base, 6 inch gold star-shaped column, free engraving and fast shipping.equestrian-star-column-trophycustom-pageaward-medalsqtequestncqtequestscqtequestdmqtequestyrqtequestplqtequestttqtequestttwqtequest3cqtequesttrqtequesperpmqtequestscbcup-equest-scbcup-equest-pbdg-equestrianequestrian-cup-place-trophyequestrian-cup-place-column-trophyequestrian-star-column-trophy1trophies1Ship for Equestrian Trophies from TrophyCentral. Each Equestrian and Horse Show Trophy Ships in 1-2 Days. Free engraving!

🏇 Equestrian Trophies & Horse Show Awards - Celebrate Equestrian Excellence

Equestrian trophies honor the exceptional partnership between horse and rider across dressage competitions, show jumping events, hunter shows, eventing championships, barrel racing, western pleasure classes, and all disciplines celebrating equestrian achievement. As distinguished symbols recognizing both athletic skill and the unique bond between equestrians and their horses, horse show trophies and riding awards provide elegant, displayable recognition that participants treasure in tack rooms, barns, and homes for years. These quality equestrian awards feature detailed horse and rider figures in multiple poses, durable construction with premium materials, customizable column colors, solid marble or wood bases, and free personalized engraving for rider names, horse names, event details, and placement recognition. Available in sizes from budget-friendly 6-inch participation trophies to impressive 24-inch grand champion awards, horse show trophies accommodate competitions at every level from local riding clubs to national championships. Perfect for recognizing grand champions, reserve champions, division winners, high point riders, best turned out awards, sportsmanship recognition, year-end awards, or any equestrian accomplishment deserving lasting tribute, these trophies create memorable moments that celebrate dedication, training excellence, and the timeless tradition of competitive horsemanship.

Expand your recognition program: Explore 1st Place Blue Award Ribbons and Explore Custom Rosette Ribbons for traditional horse show recognition. If you need help with colors, see Ribbon Color Guide. Also see our Horseshoe Trophies, Medals and Awards. Learn more: Horse Show History and Equestrian Tradition.

Frequently Asked Questions About Equestrian Trophies

What types of equestrian trophies work best for different competitions?

For local schooling shows and pleasure riding events, 6-inch to 10-inch budget trophies with single columns provide affordable recognition for all participants and class winners. For rated shows, hunter jumper competitions, and dressage events, 10-inch to 15-inch mid-sized trophies with double columns and detailed horse and rider figures offer appropriate prestige for division champions and reserve champions. For championship shows, grand prix events, national finals, and year-end high point awards, 18-inch to 24-inch deluxe trophies with multiple tiers, premium bases, and elegant designs create impressive recognition worthy of top competitive achievements. Many show organizers also use perpetual trophies for annual championships, allowing grand champion names to be engraved on permanent display trophies while winners receive replica trophies to keep.

Should engraving include both horse and rider names?

Yes, equestrian tradition typically recognizes both partners in the achievement. Standard engraving includes rider name, horse name, competition name, class or division won, placement earned, and event date. For example: Sarah Johnson riding Midnight Magic, Grand Champion Hunter, Spring Classic Horse Show, May 2025. Some shows also include barn or trainer names for additional recognition. For team events like hunt seat equitation or drill team competitions, engrave team names along with key rider names. Youth shows often include age divisions on engraving such as Junior Hunter or Children's Pony, while adult amateur shows specify Amateur Owner or Adult Amateur divisions. Premium trophies accommodate longer engraving with multiple lines for comprehensive achievement recognition.

How do equestrian trophies differ from ribbons and other awards?

Equestrian competitions traditionally use layered recognition systems. Ribbons recognize class placements with traditional colors - blue for first place through sixth place white, making them perfect for immediate recognition of every class entry and maintaining affordability for shows with hundreds of entries. Trophies recognize more significant achievements like division champions, reserve champions, grand champions, and special awards including high point rider, best turned out, or sportsmanship recognition. Many prestigious shows combine awards - ribbons for all class placings, championship ribbon rosettes for division winners, and trophies for grand champions and year-end awards. Coolers, saddle pads, and other functional prizes also supplement trophy recognition at major championships, while perpetual trophies displayed permanently at show venues honor annual champions through engraved plates recording historical achievements.

]]>
Equestrian / Horse
custom-pagecrystalcups1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"general410187-1010.45636.45JcharlesCrystal Awards1:22%,25:25%"crystal awards" "Golf Trophies"Find this Esprit Cup Award at TrophyCentral. Discounted Trophies. The Espirit Cup Includes Free Engraving.Leadershipcustom-pagefree-school-certificate-templates1"Download Only"free-academic49855011TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Essay Contest Award template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Essay-Contest-Award-Certificateessay-contest-award-freeWriting, Academiccustom-pagestar-trophies11"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"trophies458221510.45216.45Vision AwardsGiftsEngraved Gifts1:22%,26:26%"New Products"Find this Estrella Corporate Award from TrophyCentral.06-10-2015custom-pagedrama-medals-pins12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105502-41130025Classic MedallicsInsertsMusic, Drama, Art, Dance1:22%"Drama Medals and Lapel Pins" "Award Medals" "Art / Dance / Drama Medals" "Award Medals - All Subjects" "Drama Awards"Buy these high-quality Etched Drama Inserts at TrophyCentral. Each Etched Drama Insert can be used to create a unique plaque, medal or trophy.516066Drama
custom-pagemedallion-inserts-arts-and-music-medallions12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105502-41130025Classic MedallicsInsertsMusic, Drama, Art, Dance1:22%"Award Medals" "Art / Dance / Drama Medals" "Award Medals - All Subjects"Buy these high-quality Etched Music Lyre Inserts at TrophyCentral. Each Etched Music Lyre Insert can be used to create a unique plaque, medal or trophy.512981Music / Band / Chorus
custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these high-quality Outstanding Member Inserts (518757) at TrophyCentral. Each Outstanding Member Inserts (518757) can be used to create a unique plaque, medal or trophy.518757Volunteer
custom-pagemedallion-inserts-occupational-subjects12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsMusic, Drama, Art, Dance1:22%Buy these high-quality Etched Photography Inserts at TrophyCentral. Each Etched Photography Insert can be used to create a unique plaque, medal or trophy.51819707-15-2019Art, Photography
custom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these high-quality Etched Student Of The Month Inserts at TrophyCentral. Each Etched Student Of The Month Insert can be used to create a unique plaque, medal or trophy.518172General, Academic
custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality Etched United States Navy Inserts (Etched, 518210) at TrophyCentral. Each Etched United States Navy Inserts (Etched, 518210) can be used to create a unique plaque, medal or trophy.518210Military, Hero
custom-pagequickshiptrophies-fireman12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality Etched Volunteer Fire Fighter Inserts at TrophyCentral. Each Etched Volunteer Fire Fighter Insert can be used to create a unique plaque, medal or trophy.51856101-20-2020Volunteer
custom-pageblog-trophycentral11Event planners: differentiate your services with strategic recognition planning. Learn how award expertise transforms events and becomes your competitive advantage.11Master ribbon quantity planning for any event with our comprehensive guide. Get exact calculations for sports tournaments, school field days, science fairs, and more with budget optimization tips.custom-pageaward-ribbons-printed1"1-2 business days" "Topeka, Indiana" "UPS (Post Office Priority Mail may also be available)"ribbons465711-21 26120030.36Tower RibbonRibbons1:22%,50:46%Shop for Event Ribbons at TrophyCentral. Select from popular titles including: field day, science and much more!Blue Ribbon, Baseball / T Ball, Basketball, Field Day, Science, Soccer, Swimming, Trackcustom-pagesoccerwaterbottles72"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14144016.4Glass AmericaPromotional ProductsWater Bottles1:14%,1980:41%"Basketball Water Bottles" "Logo Sports Bottles" "Sports Bottles" "Promotional Sports Bottles" "Aluminum Sports Bottles" "Stainless Water Bottles" "Aluminum Water Bottles" "Bike Water Bottles" "Bicycle Water Bottles" "Baseball Water Bottles" "Football Water Bottles" "Promotional Water Bottles" "Soccer Water Bottles"Everglade Collection from TrophyCentral. See our great selection of engraved and personalized gifts!Sports / Water Bottlescustom-pagenoindexed-items11Samples of Custom Printing for Apparel. TrophyCentral is a top-rated Yahoo merchant!1custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these high-quality Exceeding Expectations Inserts at TrophyCentral. Each Exceeding Expectations Insert can be used to create a unique plaque, medal or trophy.518745General
custom-pagecorporatepinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:30%,50:34%,100:39%,500:43%"School Pins" "School Lapel Pins"Find this Exceeding Expectations pin at TrophyCentral. Exceeding Expectations pins feature a quality finish and ship in just 1-2 business days!br563Generalcustom-pagecorporatepinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsBusiness1:30%,50:32%,100:35%,500:39%Find these Excellence - A Worthwhile Goal Pins discounted at TrophyCentral. Each lapel pin features a high-quality finish and clutch back.br525Businesscustom-pagemedals-general20medals498552-40.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful Excellence 2" Epoxy-covered insert decal discounted at TrophyCentral. Fast 1-2 day shipping.custom-pagemedals-general1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Excellence Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Excellencecustom-pagetrophies-general1trophies498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Excellence insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-Excellence-Insertcustom-pagetrophies-general1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Excellence single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - ExcellenceExcellencecustom-pagetrophies-general1trophies498551-311821.06TrophyCentralTrophies1custom-pagemedals-general1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Excellence Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Excellencecustom-pagemusicartpins1plasticpinboxvelapinbox1"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsMusic, Drama, Art, Dance1:22%,50:30%,100:40%,500:46%"Music Lapel Pins" "Band Lapel Pins" "Band Awards" "School Pins"Find these Excellence in Chorus pins discounted at TrophyCentral. Each Excellence in Chorus pin features a clutch-back and beautiful finish.br578Music / Band / Choruscustom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsGeneral1:22%Buy these high-quality Excellence In Leadership Inserts at TrophyCentral. Each Excellence In Leadership Insert can be used to create a unique plaque, medal or trophy.517789General, Business, Academic (General), Coach, Leadership
custom-pagemusicartpins1plasticpinboxvelapinbox1"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsMusic, Drama, Art, Dance1:22%,50:30%,100:40%,500:46%"Music Lapel Pins" "Band Lapel Pins" "Band Awards" "School Pins"Find these Excellence in Music pins discounted at TrophyCentral. Each Excellence in Music pin features a clutch-back and beautiful finish.br573Music / Band / Choruscustom-pagemedals-general1medals498552-30.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this Colorful Excellence insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.ExcellenceExcellencecustom-pagemedals-general1medals498552-40.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this Excellence insert medal With A Personalized Front Rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Excellencecustom-pageplaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these excellence insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.1st / 2nd / 3rd / Etc., Academic, Excellence, Sportscustom-pageacademic-general-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic MedallicsMedalsGeneral1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "School Medals" "General Award Medals"These inexpensive 1 1/4 inch Excellence Medals offer a high quality, but low price for those on a tight budget.e922912-20-2020General, Business, Academic
custom-pageaward-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic MedallicsMedalsGeneral1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "School Medals" "General Award Medals"These inexpensive 1 1/4" In Honor of Excellence Medals offer a high quality, but low price for those on a tight budget.e9163General, Academic
custom-pagetrophies-general1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our excellence insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - ExcellenceExcellencecustom-pageschool-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:22%,50:30%,100:33%,500:47%"School Pins" "School Lapel Pins"EXCELLENCE Letter Pins: EC Series EXCELLENCE Lapel Pins feature a high-quality enameled finish and ship in just 1-2 business days!ec35Generalcustom-pageschool-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:22%,50:28%,100:32%,500:42%"School Pins" "School Lapel Pins"Find Excellence pins at TrophyCentral. Each AP Series Excellence pin includes a clutch back.ap04Generalcustom-pagemedals-general1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Excellence Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Excellencecustom-pagegeneral-corporate-awards1"14 business days" "Erlanger, KY" "UPS"general410187-1010.451 2 3 4 5 6 7 8 9424.45JcharlesTrophies1:22%,25:25%Buy these Excelsior Recognition Awards and other Custom Awards from TrophyCentral.custom-pagegifts-desk-general11"8-12 business days w/engraving" "Chicago, Illinois" "UPS (FedEx available on request)"606308-121 3 230.451015.45RS OwensGifts1Find this engraved gift box discounted at TrophyCentral. Makes a beautiful office gift and includes free engraving.custom-pagegeneral-corporate-awards1606307-101 3 234228RS OwensTrophies1Find this beautiful cast metal sculpted 'continents of the world' award, showing mountain ranges and islands, discounted at TrophyCentral. Choice of antique bronze or antique silver finishes.11Expert answers to common youth soccer trophy questions. Learn about sizing, budgets, engraving, ordering for boys and girls teams, and participation vs MVP awards.custom-pageribbons1-tiaras1"1-3 business days" "Topeka, Indiana" "UPS (Post Office Priority Mail also available)"465711-21 260.8244.4Tower RibbonSpiritTiaras1:22%This 2 1/2", Eye-Catching Tiara Is Sure To Be A Hit At Any Homecoming! Ships From Indiana In Just 1-2 Business Days!rtp66211-20-2022custom-pageletter-shaped-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoName Badges1Find these popular F-shaped custom mascot badges at TrophyCentral. Great for fundraising! TrophyCentral is a top-rated Yahoo merchant.letterbadges-f11Discover the perfect awards for every county fair competition! From livestock shows to bake-offs, pie contests to science fairs - find the ideal recognition for fair participants and winners.custom-pagetrophies-golf1"10 business days" "Aliquippa, PA" "UPS"trophies1500110-1410.451236.45Glass AmericaCrystal Awards1:22%,10:25%Fairway Crystal Golf Award. Ideal for leagues, schools, and tournaments. Fast shipping.Golf, Sportscustom-pageplaques1plaques498552-41JDSPlaques1Find this falcon plaque discounted at TrophyCentral. Our falcon mascot plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Mascotcustom-pagemascottrophies1"4-6 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511016.25Classic MedallicsTrophiesAcademic1:22%,5:24%,10:28%,50:32%"Mascot Awards"Buy this Falcon mascot trophy and other mascot awards at TrophyCentral.mt201109-01-2022Mascotcustom-pagemascotinserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsMascots1Buy these quality Falcons Mascot Medal Inserts at TrophyCentral. Each Falcons Insert can be used to create a unique plaque, medal or trophy.489946Mascot
custom-pagetrophies-family-reunion20498551-30.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful Family Reunion 2" Epoxy-covered insert decal discounted at TrophyCentral. Fast 1-2 day shipping.Family Reunioncustom-pageblog-trophycentral11custom-pagetrophies-family-reunion1trophies498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Family Reunion Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Family Reunioncustom-pagefreeawardcertificates1"Download Only"certificates4985501Trophy CentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Family Reunion template is free and designed exclusively for Trophy Central. Family Reunion certificates measure 11" x 8 1/2" and can be easily downloaded and printed.family-reunion-certificatefamily-reunionFamily Reunioncustom-pagetrophies-family-reunion1trophies498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Family Reunion insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-Family Reunion-InsertFamily Reunioncustom-pagetrophies-family-reunion1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Family Reunion single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - Family ReunionFamily Reunioncustom-pagetrophies-family-reunion1trophies498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Family Reunion Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Family Reunioncustom-pagetrophies-family-reunion1medals498551-30.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this Colorful Family Reunion Insert Medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Family Reunioncustom-pagetrophies-family-reunion1trophies498551-30.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this Family Reunion insert medal With A Personalized Front Rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Family Reunioncustom-pageplaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these family reunion insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Family Reunioncustom-pagetrophies-family-reunion1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Family Reunion insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - Family ReunionFamily Reunioncustom-pagetrophies-family-reunion1plaques498552-41JDSPlaques1Find this family reunion plaque discounted at TrophyCentral. Our family reunion plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping. Choose from several popular images.Family Reunioncustom-pagetrophies-family-reunion1trophies498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Family Reunion Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Family Reunioncustom-pageaward-medalsfamily-reunion-part-ifamily-reunion-single-ifamily-reunion-mcfamily-reunion-mc-prfamily-reunion-jigffamily-reunion-jibffamily-reunion-jisffamily-reunion-champ-ifamily-reunion-award-plaquefamily-reunion-plaque-ifamily-reunion-e-part-ifamily-reunion-e-single-i1trophies1Find family reunion medals and family reunion trophies discounted at TrophyCentral. Medals feature a free ribbon and trophies include engraving.Family Reunioncustom-pagefree-sports-templates1"Download Only"free-fantasy4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Fantasy Baseball Biggest Loser Free Template. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.fantasy-baseball-loser-Mainfantasy-baseball-loserBaseball / T-Ballcustom-pagefree-sports-templates1"Download Only"free-fantasy4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Fantasy Baseball Commissioner of the Year. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.fantasy-baseball-commissioner-Mainfantasy-baseball-commissionerBaseball / T-Ballcustom-pagefree-sports-templates1"Download Only"free-fantasy4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Fantasy Baseball League Champion Free Template. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.fantasy-baseball-champ-Mainfantasy-baseball-champBaseball / T-Ballcustom-pagetrophies-baseball1fantasy-baseball-trophiesperpetual trophies498552-311.41234Trophy CentralTrophiesPerpetual Trophies1"Baseball Awards" "Baseball Trophies" "Baseball Trophies and Medals" "Baseball Medals and Trophies"Find this Perpetual Baseball Trophy Discounted at TrophyCentral. Each Trophy has enough room for 32 names. Ships in just 1-2 days.Baseball / T-Ball, Sportscustom-pagefree-sports-templates1"Download Only"free-fantasy4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Fantasy Basketball Biggest Loser Free Template. Ideal for leagues, schools, and tournaments. Instant download.fantasy-basketball-loser-Mainfantasy-basketball-loserBasketball, Fantasy Basketball, Losercustom-pagefree-sports-templates1"Download Only"free-fantasy4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Fantasy Basketball Commissioner of the Year. Ideal for leagues, schools, and tournaments. Instant download.fantasy-basketball-commissioner-Mainfantasy-basketball-commissionerBasketball, Fantasy Basketballcustom-pagefree-sports-templates1"Download Only"free-fantasy4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Fantasy Basketball League Champion Free Template. Ideal for leagues, schools, and tournaments. Instant download.fantasy-basketball-champ-Mainfantasy-basketball-champBasketball, Fantasy Basketballcustom-pagefree-sports-templates1"Download Only"free-fantasy4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Fantasy Football Biggest Loser Free Template. Ideal for leagues, schools, and tournaments. Instant download.fantasy-football-loser-Mainfantasy-football-loserFootball, Fantasy Football, Losercustom-pagefree-sports-templates1"Download Only"free-fantasy4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Fantasy Football Commissioner of the Year Free Template. Ideal for leagues, schools, and tournaments. Instant download.fantasy-football-commissioner-Mainfantasy-football-commissionerFootball, Fantasy Footballcustom-pagefree-sports-templates1"Download Only"free-fantasy4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Fantasy Football League Champion Free Template. Ideal for leagues, schools, and tournaments. Instant download.fantasy-football-champ-Mainfantasy-football-champFootball, Fantasy Footballcustom-pagetrophies-football1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.41234Quick TrophyTrophiesPerpetual Trophies11:14%,3:15%,10:16%"Football Awards" "Football Trophies"Find this Perpetual Football Trophy Discounted at TrophyCentral. Each Trophy has enough room for 32 names. Ships in just 1-2 days.qtfootperpReturn to section for our complete selection.trophies-footballFootball, Sportscustom-pagefree-sports-templates1"Download Only"free-fantasy4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Fantasy Sports Couch Potato Award Certificate is free and designed exclusively for TrophyCentral. Certificate templates measure 11 x 8 1/2 inches and can be easily downloaded and printed.fantasy-sports-couch-Mainfantasy-sports-couchFantasy Sports, Losercustom-pageribbons1-tiaras1"1-3 business days" "Topeka, Indiana" "UPS (Post Office Priority Mail also available)"465711-21 260.8244.4Tower RibbonSpiritTiaras1:22%The Fashion Series Pageant Tiara Measures 1 3/4" High and Typically Ships in Just 1-2 Business Days!custom-pagetrophies-bowling11"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"medals498852-30.3716021.6Quick TrophyMedalsSports, Hobby, Org, Livestock1:14%,10:25%,100:36%"Bowling Awards" "Award Medals - All Subjects" "Sports Medals"Find these 2 inch quick-ship Bowling medals discounted online at TrophyCentral. Medals include ribbon and ship fast - just 1-2 days!qushbomeBowlingcustom-pagetrophies-swimming-diving11"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)""PT1=Medals" "PC12=498852-30.3716021.6Quick TrophyMedalsSports, Hobby, Org, Livestock1:14%,10:25%,100:36%"Swimming Awards" "Most Popular Items" "Award Medals - All Subjects" "Sports Medals" "Swimming Medals" "Swimming Ribbons"Find these 2 inch quick-ship Swimming medals discounted online at TrophyCentral. Medals include ribbon and ship fast - just 1-2 days!Swimming / Diving, Sportscustom-pagetrophies-track-field11"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)""PT1=Medals" "PC12=498852-30.3716021.6Quick TrophyMedalsSports, Hobby, Org, Livestock1:14%,10:25%,100:36%"Track Awards" "Award Medals - All Subjects" "Sports Medals" "Track Medals" "Track Ribbons"Find these 2 inch quick-ship Track medals discounted online at TrophyCentral. Medals include ribbon and ship fast - just 1-2 days!custom-pagelapel-award-pins1100"Standard Service: 8 Business Days from Receipt of Artwork, Rush Service (Extra Charge): 3 Business Days from Receipt of Artwork" "Charlotte, NC or Oxnard, CA" "UPS (FedEx available on request)"lapel pins930338-910.37Simba CalLapel PinsGeneral1:22%,300:52%,500:62%,1000:68%"Quick-Ship Items" "Custom Lapel Pins" "Lapel Pins, Custom" "Custom Trading Pins"Find for Fast-Ship Personalized Cloisonart Pins discounted at TrophyCentral. Large bulk discounts andexclpicustom-pagemedallion-inserts-government-agencies-and-logos12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%"Award Medals" "Award Medals - All Subjects" "Medals - All Others"Buy these high-quality Fed. Aviation Administration Inserts at TrophyCentral. Each Fed. Aviation Administration Insert can be used to create a unique plaque, medal or trophy.517672General
custom-pagemedallion-inserts-government-agencies-and-logos12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%"Award Medals" "Award Medals - All Subjects" "Medals - All Others"Buy these high-quality Federal Bureau Of Prisons Inserts at TrophyCentral. Each Federal Bureau Of Prisons Insert can be used to create a unique plaque, medal or trophy.51767905-15-2017General
custom-pageservicepins1plasticpinboxvelapinbox10lapel pins105502-30.31150030.3Classic MedallicsLapel Pins11:22%,50:30%,100:33%,500:47%Find These US Federal Government Years of Service Pins discounted at TrophyCentral. Government Service lapel pins are available in 5 year increments up to 50 years. Fast 1-2 day shipping!Federal-Service-Pins10-15-2017Serviceemployee-resource-hub11Comprehensive guide to federal service pins. Learn how to select, wear, and present service pins to honor years of federal service with professionalism and respect.1custom-pageservicepins1plasticpinboxvelapinbox1105502-30.31150030.3Classic MedallicsLapel Pins1Find These 24 kt Gold Federal Service Retirement Pins Discounted At TrophyCentral. Measures 5/8". Fast 1-2 Day Shipping!Federal-Service-Retirement-Pins11Compare traditional felt pennants (classic, indoor use, budget-friendly) with polyester pennants (durable, weather-resistant, outdoor use) for your team.custom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic MedallicsMedalsSports, Hobby, Org, Livestock Bottles1:22%,100:28%,500:34%,1000:45%"Track Medals"These inexpensive 1 1/4 inch Dash (Female) Medals offer a high quality, but low price for those on a tight budget.e910202-26-2016
custom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic MedallicsMedalsSports, Hobby, Org, Livestock Bottles1:22%,100:28%,500:34%,1000:45%"Track Medals"These inexpensive 1 1/4 inch Long Jump (Female) Medals offer a high quality, but low price for those on a tight budget.e649102-26-2016
custom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic MedallicsMedalsSports, Hobby, Org, Livestock Bottles1:22%,100:28%,500:34%,1000:45%"Track Medals"These inexpensive 1 1/4 inch Distance (Female) Medals offer a high quality, but low price for those on a tight budget.e910802-26-2016
custom-pageskiingmedals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "Sports Medals" "Skiing and Snow Sports Medals"These inexpensive 1 1/4 inch Downhill Skiing (Female) Medals offer a high quality, but low price for those on a tight budget.e9274Skiing (Downhill), Sports
custom-pagetrophies-golf1"3-6 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"trophies105503-610.81612.8Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,3:23%"Golf Awards"Female Golf FIgure Electroplated Bronze Trophy, 12". Ideal for leagues, schools, and tournaments. Fast shipping.tr5329Golf, Sportscustom-pagetrophies-gymnastics12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.371 2 3 4 5 6 7 8 9115021.37Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%"Gymnastics Awards" "Gymnastics Medals"Your athletes will love these colorful Mylar Women's Gymnastics Medals from TrophyCentral. Each Women's Gymnastics medal includes a neck ribbon!tm9982gGymnastics, Sports
custom-pagesports-inserts1105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Softball Female Inserts (Litho) at TrophyCentral. Each Softball Female Insert can be used to create a unique plaque, medal or trophy.504531Softball, Sportscustom-pagesports-inserts1105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Volleyball (Female) Inserts (Litho) at TrophyCentral. Each Volleyball (Female) Insert can be used to create a unique plaque, medal or trophy.504411Volleyball, Sportscustom-pagesports-inserts1105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Female Soccer Litho Medal Insert. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.506945Soccer, Sportscustom-pagetrophies-swimming-diving12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
"PT1=Medals" "PC12=105503-60.515014Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,50:28%,100:34%,500:41%"Swimming Awards" "Award Medals - All Subjects" "Sports Medals" "Swimming Medals" "Swimming Ribbons"Find our Female Swimmers 2" Olympic-Style J-Series Medals at a super price point at TrophyCentral. Large quantity discounts available!j9034Return to thesection for more great choices.swimmingmedals112-20-2040
custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Fencing Medals"Buy these quality Fencing Foil Inserts (Litho) at TrophyCentral. Each Fencing Foil Insert can be used to create a unique plaque, medal or trophy.50421Fencing
custom-pagefield-day-templates1"Download Only"free-sports4985501Trophy CentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our 1st Place Field Day template is free and designed exclusively for Trophy Central. Field Day certificate templates measure 11" x 8 1/2" and can be easily downloaded and printed.field-day-certificate-1stfield-day-certificate-1stField Day, Academiccustom-pagefield-day-templates1"Download Only"free-sports4985501Trophy CentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our 2nd Place Field Day template is free and designed exclusively for Trophy Central. Field Day certificate templates measure 11" x 8 1/2" and can be easily downloaded and printed.field-day-certificate-2ndfield-day-certificate-2ndField Day, Academiccustom-pagefield-day-templates1"Download Only"free-sports4985501Trophy CentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our 4th Place Field Day template is free and designed exclusively for Trophy Central. Field Day certificate templates measure 11" x 8 1/2" and can be easily downloaded and printed.field-day-certificate-4thfield-day-certificate-4thField Day, Academiccustom-page9431field-day-templates"Download Only"free-sports49855011TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"See this Field Day Certificate designed exclusively for TrophyCentral! Field Day Certificates can be downloaded for free! Each field day certificate measures 11 x 8 1/2 inches.fielddayfrField Day, Academiccustom-pagefield-day-templates1"Download Only"free-sports4985501Trophy CentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Honorable Mention Field Day template is free and designed exclusively for Trophy Central. Field Day certificate templates measure 11" x 8 1/2" and can be easily downloaded and printed.field-day-certificate-honorable-mentionfield-day-certificate-honorable-mentionField Day, Academiccustom-pagefield-day-templates1"Download Only"free-sports4985501Trophy CentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Participant Place Field Day template is free and designed exclusively for Trophy Central. Field Day certificate templates measure 11" x 8 1/2" and can be easily downloaded and printed.field-day-certificate-participantfield-day-certificate-participantField Day, Academiccustom-pagefield-day-templates1"Download Only"free-sports4985501Trophy CentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our 3rd Place Field Day template is free and designed exclusively for Trophy Central. Field Day certificate templates measure 11" x 8 1/2" and can be easily downloaded and printed.field-day-certificate-3rdfield-day-certificate-3rdField Day, Academiccustom-page9431"1-2 business days" "Topeka, Indiana" "UPS (Post Office Priority Mail may also be available)"465711-21 260.3620030.36Tower RibbonRibbons11:22%,50:46%Find field day ribbons discounted at Trophy Central. Choose from 1st - 6th place, participant and more!Field Day, Academiccustom-pageawardcertificates11fielddayfr field-day-ribbonscertificates290631-31 2 3 230.45100020.45Certificate SourceCertificatesAward Certificates1:22%,25:24%,100:40%,500:50%Find These Printed Field Day Award certificates at TrophyCentral. Each Field Day Award certificate measures 11 x 8 1/2 inches.943Field Day, Academiccustom-pageaward-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
"PT1=Medals" "PC12=105503-60.7530033.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "Sports Medals" "Hockey Awards" "Hockey Medals" "Field Hockey Medals"These inexpensive 1 1/4 inch Field Hockey Medals offer a high quality, but low price for those on a tight budget.e902012-20-2020Field Hockey, Sports
custom-pagefree-sports-templates1"Download Only"free-sports49855011TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Field Hockey template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Field-Hockey-Certificatefield-hockeyField Hockey, Sportscustom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Field Hockey Female Inserts (Litho) at TrophyCentral. Each Field Hockey Female Insert can be used to create a unique plaque, medal or trophy.506011Field Hockey, Sports
custom-pagetrophies-figure-skating1trophies498551-310.452429Trophies1Find this popular Figure Skating trophy discounted at TrophyCentral. Features a real marble base, stylish 4-inch gold cup, free engraving and fast shipping.figure-skating-cup-place-trophycustom-pagetrophies-figure-skating1"1-4 (typically 1-2) business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular figure skating 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!qtskateplFigure Skating, 1st / 2nd / 3rd / Etc., Sportscustom-pagetrophies-figure-skating1"1-4 (typically 1-2) business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find these popular Figure Skating year trim trophies discounted at TrophyCentral. Available in multiple sizes and includes free personalization. Features gold year of event trim.qtskateyrFigure Skating, Sportscustom-pagetrophies-figure-skating1trophies498852-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with figure skating figure discounted at TrophyCentral. Includes free text engraving!cup-skate-pFigure Skating, Sportscustom-pagetrophies-figure-skating1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these figure skating budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtskatescbFigure Skating, Sportscustom-pagetrophies-figure-skating1498852-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Find this budget figure skating award trophy discounted at Trophy Central. Features a real marble base and plastic figure skating figure (male or female skater). Engraving is free. Fast 1-2 day shipping.bdg-figure-skatingFigure Skating, Sportscustom-pagetrophies-figure-skating1"1-4 (typically 1-2) business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous two-tier Figure Skating Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtskatettFigure Skating, Sportscustom-pagetrophies-figure-skating1"1-4 (typically 1-2) business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-411.2115Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%See this championship trophy with a Skating figure at TrophyCentral. Be sure to see all of our Skating figure awards.qtskatettwFigure Skating, Sportscustom-pagetrophies-figure-skating1"1-4 (typically 1-2) business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%Find these popular Figure Skating Single Column Elite Series trophies discounted and with free personalization at TrophyCentral.qtskatescFigure Skating, Sportscustom-pagetrophies-figure-skating1"1-4 (typically 1-2) business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.451623.65Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%Find This Popular Skating Deluxe Platform Series Trophies Discounted at TrophyCentral. Real Marble Base; Free Personalization!qtskatedmFigure Skating, Sportscustom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Figure Skating Female Inserts (Litho) at TrophyCentral. Each Figure Skating Female Insert can be used to create a unique plaque, medal or trophy.506571Figure Skating, Sports
custom-pagetrophies-figure-skating1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Figure Skating figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-skate-scbFigure Skating, Sportscustom-pagetrophies-figure-skating1"1-4 (typically 1-2) business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-411.4118Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous two-tier, Champions Line 3-Column Figure Skating Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtskate3cFigure Skating, Sportscustom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these high-quality Figure Skating Inserts at TrophyCentral. Each Figure Skating Insert can be used to create a unique plaque, medal or trophy.518257Figure Skating, Sports
custom-pagetrophies-figure-skating1"1-4 (typically 1-2) business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%,25:23%,50:29%,100:34%Our popular Figure Skating participation trophies feature a real slant-front marble base and free engraving.qtskatencFigure Skating, Sportscustom-pagetrophies-figure-skating1trophies498551-310.452429Trophies1Find our Figure Skating star column trophy discounted at TrophyCentral. Features a real marble base, 6 inch gold star-shaped column, free engraving and fast shipping.figure-skating-star-column-trophycustom-pageaward-medalsqtskatencqtskatescqtskatedmqtskateyrqtskateplqtskatettqtskatettwqtskate3cmqtskatescbcup-skate-pcup-skate-scbbdg-figure-skatingfigure-skating-cup-place-column-trophyfigure-skating-cup-place-trophyfigure-skating-star-column-trophy1trophies1"Figure Skating Awards" "Sports Trophies"Find figure skating trophies discounted at TrophyCentral. Each skating trophy includes free personalization! Fast 1-2 day shipping.

Figure Skating Trophies and Awards - Honor Every Skater, Program, and Competition Level

Figure skating trophies celebrate the grace, athleticism, and years of dedicated practice that competitive and recreational skating demands at every level of the sport. From the youngest learn-to-skate participants completing their first session to pre-preliminary skaters landing their first jumps, from juvenile and intermediate competitors advancing through USFS test structures to high school and adult recreational skaters performing in annual ice shows and club exhibitions, quality figure skating awards honor the commitment that every skater and their family invests in the sport. Our figure skating trophy collection features skating figurine designs capturing skaters mid-spin, in layback positions, and in the athletic poses that define the sport's visual identity, available in economy sizes for participation and session completion awards all the way through impressive single-column and multi-tier trophies appropriate for invitational competition champions and club achievement honors. Figure skating medals with free neck ribbons offer an affordable recognition alternative well suited for large invitational events recognizing multiple disciplines and levels simultaneously, while figure skating plaques provide permanent wall-mounted recognition for club offices, rink lobbies, and coach recognition programs. Every figure skating trophy includes free engraving personalized with skater name, discipline, event or competition name, club, and season year.

Frequently Asked Questions About Figure Skating Trophies

What skating events and programs use figure skating trophies?

Figure skating trophies and awards are used across a wide range of competitive and recreational skating contexts. Learn-to-skate programs use participation trophies and medals at session completion ceremonies to celebrate young skaters finishing their first structured instruction, building enthusiasm for continued skating and creating a positive first experience with competitive recognition. Skating club invitationals and local competitions recognize skaters across multiple disciplines including free skate, ice dance, pairs, and synchronized skating, with trophies for first through third place finishers in each level and discipline creating a competitive structure that motivates skaters to prepare and perform their best. Annual ice shows and club exhibitions use participation awards and special recognition trophies to honor every skater who performed, with larger awards for featured performers, senior soloists, and choreography standouts. Summer skating camps and intensive training programs present trophies and medals at the conclusion of the program to recognize skill development, most improved, and special achievement across the week or session. High school skating clubs and synchronized skating teams competing in regional and national competitions use trophies to mark placement results and team championship achievements. Adult recreational skating programs including freestyle sessions, adult competition events, and social skating clubs use figure skating trophies for year-end recognition ceremonies that honor participation, improvement, and the community spirit that adult skating programs thrive on.

What trophy sizes work best for different figure skating recognition levels?

Figure skating trophy sizing should reflect the competitive level and significance of the achievement being recognized within the program's overall award structure. Learn-to-skate session completion trophies work best in the 6-inch to 9-inch economy range that provides meaningful recognition for young skaters without exceeding the budget constraints of large group programs that may be awarding dozens of skaters at a single ceremony. Basic skills and pre-preliminary competition trophies for first through third place finishers suit the 10-inch to 14-inch single column range, giving young competitive skaters a trophy with enough presence to display proudly while keeping costs manageable across a large field of entries. Juvenile through intermediate level competition awards warrant 14-inch to 18-inch premium trophies that reflect the increasing technical difficulty and commitment required at these levels of the USFS structure. Club championship, invitational overall winner, and high-level competition trophies deserve 18-inch to 24-inch multi-column pieces that serve as the centerpiece award of the event and communicate clearly that something exceptional was achieved on the ice. Synchronized skating team championships and special recognition awards at the top tier of club programs benefit from the most impressive trophy available, since these achievements represent sustained team commitment that a modest award fails to honor appropriately. Participation awards for ice show performers and recreational program completers work well as medals with ribbons, which are easy to distribute during large cast ceremonies and serve as wearable keepsakes that travel home from the rink more conveniently than a boxed trophy.

What details should figure skating trophy engraving include?

Figure skating trophy engraving should capture the skater, the discipline, the event, and the achievement level so the trophy remains a meaningful keepsake as the skater advances through the sport over subsequent seasons. Essential elements include skater name, placement or award title, discipline and level if applicable, competition or event name, skating club, and season year. For example: Olivia Chen, First Place, Free Skate, Pre-Preliminary Level, Lakeside Invitational, Riverside Skating Club, 2025, or Marcus Williams, Most Improved Skater, Learn to Skate Spring Session, Ice Palace FSC, 2025. Ice show and exhibition trophies benefit from noting the specific performance or role: Sofia Park, Featured Soloist, Holiday Ice Spectacular, Northside Figure Skating Club, December 2025. Synchronized skating team trophies should include the team name and division alongside the placement: Riverside Edges, First Place, Juvenile Team, Regional Synchronized Skating Championships, 2025. Coach and program recognition trophies are particularly meaningful in figure skating where coaches invest enormous personal time in their skaters, and including years of coaching service alongside the club name honors the depth of that commitment: Coach Jennifer Walsh, 15 Years of Excellence, Lakeview Figure Skating Club, 2025. For large invitationals where engraving every placement trophy individually before the event is impractical, leaving the skater name and placement to be filled after results are announced while pre-engraving the competition name, discipline, level, and year keeps the pre-event workload manageable without sacrificing the personalization that makes each trophy meaningful.

If you need more information before deciding, see our expert resource section:
]]>Figure Skatingcustom-pagenoindexed-items111find-item-contents11custom-pagefreeawardcertificates1"Download Only"certificates49855011TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Fine Arts Award template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Fine-Arts-Award-Certificatefine-arts-award-freeArt, Academiccustom-pageschool-pinsplasticpinboxvelapinbox10105502-30.31150030.3Classic MedallicsLapel Pins11:22%,50:30%,100:33%,500:47%Find These Fine Arts Lapel Pins Discounted At TrophyCentral. Each Fine Arts Pin Features A Clutch-Back. Fast 1-2 Day Shipping!Fine-ArtsFine Arts, Artcustom-pagemedallion-inserts-arts-and-music-medallions12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsMusic, Drama, Art, Dance1:22%"Award Medals" "Art / Dance / Drama Medals" "Award Medals - All Subjects" "Art Awards"Buy these high-quality Fine Arts Painting Sculpture Inserts at TrophyCentral. Each Fine Arts Painting Sculpture Insert can be used to create a unique plaque, medal or trophy.518196Art, Academic
custom-pageart-trophies1"3-6 business days with engraving, Without engraving: 1-3 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"plaques105503-610.4511219.65Classic MedallicsPlaquesInsert1:22%,3:24%,5:27%Genuine Walnut Fine Arts Plaque with 2 Inch Insert and Free Engraving.51-8196Art, Academic1lapel-award-pins1Find fire department pins and other hero lapel pins discounted at TrophyCentral. Each fire department pin features a clutch back for easy attachment to clothing.Shop for Firefighter Pins with Ease at TrophyCentral Find a great selection of fire department pins, low pricing, bulk discounting and great customer service. IF you need help, call our customer service experts in Michigan and New York. They would love to help you!]]>Firefighter / Hero / EMS / Nursingcustom-pagemedallion-inserts-occupational-subjects12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these quality Fire Department (49919) Inserts (Litho) at TrophyCentral. Each 2" insert can be used to create a unique plaque, medal or trophy.49919Firefighter, Hero
custom-pagemedallion-inserts-occupational-subjects12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these quality Fire Department (501171) Inserts (Litho) at TrophyCentral. Each Fire Department (501171) Insert can be used to create a unique plaque, medal or trophy.501171Firefighter, Hero
custom-pagequickshiptrophies-fireman20trophies498551-30.5100021TrophyCentralInsertsSports, Hobby, Org, Livestock1Find this colorful Fire Department 2" Epoxy-covered insert discounted at TrophyCentral. Fast 1-2 day shipping.Firefighteracpin1corporatepins1Find fire department award pins discounted at TrophyCentral. Each fire department pin features a clutch-back. Lapel pins and medals ship in 1-2 days!

Shop With Confidence at TrophyCentral

We offer a huge selection, discounted prices and great customer service. Do you need help with some ideas or with ordering? Yes, we sell online, but we have real people who would love to help you! Feel free to call our customer service experts in Michigan, New York and online. TrophyCentral - delivering smiles since 1999!


]]>
servicepins1 engraveablepinFrontline Workers / Firefighter
custom-pagequickshiptrophies-fireman1498551-31.520033TrophyCentralMedalsSports, Hobby, Org, Livestock1Find these Fire Department Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Firefightercustom-pagequickshiptrophies-fireman1trophies498551-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Fire Department insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Firefightercustom-pagequickshiptrophies-fireman1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Fire Department single column insert trophy features a choice of column color, a marble base and free trophy engraving.Firefightercustom-pagequickshiptrophies-fireman1trophies498551-311821.06TrophyCentralTrophies1Firefightercustom-pagequickshiptrophies-fireman1498551-31.520033TrophyCentralMedalsSports, Hobby, Org, Livestock1Find these Fire Department Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Firefightercustom-pagequickshiptrophies-fireman1498551-30.525035.5TrophyCentralMedalsSports, Hobby, Org, Livestock1Find this colorful Fire Department insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Firefightercustom-pagequickshiptrophies-fireman1498551-30.525035.5TrophyCentralMedalsSports, Hobby, Org, Livestock1Find this Fire Department insert medal with a personalized front rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Firefightercustom-pagequickshiptrophies-fireman1plaques498551-311.11623.5TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these Fire Department insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Firefightercustom-pagequickshiptrophies-fireman1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our fire department insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Firefightercustom-pagecorporatepins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsHero1:22%,50:30%,100:40%,500:46%Find Fire Department pins discounted at TrophyCentral. Each Fire Department lapel pin features a clutch-back and fast 1-2 day shipping!fire06-30-2012Occupations, Military, Hero, Fire Departmentcustom-pagequickshiptrophies-fireman1plaques498552-41JDSPlaques1Find this fire department plaque discounted at TrophyCentral. Our fire department plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Military / Herocustom-pagecorporatepins1plasticpinboxvelapinbox10lapel pins105502-31Lapel Pins1Shop for these Fire Department Service Pins At TrophyCentral. Fire Service Pins Are Available With Imprints From 5 Years To 45 Years.firepin1312020Fire Department, Herocustom-pagequickshiptrophies-fireman1498551-31.520033TrophyCentralMedalsSports, Hobby, Org, Livestock1Find these Fire Department Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Firefightercustom-pagequickshiptrophies-fireman12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
trophies105502-41130025Classic MedallicsInsertsHero1:22%Buy these quality Fire Emblem Inserts (Litho) at TrophyCentral. Each 2" insert can be used to create a unique plaque, medal or trophy.49840304-15-2015Firefighter, Hero
custom-pagemedallion-inserts-occupational-subjects12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality Fire Fighter Inserts at TrophyCentral. Each Fire Fighter Insert can be used to create a unique plaque, medal or trophy.518562Firefighter, Hero
custom-pagecorporatepins1lapel pins105502-40.39125035.39Classic MedallicsGiftsKeychains1:22%,10:25%,25:32%,50:39%,100:47%Find these popular Pewter Fire Helmet Key Chains at TrophyCentral; discounted prices!pk75-cmKeychainscustom-pagequickshiptrophies-fireman1trophies498551-310.452429Trophies1Find this popular Firefighter trophy discounted at TrophyCentral. Features a real marble base, stylish 4-inch gold cup, free engraving and fast shipping.firefighter-cup-place-trophycustom-pagefreeawardcertificates1"Download Only"certificates4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Firefighter Award template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Firefighter-Award-Certificatefirefighter-freeHero, Firefightercustom-pagequickshiptrophies-fireman1trophies498551-311821.06TrophyCentralTrophies1Firefightercustom-pagequickshiptrophies-fireman1trophies498551-310.71217.38Trophies1Firefightercustom-pagecorporatepinsplasticpinboxvelapinbox10105502-30.31150030.3Classic MedallicsLapel Pins11:22%,50:30%,100:33%,500:47%Find These Firefighter Maltese Cross Pins Discounted at TrophyCentral. Each Firefighter Maltese Cross Pin Features a Clutch-Back. Fast 1-2 Day Shipping!Firefighter-Maltese-CrossFire Department, Hero1service-medals1Honor firefighter bravery and service with custom firefighter medals. Perfect for ceremonies, retirements, and recognition events. Free engraving and fast shipping available.Shop for Unique Firefighter Medals with Ease at TrophyCentral Honor the brave men and women who risk their lives to protect our communities with firefighter medals that truly recognize their courage and dedication. Whether celebrating years of service, heroic acts, retirement milestones, or departmental achievements, our firefighter medals provide the dignified recognition these heroes deserve. Our firefighter medal collection features designs specifically created to honor the fire service, with symbols and imagery that reflect the pride and tradition of firefighting. From classic maltese cross designs to modern commemorative styles, each medal captures the essence of firefighter valor and commitment to public safety. Every firefighter medal includes free personalized engraving to make each award meaningful and memorable. Add recipient names, dates of service, specific achievements, department names, or special messages to create lasting recognition. Whether for individual heroism, years of service milestones, or team achievements, personalized engraving ensures each medal tells its own story of service. Perfect for award ceremonies, retirement celebrations, promotional events, or memorial services, these medals provide the formal recognition that firefighter service demands. With our quick 1-2 day production time and volume discounts for departments, honoring your firefighters has never been more convenient or affordable.RetryClaude can make mistakes. Please double-check responses.]]>quickshiptrophies-firemanFirefightercustom-pagequickshiptrophies-fireman11plaques105503-610.4511219.65Classic MedallicsPlaquesBlank Plaques1:22%Shop for Firefighter Plaque from TrophyCentral. Fast Shipping on Firefighter Plaques and Awards.Firefightercustom-pagequickshiptrophies-fireman11trophies105503-610.451618.45Classic MedallicsTrophies1:22%,2:24%"Hero Awards" "Fire Awards" "Fire Trophies" "Fire Department Awards" "Fire Department Trophies"Shop for Firefighter Plaques from TrophyCentral; Free Engraving. TrophyCentral is a Top-Rated Yahoo Merchant.07-20-2018Firefightercustom-pagequickshiptrophies-fireman11trophies105503-610.4511618.05Classic MedallicsTrophiesHero1:22%Shop for Firefighter Trophies from TrophyCentral. Fast Shipping on Firefighter Trophies and Awards.07-31-2018Firefightercustom-pagequickshiptrophies-fireman11trophies105503-610.451614.25Classic MedallicsTrophies1:22%"Hero Awards" "Fire Awards" "Fire Trophies" "Fire Department Awards" "Fire Department Trophies"Shop for Firefighter Trophies at TrophyCentral. Each Firefighter Trophy Includes Free Engraving!07-30-2018Firefightercustom-pagequickshiptrophies-fireman1trophies498551-310.452429Trophies1Find our Firefighter star column trophy discounted at TrophyCentral. Features a real marble base, 6 inch gold star-shaped column, free engraving and fast shipping.firefighter-star-column-trophycustom-pagetrophies-volunteerfire-department-award-plaqueshieldplaquenurse-award-plaqueems-award-plaquepn5614vol-fire-plaque-ifire-department-plaque-ifiplwaappl51-40935185615140931trophies1Find firefighter trophies and awards discounted at TrophyCentral. Each firefighter trophy includes engraving. Medals include a ribbon. Recognize your local hero now!firefighter trophies, firefighter trophy, firefighter awards, firefighter trophies and awardsCustom Firefighter Trophies and Awards - Honor Those Who Serve

Firefighter trophies and awards recognize the courage, dedication, and sacrifice that define a life in the fire service. From volunteer fire departments honoring members who give their time to protect their neighbors, to career departments celebrating promotions, retirements, and years of service milestones, to fire academies marking the moment recruits earn their badge, quality firefighter awards give these moments the dignity they deserve. Our collection features designs created specifically for the fire service, including classic Maltese cross figures, ladder and helmet motifs, and firefighter figurines in action poses, available in resin, acrylic, and crystal finishes across a wide range of sizes and price points. Every trophy includes free custom engraving to add recipient names, station numbers, dates, ranks, and department information, and medals include a free ribbon - making them ideal for annual banquet recognition, muster competition awards, retirement ceremonies, fire prevention week events, and department appreciation nights. Volume discounts are available for departments ordering multiple pieces, and fast production times mean orders are ready when your ceremony is.

Frequently Asked Questions About Firefighter Trophies

What occasions typically call for firefighter trophies and awards?

Firefighter awards are used across a wide range of department events and milestones. Annual awards banquets are the most common occasion, where departments recognize firefighter of the year, rookie of the year, most calls responded to, and community service awards. Retirement ceremonies call for larger, more substantial pieces - two-tier trophies, walnut plaques, or engraved crystal awards - that reflect a full career of service. Fire academy graduations typically use medals or column trophies presented to each recruit. Muster competitions and fire department rodeo events use place trophies for individual and team events. Fire prevention week events sometimes include recognition for station open house volunteers or community educators. Departments that sponsor youth programs may also order participation trophies for junior firefighter or explorer post members.

What should firefighter trophy engraving include?

The right engraving transforms a trophy into a lasting record of service. For individual awards, include the recipient's name, rank or title, award name, department or station name, and year. For retirement trophies, adding the years of service - "20 Years of Dedicated Service" - gives the piece additional meaning. For competition or muster awards, include the event name, place finish, and date. For memorial or special recognition awards, a brief phrase such as "In Recognition of Exceptional Valor" adds weight appropriate to the occasion. Keep lines concise so the engraving remains readable, and prioritize the details that will matter most to the recipient and their family years from now.

What is the difference between the firefighter and fire department trophy designs?

Both design families cover the same range of trophy styles and sizes, but the insert artwork differs. Firefighter inserts typically feature a single figure in turnout gear or action pose, emphasizing the individual first responder. Fire department inserts more commonly feature station emblems, Maltese cross symbols, ladder truck imagery, or department-style crests, making them better suited for station-level or departmental recognition rather than individual achievement awards. For volunteer recognition, we offer a dedicated Volunteer Firefighter series with insert artwork that specifically acknowledges the volunteer nature of the service.

]]>
trophies firefighter-medals trophies-military-heroFirefighter
custom-pagequickshiptrophies-fireman1"7-10 business days w/engraving" "Chicago, Illinois" "UPS (FedEx available on request)"trophies606307-101 3 230.451619.65RS OwensTrophies1This fabulous trophy features an antique bronze firefighter climbing a ladder. The figure sits atop a marble and Walnut base. Price includes engraving!custom-pagequickshiptrophies-fireman1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesHero1:14%,10:18%,50:22%,100:25%Find this popular firefighter figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at trophyCentral. Ships in a fast 1-2 days!qtfiremanplFirefighter, Hero, 1st / 2nd / 3rd / Etc.custom-pagequickshiptrophies-fireman1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesHero1:14%,10:18%,50:22%,100:25%This popular Fireman trophy features a real marble base, column, figure and trim indicating year of award. Includes up to three lines of free engraving!qtfiremanyrFirefighter, Herocustom-pagequickshiptrophies-fireman1trophies498552-311821.06TrophiesHero1Find this achievement cup trophy with fireman figure discounted at TrophyCentral. Includes free text engraving!cup-fireman-pFirefighter, Herocustom-pagequickshiptrophies-fireman1trophies498552-312421.33TrophiesHero1Find these fireman budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtfiremanscbFirefighter, Herocustom-pagequickshiptrophies-fireman1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75434.75Quick TrophyTrophiesHero1:14%,3:19%,10:27%Find these fabulous Firefighter Two-Tier Trophies discounted online at TrophyCentral. Quick 1-2 day shipping! Free Personalization!qtfiremanttFirefighter, Herocustom-pagequickshiptrophies-fireman1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.751434.75Quick TrophyTrophiesHero1:14%,10:28%See this championship trophy with a Fireman figure at TrophyCentral. Be sure to see all of our Fireman figure awards.qtfiremanttwFirefighter, Herocustom-pagequickshiptrophies-fireman1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesHero1:14%,10:18%,50:24%,100:28%This popular Fireman Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtfiremanscFirefighter, Herocustom-pagequickshiptrophies-fireman1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.05Quick TrophyTrophiesHero1:14%,10:18%Find This Popular Fireman Deluxe Platform Series Trophy Discounted at TrophyCentral. Real Marble Base; Free Personalization!qtfiremandmFirefighter, Herocustom-pagequickshiptrophies-fireman1trophies498552-311218.84TrophiesHero1Find this unique cup trophy with Fireman figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-fireman-scbFirefighter, Herocustom-pagequickshiptrophies-fireman1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.41226Quick TrophyTrophiesHero1:14%,3:19%,10:24%Find these fabulous Fireman Line 3-column Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qtfireman3cFirefighter, Herocustom-pagequickshiptrophies-fireman1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453633.4Quick TrophyTrophiesHero1:14%,100:38%"Hero Awards" "Fireman Awards" "Firefighter Awards"Our popular Fireman participation trophies feature a real slant-front marble base and free engraving.qtfiremanncFirefighter, Herocustom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality First Armor Division Inserts at TrophyCentral. Each First Armor Division Insert can be used to create a unique plaque, medal or trophy.515096Military, Hero, Army
custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality First Calvary Division Inserts at TrophyCentral. Each First Calvary Division Insert can be used to create a unique plaque, medal or trophy.515063Military, Hero, Army
custom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality First Infantry Division Inserts at TrophyCentral. Each First Infantry Division Insert can be used to create a unique plaque, medal or trophy.515085Military, Hero, Army
custom-page1st-place-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130042.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%,50:30%,100:36%,500:42%Shop for First Place Torch Medals at TrophyCentral. Fast 1-2 Day Shipping!tm9915gReturn to thesection for more fabulous choices.place-medalsSports, Academic, General, Torch, Achievement, 1st / 2nd / 3rd / Etc.
custom-page11111Budget student awards for first semester. 12 recognition ideas under $50 per class. Free certificates, ribbons, and medals. Fast shipping for teachers.custom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceSealsEmbosser Seals1:22%,3:28%,5:31%Find these First Semester Embossed Certificate Seals discounted at TrophyCentral.803fsGeneralcustom-pagefishing-medals20medals498554-Feb0.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful Fishing 2" Epoxy-covered insert decal discounted at TrophyCentral. Fast 1-2 day shipping.Fishing, Sportscustom-pagefishing-medals1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Fishing Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Fishing, Sportscustom-pagetrophies-bass-fishing1trophies498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Fishing insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-Fishing-InsertFishing, Sportscustom-pagetrophies-bass-fishing1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Fishing single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - FishingFishing, Sportscustom-pagetrophies-bass-fishing1trophies498551-311821.06TrophyCentralTrophies1Fishing, Sportscustom-pagetrophies-bass-fishing1trophies498551-310.71217.38Trophies1Fishing, Sportscustom-pagefishing-medals1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Fishing Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Fishing, Sportscustom-pagefishing-medals1medals498553-Feb0.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this colorful Fishing insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Fishing, Sportscustom-pagefishing-medals1medals498553-Feb0.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this Fishing insert medal with a personalized front rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Fishing, Sportscustom-pageplaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these fishing insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Fishing, Sportscustom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Fishing Inserts (Litho) at TrophyCentral. Each Fishing Insert can be used to create a unique plaque, medal or trophy.501471Fishing, Sports
custom-pageaward-medalsfishing-mcfishing-mc-prtm9979gfishing-jigffishing-jibffishing-jisf11Find fishing medals discounted at TrophyCentral. Each fishing medal includes a free ribbon. Fast shipping!trophies-bass-fishing trophies-marlin-fishingFishingcustom-pagetrophies-bass-fishing1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our fishing insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - FishingFishing, Sportscustom-pagefishing-medals1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Fishing Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Fishing, Sportsquickshiptrophies-marlinqtbassncqtbassscqtbassdmqtbassyrqtbassplqtbassttqtbassttwqtbass3cwbt790tm9979gqtbassperpquickshiptrophies-marlin11"Fishing Awards" "Sports Trophies"Find a great selection of Bass Fishing Trophies at TrophyCentral. Each Bass Fish Trophy and Award includes free personalization.

Fishing Trophies and Awards

TrophyCentral has a great selection of bass and marlin fishing trophies. Be sure to see our popular Single Column trophies, available in several sizes and with several different color columns, and our place trophies – with a choice of 1st, 2nd or 3rd place trim. All of our fishing awards include up to three lines of FREE ENGRAVING (larger trophies include additional lines). We also offer FREE SHIPPING on award orders over $100 shipping to the continental U.S.]]>
Fishing (Bass)
quickshiptrophies-bassqtmarlinncqtmarlinscqtmarlindmqtmarlinplqtmarlinyrqtmarlinttqtmarlinttwqtmarlin3cquickshiptrophies-bass11"Fishing Awards"Find Marlin Fishing Trophies Discounted at TrophyCentral. Each Marlin Fish Trophy Includes Free Personalization! Fast 1-2 Day Shipping!

Marlin Fishing Trophies and Awards

TrophyCentral has a great selection of bass and marlin fishing trophies appropriate for contests and clubs. Be sure to see our popular Single Column trophies, available in several sizes and with several different color columns, and our place trophies – with a choice of 1st, 2nd or 3rd place trim. All of our marlin fishing awards include up to three lines of FREE ENGRAVING (larger trophies include additional lines). We also offer FREE SHIPPING on award orders over $100 shipping to the continental U.S. ]]>
Fishing (Marlin)
custom-pagebaseballdisplay11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 23 24 25119Perfect CaseDisplay Cases11:14%,5:18%Five Baseball Glass Display Case. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.basedisplay-5Baseball / T-Ball, Sportscustom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceSealsEmbosser Seals1:22%,3:28%,5:31%Find these Flag (Die Cut) Embossed Certificate Seals discounted at TrophyCentral.803dfFlagcustom-pagedisplaycases211"7-10 business days" "Connelly Springs, North Carolina" "UPS (FedEx available on request)"display case286127-1010.4520SpartaCraftDisplay CasesSpecialty Cases11:14%"Military Awards"Find This Fabulous Flag Case with Medal Display and other Flag Cases at TrophyCentral.Flag Casescustom-pagetrophycasesdisplaycase1trflcacaflcecaflagdisplayflagcase1vekeurntrdistmedica1pemeurnburialflagchcodicasecodi6timedicapedestal11"Military Awards" "Glass Display Case" "Glass Display Cases" "Glass Trophy Cases" "Glass Trophy Case" "Retail Displays" "Retail Display Cases" "Retail Display" "Retail Cases" "Retail Store Display" "Retail Store Displays" "Retail Display Case"Find challenge coin displays and flag display cases discounted at TrophyCentral. Add personalization for a special touch.Personalized Flag Display Cases TrophyCentral has an industry-leading selection of flag displays to meet all of your needs. Choose from a simple flag case to hold a single flag or one that holds a certificate and even your prized military medals. Available with optional engraving.

Custom Challenge Coin Display Cases

We also carry quality challenge coin racks in a variety of sizes and beautiful wood finishes. Similar to our flag cases, displays feature optional engraving.

Shop with Confidence at TrophyCentral!

If you are shopping for flag cases or military displays, look no further! Our experts in New York and Michigan have been providing suggestions and guidance since 1999!
]]>
custom-pagestar-pinsflagpins1amflpinwieabr718-flag-with-starheshflpinusflpiwistoffrlapinambrflpinamjaflpinusarmyflagpinsusmausflpinusnavyflagpinsusgecrflpinusairfolapinonamefire1corporatepins1"Employee Lapel Pins" "Corporate Lapel Pins"Find American flag pins in a number of patriotic styles. Each American flag pin features a clutch-pin back for easy and safe attachment to clothing. flaglapelpins

American Flag Lapel Pins - Patriotic Pins for Every Occasion

American flag lapel pins are one of the most recognized symbols of patriotism and national pride, worn by elected officials, veterans, business leaders, educators, and everyday citizens to display their respect for the country. Our collection covers the full range of patriotic pin styles, from the classic waving brass flag pin to eagle and flag combinations conveying strength and pride, heart-shaped flag designs expressing love of country, military branch pins honoring service members in the Army, Navy, Air Force, and Marines, and friendship flag pins celebrating the bond between the United States and allied nations. Each pin is finished in durable enamel with vivid red, white, and blue coloring and features a secure clutch back that attaches firmly to lapels, shirt collars, uniform jackets, hats, and bags. Volume pricing makes it practical to order flag pins in quantity for employee distribution, event giveaways, patriotic ceremonies, and organizational recognition programs.

Frequently Asked Questions About Flag Lapel Pins

What occasions are American flag lapel pins appropriate for?

American flag lapel pins are appropriate for virtually any occasion where patriotism, national pride, or respect for service is relevant. Political campaigns and civic events have a long tradition of flag pin wearing among candidates and officials, making them a staple at rallies, town halls, and public appearances. Veterans organizations, military reunions, and Memorial Day and Veterans Day ceremonies commonly use flag pins as both personal expressions of service and as items distributed to participants and honorees. Businesses frequently provide flag pins to employees for display on uniforms or professional attire, particularly in industries like hospitality, retail, and public service where client-facing presentation matters. Schools and civic organizations distribute flag pins at patriotic events, naturalization ceremonies for new citizens, and Fourth of July celebrations. Military branch pins pairing the American flag with Army, Navy, Air Force, or Marine insignia make meaningful recognition gifts for service members and veterans, and friendship flag pins work well for international business meetings, exchange programs, and diplomatic events honoring relationships between allied nations.

How are flag lapel pins attached to clothing?

Each flag lapel pin includes a clutch back, which is the standard attachment mechanism for most lapel pins. A clutch back consists of a metal post on the back of the pin that slides through the fabric and locks into a small metal clasp, holding the pin securely in place without damaging the garment. Clutch backs work well on suit lapels, dress shirt collars, uniform jackets, blazers, and most woven fabrics. To attach the pin, simply push the post through the fabric at the desired location and press the clutch down over the post until it clicks into place. To remove, squeeze the clutch from both sides to release the post. Flag pins are most traditionally worn on the left lapel near the heart, though placement on shirt collars, jacket pockets, hats, and bags is also common and a matter of personal preference.

What is the difference between the flag pin styles in this collection?

The waving flag pin in brass is the most traditional style, depicting the American flag in a rippled wave design that suggests movement and is the type most commonly seen on suit lapels in professional and political settings. Eagle and flag combinations add a second patriotic symbol, with the bald eagle representing national strength and freedom alongside the flag, making them popular for veterans organizations and civic groups where both symbols hold meaning. The heart-shaped flag pin presents the flag in a heart shape, conveying love of country in a softer, more personal design that works well for community events and general patriotic wear. Military branch pins pair the American flag with Army, Navy, Air Force, or Marine insignia on a single pin, making them the appropriate choice for recognizing or honoring service members in a specific branch. Friendship flag pins display two national flags side by side, suited for international business relationships, cultural exchange events, and recognition of ties between the United States and specific allied nations. All styles share the same quality construction and clutch back attachment.

If you need more information before deciding, see our expert resource section:
]]>
fire-department-pins engraveablepin
custom-pagegifts-desk-general1"10 business days" "Aliquippa, PA" "UPS"1500110-1410.45618.45Glass AmericaCrystal Awards1:22%,10:25%Flags Desk Set from TrophyCentral. See our great selection of engraved and personalized gifts!custom-pagestar-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsGeneral1:30%,50:34%,100:38%"Star Pins" "Star Lapel Pins" "Star Award Pins"Find this gold star - 3/4 inch flat pin at TrophyCentral. Gold stars and other award pins ship in just 1-2 business days!br464gStar, Generalcustom-pageaward-ribbons-rosetteseventribbonsfunribbonsscoolribbonsrsubxxrsubxxcres6xx1esxstocawribwitflatstocpinrs2cx2dgsxresxbaseball-ribbonsswimming-ribbonstrack-ribbonsbasketball-ribbonssoccer-ribbonscusflatribcusflatrib1conribcomsoocucoriconribcomsoo111Find flat ribbons discounted at TrophyCentral. Choose from a large variety of styles to meet your needs. Stock and custom options available.award-ribbons-rosettes

Printed Award Ribbons - Ready-to-Present Recognition for Schools and Events

Printed award ribbons are the practical recognition solution for teachers, coaches, and event coordinators who need to present meaningful awards to large groups quickly and affordably. Where engraved trophies and medals require personalization lead time, printed ribbons ship fast and arrive ready to hand out at the next class, meet, or tournament. Available in economy 1-5/8 inch styles for maximum budget efficiency, standard 2 x 8 inch stock ribbons in traditional place colors, full color printed designs featuring sport-specific and subject-specific artwork, and ribbon sets with card and string attachment for immediate pinning, our selection covers every common recognition need from 1st through 3rd place finishes to participation acknowledgment to school subject awards. Sport-specific ribbon sets for baseball, basketball, soccer, swimming, and track include coordinating designs that connect the award to the activity, while school and fun ribbon styles serve classroom reward programs across grade levels and subjects.

Frequently Asked Questions About Printed Award Ribbons

What is the difference between stock ribbons, printed ribbons, and full color ribbons?

Stock ribbons are the most basic style, featuring a solid color fabric with a simple pre-printed title such as 1st Place, 2nd Place, or Participant in a single ink color. They are the most affordable option and work well for large field days, track meets, and youth league programs where volume matters most and budget is the primary consideration. Printed recognition ribbons add more graphic detail to the ribbon face, incorporating award titles with decorative borders or simple design elements that make the ribbon feel more distinctive than a plain stock style. Full color ribbons feature vibrant multicolor printed designs, often incorporating sport-specific imagery or detailed artwork alongside the award title, producing a finished ribbon that looks more substantial and visually appealing at presentation. Sport-specific ribbon sets such as those for baseball, basketball, soccer, swimming, and track use full color designs tied directly to the activity, making them ideal when you want the ribbon to immediately communicate both the achievement and the sport. The right choice depends on your budget, the size of your program, and how prominently the visual design of the ribbon matters to your recipients.

What occasions are printed award ribbons most commonly used for?

Printed award ribbons are used most heavily in elementary and middle school classroom recognition programs, where teachers distribute ribbons for reading milestones, spelling bees, math challenges, science fairs, and general academic achievement on a regular basis throughout the school year. School field days where students compete across multiple events in a single day represent another major use case, since printed ribbons can be handed out immediately after each event without any customization step. Youth sports leagues use place ribbons for end-of-season ceremonies and tournament finishes, particularly at younger age divisions where participation recognition is as important as competitive placement. County fairs, 4-H competitions, livestock shows, and community events with multiple competitive categories have a long tradition of ribbon presentation and rely on printed styles for their affordability and immediate availability. Event ribbons featuring general titles like Guest, Speaker, Volunteer, and Staff are also widely used at conferences, ceremonies, and organized gatherings where identifying roles visually helps manage large groups of attendees.

What is the difference between ribbons sold individually and ribbons sold with card and string?

Ribbons with a pinked top edge are designed to be pinned or attached directly to clothing, bulletin boards, or award displays. They are sold in packs and are the more economical format, suited for programs that pin ribbons onto shirts at the event or attach them to certificates and award packets after the fact. Ribbons sold with card and string include a small printed card at the top of the ribbon with a string loop, allowing the ribbon to be hung from a nail, pinboard, or display hook without pinning. This format is popular for classroom displays where ribbons are shown on a wall or bulletin board as part of an ongoing recognition program, and for county fair and livestock show presentations where ribbons are traditionally hung on stall doors or display panels. Both formats are sold in packs of 25 for most styles, making it practical to stock up for an entire season or event series at one time.

If you need more information before deciding, see our expert resource section:
]]>
rosetteribbons
custom-pagestar-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsGeneral1:30%,50:34%,100:38%"Star Pins" "Star Lapel Pins" "Star Award Pins"Find this 1" Bronze Star discounted at TrophyCentral. Each bronze star features a clutch-back and fast 1-2 day shipping.br298b12-15-2011Star, Generalcustom-pagestar-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsGeneral1:30%,50:34%,100:38%"Star Pins" "Star Lapel Pins" "Star Award Pins"Find these 1/2" gold stars discounted at TrophyCentral. Each star pin features a flat, smooth finish and fast 1-2 day shipping!br390Star, Generalcustom-pagestar-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsGeneral1:30%,50:34%,100:38%"Star Pins" "Star Lapel Pins" "Star Award Pins"Find this Flat - 3/4 Inch Flat Bronze Star Pin at TrophyCentral. Flat - 3/4 Inch Bronze stars and other pins ship in just 1-2 business days!br464bStar, Generalcustom-pagestar-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsGeneral1:30%,50:34%,100:38%"Star Pins" "Star Lapel Pins" "Star Award Pins"Find BR series gold star pins discounted at TrophyCentral. Each gold star pin features a smooth finish, a clutch back and measures 1 inch. Ships in just 1-2 days.br298gStar, General11Find These Popular Flat Star Pins In Three Sizes And Discounted At TrophyCentral!flstpi3siandFlat Pins The above star-shaped pins are available in three finishes: gold, silver and bronze. Each flat star pin features a clutch back and measures 3/4" in diameter and features a smooth finish. These lapel pins are popular for employee and for student recognition. Most pins in this section ship from the factory in just 1-2 days. Bulk discounts are available for larger pin orders. If this is not what you are looking for, please see our large selection of star pins.]]>custom-pagegeneral-corporate-awards11"7-10 business days w/engraving" "Kentucky" "UPS (FedEx available on request)"trophies410187-101 3 22 230.451272.45J CharlesTrophies1:22%Eagle Leadership Awards from TrophyCentral. Discounted Trophies, Awards and Promotional Products.acpin11Find flower pins discounted at TrophyCentral. Each flower pin features a clutch-pin back and enabled finish. Choice of 3 colors.Rose Flower Lapel Pins Shop with confidence at TrophyCentral. We feature a huge selection of quality lapel pins and awards, all at discounted prices. Need help? Our experts in Michigan and New York would be happy to assist you!]]>custom-pagegift-certificate-templates1"Download Only"certificates4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Gift Certificate template (design 4) is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.gift-certificate-design-4gift-certificate-a4Gift Certificate, Flowercustom-pagemusicartpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsMusic, Drama, Art, Dance1:22%,50:30%,100:33%,500:45%"Music Lapel Pins" "Band Lapel Pins" "Music Pins"Find These Flute Lapel Pins Discounted at TrophyCentral. Features a Clutch-Pin Back and Fast 1-2 Day Shipping!mp206-01-2007Music / Band / Choruscustom-pageaward-medals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
"PT1=Medals" "PC12=105503-60.7530042.75Classic MedallicsMedalsGeneral1:22%,50:28%,100:34%,500:41%"Patriotic Awards" "Award Medals - All Subjects" "General Award Medals"Find our Flying Eagle With Torch 2" Olympic-Style J-Series Medals 2" Olympic-Style J-Series Medals at a super price point at TrophyCentral. Large quantity discounts available!j907512-20-2040General, Eagle
custom-pagetrophies-golf1"10 business days" "Aliquippa, PA" "UPS"trophies1500110-1410.451236.45Glass AmericaCrystal AwardsSports, Hobby, Org, Livestock1:22%,10:25%Flying Golf Ball Trophy. Ideal for leagues, schools, and tournaments. Fast shipping.Golf, Sportscustom-pageglass-crystal-awards1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"general410187-1010.458JcharlesCrystal Awards11:22%,25:24%"crystal awards"Fontana Glass Art Awards represents inspired works of art and a master display of craftsmanship. Available in two sizes, personalization is free!Leadershipcustom-pageplaques1"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498852-310.45811.6Quick TrophyPlaquesInsert1:14%,3:14%"Football Awards"Football "Goal Line" Holographic Decal Plaque. Ideal for leagues, schools, and tournaments. Fast shipping.qsinplaqfootballFootball, Sportscustom-pagename-badges-tagswoyoulipr100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoName Badges1Football #1 Custom Badge. Ideal for leagues, schools, and tournaments. Fast shipping.namebadges-footbball2custom-pagesports-inserts1105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Football (497665) Litho Medal Insert. Ideal for leagues, schools, and tournaments. Fast shipping.49766512-20-2020Sportscustom-pagesports-inserts1105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Football (502551) Litho Medal Insert. Ideal for leagues, schools, and tournaments. Fast shipping.502551Sportscustom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Football (504291) Litho Medal Insert. Ideal for leagues, schools, and tournaments. Fast shipping.504291Sports
custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Football (507183) Litho Medal Insert. Ideal for leagues, schools, and tournaments. Fast shipping.50718303-31-2019Sports
custom-pagetrophies-football12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:29%,100:38%"Football Awards" "Football Medals"Football (Ball / Helmet Design) - 2 Inch Diamond Cut Edge Medal with Ribbon. Ideal for leagues, schools, and tournaments. Fast shipping.z9018Football, Sports
custom-pageplaques1ps5864 ps5866 8xwalplaqwsu"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498852-310.45811.6Quick TrophyPlaquesInsert1:14%,3:14%"Football Awards"Football / Fantasy Football Plaque. Ideal for leagues, schools, and tournaments. Fast shipping.qsinplaq3dfootballFootball, Coach, Sportscustom-pageplace-trophies1trophies498551-310.452429Trophies1Find this popular Football trophy discounted at TrophyCentral. Features a real marble base, stylish 4-inch gold cup, free engraving and fast shipping.football-cup-place-trophycustom-pageplace-trophies1j9544 sporcer cogi24kgowh silplatsteel sports"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this place trim (1st, 2nd, or 3rd) football trophy discounted at trophyCentral. Ideal for leagues, schools, and tournaments. Fast shipping.qtfootplFootball, 1st / 2nd / 3rd / Etc., Sportscustom-pagetrophies-football1"2-4 business days" "Marquette, MI" "UPS"medals498552-40.530012.37TrophyCentralMedalsSports, Hobby, Org, Livestock1:22%,100:35%"Sports Medals" "Football Medals" "Football Awards" "New Products"2" Color Medals - Football. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.08-10-2013Football, Sportscustom-pagetrophies-football20498552-40.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Football Epoxy Decal (2"). Ideal for leagues, schools, and tournaments. Fast shipping.Football, Sportscustom-pagetrophies-football1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this year trim football trophy discounted at trophyCentral. Ideal for rec leagues, schools, and tournaments. Fast shipping.qtfootyrFootball, Sportscustom-pagetrophies-football1"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"medals498552-30.3716021.6Trophy CentralMedalsSports, Hobby, Org, Livestock1:14%,10:19%,50:28%,100:34%,500:42%"Football Medals"Football 3D Relief Medals (2"). Ideal for leagues, schools, and tournaments. Fast shipping.qush3dfootmeFootball, Sportscustom-pagetrophies-football1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Achievement Cup Trophy - Football. Ideal for leagues, schools, and tournaments. Fast shipping.cup-foot-pFootball, Sportscustom-pagetrophies-football1medals498552-30.525033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this Football Player 2 1/4" Antique Gold Medal Discounted at TrophyCentral. Each medal features a free ribbon. Fast shipping!Football, Sportscustom-pagefree-sports-templates1"Download Only"free-sports4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our football award certificate is free and designed exclusively for TrophyCentral. Certificate templates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Football-Certificatefootball-freeFootball, Sportscustom-pagetrophies-football11"1-3 business days + shipping time" "Topeka, Indiana" "UPS (FedEx available on request)"trophies465713-410.4511217.9Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,12:32%Football Bank Trophy. Ideal for leagues, schools, and tournaments. Fast shipping.footballbankFootball, Sportscustom-pagetrophies-football1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%2 3/4" T-Series Medal with Bronze Frame: Football. Ideal for leagues, schools, and tournaments. Fast shipping.Football, Sportscustom-pagetrophies-football1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Single Column Budget Trophy - Football. Ideal for leagues, schools, and tournaments. Fast shipping.mqtfootscbFootball, Sportscustom-pagetrophies-football1498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Budget Award Trophy - Football. Ideal for leagues, schools, and tournaments. Fast shipping.bdg-footballFootball, Sportscustom-pagetrophies-football1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511230.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,6:23%,12:24%,24:26%"Football Awards"Football Cast Stone Trophy. Ideal for leagues, schools, and tournaments. Fast shipping.tr9917Return to oursection for more great choices!trophies-footballFootball, Sportscustom-pagesporcerfootballfr1footballfrcertificates290631-31 2 3 230.45100020.45Certificate SourceCertificatesAward Certificates1:22%,25:27%,100:40%,500:50%Football Certificates. Ideal for leagues, schools, and tournaments. Fast shipping.1036Football, Sportscustom-pagefree-sports-templates1"Download Only"free-sports49855011TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"See this Football Certificate designed exclusively for TrophyCentral! Football Certificates can be downloaded for free!footballfrFootball, Sportscustom-pagetrophies-football1trophies498552-411229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Champion's Cup - Football. Ideal for leagues, schools, and tournaments. Fast shipping.Champion's Cup - FootballFootball, Sportscustom-pagetrophies-football1trophies498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Champion's Trophy with Football Insert. Ideal for leagues, schools, and tournaments. Fast shipping.Champion's-Trophy-with-Football-InsertFootball, Sportscustom-pagetrophies-football1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Quick-Ship Two-Tier Trophies with Football Figure. Ideal for leagues, schools, and tournaments. Fast shipping.qtfootttFootball, Sportscustom-pagetrophies-football1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.2115Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%Football Two Tier Championship Trophy with Wood Base. Ideal for leagues, schools, and tournaments. Fast shipping.qtfootttwFootball, Sportscustom-pagetrophies-football1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Single Column Insert Trophy - Football. Ideal for leagues, schools, and tournaments. Fast shipping.Single Column Insert Trophy - FootballFootball, Sportscustom-pagetrophies-football1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%Single Column Trophy - Football. Ideal for leagues, schools, and tournaments. Fast shipping.qtfootscSee more fabulousin other great styles.trophies-footballFootball, Sportscustom-pagetrophies-football1trophies498551-311821.06TrophyCentralTrophies1Football, Sportscustom-pagetrophies-football50medals9303310-May1Simba CalMedals1Football Medal with Personalized School, Team or Event Name. Ideal for leagues, schools, and tournaments. Fast shipping.Football, Sportscustom-pagetrophies-football1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451623.65Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%Double Platform Trophies in 3 Sizes - Football. Ideal for leagues, schools, and tournaments. Fast shipping.qtfootdmFootball, Sportscustom-pagenoname11wallmountminihelmetdoubleminidisplayacfoothelholfootballdisplayrfootballdisplayononame10sambutwitwoo1footballdisplayuminidisplaydisplaycubestripleminidisplayhelmetdisplaywallmountfootballuwallmountfootballwallmountfoothelmethelmetfootballowallmounttripleminiwallmountdoubleminicapdisplay11Football Display Cases. Ideal for leagues, schools, and tournaments. Fast shipping.

Shop with Confidence at TrophyCentral

We offer a huge selection, discounted prices and fabulous customer service. Do you need help with some ideas or with ordering? Yes, we sell online, but we have real people who would love to help you! Feel free to call our experts in Michigan, New York and online. TrophyCentral - delivering smiles since 1999!


]]>
custom-pagefootball-awards1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"498852-30.38150030Quick TrophyDog TagsSports, Hobby, Org, Livestock1:14%,10:15%Football Dog Tags. Ideal for leagues, schools, and tournaments. Fast shipping.qtdogfootFootball, Sportscustom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Football GENERAL Litho Medal Insert. Ideal for leagues, schools, and tournaments. Fast shipping.506631Sports
custom-pagetrophies-football1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Single Column Cup Trophy - Football. Ideal for leagues, schools, and tournaments. Fast shipping.cup-foot-scbFootball, Sportscustom-pagetrophies-football1trophies498551-310.71217.38Trophies1Football, Sportscustom-pagetrophies-football1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%2 3/4" T-Series Medal with Gold Frame: Football. Ideal for leagues, schools, and tournaments. Fast shipping.Football, Sportscustom-pagetrophies-football1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.4118Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Quick-Ship Two-Tier 3-Column Trophies - Football. Ideal for leagues, schools, and tournaments. Fast shipping.qtfoot3cFootball, Sportscustom-pagekeychains21105502-40.39125035.39Classic MedallicsGiftsKeychains1:22%,10:25%,25:32%,50:39%,100:47%"Football Awards"Football Helmet Pewter Key Chains. Ideal for leagues, schools, and tournaments. Fast shipping.pk80-cmKeychainscustom-pagetrophies-football1medals498552-30.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Football Insert Medal. Ideal for leagues, schools, and tournaments. Fast shipping.Football, Sportscustom-pagetrophies-football1medals498552-40.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Football Insert Medal with Personalized Rim. Ideal for leagues, schools, and tournaments. Fast shipping.Football, Sportscustom-pageplaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Football Insert Plaque (Multiple Styles). Ideal for leagues, schools, and tournaments. Fast shipping.Football, Sportscustom-pagetrophies-football1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511218.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,24:41%"Football Awards"Kid's Resin Football - "Little Buddy" Trophy. Ideal for leagues, schools, and tournaments. Fast shipping.tr7223Football, Sportscustom-pagetrophies-football12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,100:28%,500:34%,1000:45%"Football Medals" "Football Awards" "Award Medals - All Subjects" "Sports Medals"Football Medal (1 1/4"). Ideal for leagues, schools, and tournaments. Fast shipping.e9018Return to the section for more fabulous medal choices.footballmedals01-20-2015Football, Sports
football-awardsfootball-mcfootball-mc-prfootball-mge9018e9374tm9977gir11qush3dfootmefootball138140-gme101gz9018j9544football-qcmfootball-jigffootball-jibffootball-jisf1sports-medals1Find football medals your players and team members will love discounted at TrophyCentral. Each football medal includes a free ribbon! Shop for Football Award Medals with Ease at TrophyCentral We have a great selection, low prices and great customer service. Our customer service reps have been helping customers since 1999 and they would be happy to help you, too! Whether you want to award players for an outstanding MVP performance, team spirit or just participation, we can help make your end of season celebration a special one! ]]>trophies-footballFootballcustom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Football Mylar Decal Medal Insert. Ideal for leagues, schools, and tournaments. Fast shipping.489713Football, Sports
custom-pagetrophies-football1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Participation Insert Trophy - Football. Ideal for leagues, schools, and tournaments. Fast shipping.Participation Insert Trophy - FootballFootball, Sportscustom-pagetrophies-football1j9544 sporcer cogi24kgowh silplatsteel sports"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%,25:23%,50:29%,100:34%Football Participation Trophy. Ideal for leagues, schools, and tournaments. Fast shipping.qtfootncReturn to thesection for other great choices.trophies-footballFootball, Sportsfootball-awards1lapel-award-pins1Our Football Pins are ideal for leagues, schools, and tournaments. Fast shipping.Lapel Pins: Football TrophyCentral has a great selection of stock football lapel pins. Our football letter pins are available with a color or chenille gold finish and are available in several styles.
We also carry a great selection of generic pins, such as Varsity, JV, MVP, All Star, Champs, Coach and more! Award and lapel pins can be proudly worn directly on a "football jacket" or on a varsity or JV letter. Each football pin features a clutch-pin back for safe and easy attachment to clothing.

Shop with Confidence at TrophyCentral!

If you are looking to buy football lapel pins online, look no further! TrophyCentral has a great selection that will fit any budget. Our top-rated representatives are happy to assist you with all of your football pin needs. Our experts in New York and Michigan have been providing suggestions and guidance since 1999! To find the perfect football lapel pin, click on an image above, or for personal service, call us toll-free at 1-888-809-8800. Pins typically ship in just 1-2 business days.]]>
trophies
custom-pagename-badges-tagswoyoulipr100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoName Badges1Football Player Badge. Ideal for leagues, schools, and tournaments. Fast shipping.namebadges-footballcustom-pagetrophies-football12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,100:28%,500:34%,1000:45%"Football Medals" "Award Medals - All Subjects" "Sports Medals"Football Runner Medals (1 1/4"). Ideal for leagues, schools, and tournaments. Fast shipping.e9374Football, Sports
custom-pagetrophies-footballplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsSports, Hobby, Org, Livestock1:22%,50:30%,100:33%,500:47%Football Shaped Lapel Pins. Ideal for leagues, schools, and tournaments. Fast shipping.ec03Football, Sportscustom-pagetrophies-football1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%2 3/4" Silver Frame Medal: Football. Ideal for leagues, schools, and tournaments. Fast shipping.Football, Sportscustom-pagetrophies-football1trophies498551-310.452429Trophies1Find our Football star column trophy discounted at TrophyCentral. Features a real marble base, 6 inch gold star-shaped column, free engraving and fast shipping.football-star-column-trophycustom-pagetrophies-basketballqsinplaqfootballqsinplaq3dfootballfootball-plaque-ifootball-ei1063cl07ec031trophies1Shop football trophies from Trophy Central - youth, fantasy, and championship styles. Free custom engraving. Fast 1-2 day shipping.

Custom Football Trophies & Awards - Honor Gridiron Glory

Football trophies celebrate the dedication, teamwork, and athletic achievement that define America's most beloved autumn tradition. From youth flag football leagues teaching fundamentals to high school Friday night lights showcasing community pride, from competitive club tournaments to fantasy football leagues where armchair coaches reign supreme, quality football awards recognize players, coaches, and fans across every level of the game. Our versatile trophies feature dynamic football figurines in action poses capturing quarterbacks throwing spirals, running backs breaking tackles, and receivers making spectacular catches, traditional column designs in team colors with football inserts and trim, premium resin sculptures depicting game-winning moments, championship cups worthy of conference title celebrations, and customizable engraving plates documenting season highlights, statistical achievements, and team accomplishments.

Frequently Asked Questions About Football Trophies

What trophy sizes work best for different football award categories?

Youth participation leagues benefit from 6-inch to 9-inch economy trophies ensuring every player receives affordable recognition for completing the season, building confidence and encouraging return next year. Position-specific awards and category winners deserve 10-inch to 14-inch single column trophies featuring action figurines matching their role, whether quarterback, running back, linebacker, or kicker, creating meaningful individual recognition within team contexts. Team MVP, offensive player of the year, and defensive player of the year honors warrant 15-inch to 18-inch premium trophies with substantial presence reflecting superior season-long performance above teammates. League championships and conference titles demand 20-inch to 24-inch multi-column championship trophies with impressive height and weight befitting the culmination of an entire season's effort. Fantasy football leagues embrace creative trophy sizing based on league personality, from modest 8-inch consolation prizes for last place to towering 18-inch perpetual trophies passed between champions annually.

What details should football trophy engraving include?

Comprehensive engraving preserves season memories beyond fading photographs. Essential elements include player name, award title, team name, league or organization, and season year. Keep text concise and readable, prioritizing most meaningful details when space limitations require choices.

Should youth football programs give trophies to every player or only award winners?

Youth programs serving players under 12 years old benefit significantly from universal participation trophies acknowledging every athlete who completed the season, building confidence and creating positive associations with organized sports that encourage continued participation. These affordable 6-8 inch trophies cost little but mean everything to young players displaying their first sports awards at home. However, even participation-focused programs should maintain some competitive recognition by presenting larger distinctive trophies for team MVP, most improved player, best sportsmanship, and coaches awards, teaching young athletes that exceptional effort earns special recognition. Middle school and high school programs appropriately shift toward merit-based awards where trophies recognize genuine achievement in championships, all-conference selections, statistical leaders, and team superlatives, preparing athletes for increasingly competitive environments.

If you need more information before deciding, see our expert resource section:
]]>
Football
custom-pagefree-sports-templates1"Download Only"free-fantasy4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Football: Almost Doesn't Count. Ideal for leagues, schools, and tournaments. Instant download.fantasy-football-almost-Mainfantasy-football-almostFootball, Fantasy Football, Losercustom-pagefree-sports-templates1"Download Only"free-fantasy4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Football: Asleep at the Wheel. Ideal for leagues, schools, and tournaments. Instant download.fantasy-football-asleep-Mainfantasy-football-asleepFootball, Fantasy Football, Losercustom-pagefree-sports-templates1"Download Only"free-fantasy4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Football: Comeback of the Year. Ideal for leagues, schools, and tournaments. Instant download.fantasy-football-comeback-Mainfantasy-football-comebackFootball, Fantasy Footballcustom-pagefree-sports-templates1"Download Only"free-fantasy4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Football: No Place To Go But Up. Ideal for leagues, schools, and tournaments. Instant download.fantasy-football-up-Mainfantasy-football-upFootball, Fantasy Football, Loser100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)""PT2=7745310-14125016.5PepcoPromotional ProductsSports / Water Bottles1:14%,250:21%,500:31%,1000:45%,2500:49%Forest Green Custom Sports Bottles from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.sportsbottles-forestSports / Water Bottlescustom-pagemedallion-inserts-military-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%Buy these high-quality Forscom Inserts at TrophyCentral. Each Forscom Insert can be used to create a unique plaque, medal or trophy.515283Military, Hero
custom-pagebaseballdisplay11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 23 24 25119Perfect CaseDisplay Cases11:14%,5:18%Four Baseball Glass Display Case. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.basedisplay-4Baseball / T-Ball, Sportscustom-pageofficesigns11"9-12 business days" "Roanoke, Virginia" "UPS (FedEx available on request)"240169-1210.4610022.46RoanokeOffice Signs1custom-pagegeneral-corporate-awards1606307-101 3 234436RS OwensPlaques1This golden record is a perfect award to recognize any record breaking accomplishment! Find it discounted at TrophyCentral!custom-pagecertificateplaques1plaques498553-4141239Plaques1Find this frameless black marble certificate plaque with a gold frame discounted at TrophyCentral. Measures 10 1/2 x 13 and holds an 8 1/2 x 11 certificate or diploma.custom-pagecertificateplaques1plaques498553-4141239Plaques1Find this frameless Cherry certificate plaque discounted at TrophyCentral. Measures 10 1/2 x 13 and holds an 8 1/2 x 11 certificate or diploma.custom-pageinserts14931814915035111814915054915064915105174541inserts11Browse our select of Fraternal Organizational Inserts from TrophyCentral. Each 2" inserts fits in a medal frame, plaque or trophy.Fraternal1111Find free camp certificate templates at TrophyCentral. Each camp certificate measures 8 1/2 x 11" and can be downloaded for free! Choose from a great variety of designs!.Camp Certificatescustom-pagetrophies-family-reunionartistfrgift-certificate-templatesfree-school-certificate-templatesfree-sports-templatesfield-day-templateschristmas-freebest-husband-freeemployee-of-the-month-freecongratulations-freetop-performer-freemarriage-award-freefirefighter-freecommunity-caring-freepaintball-freeinnovation-freenursing-freeteam-award-freegroup-award-freeentrepreneurship-freeworlds-best-freesafety-freeemt-freefine-arts-award-freedrama-freeagriculture-award-freecertificate-of-completion-freesales-award-freecompletion-freemindfulness-freego-kart-freehalloween-freepet-adoption-awarddramafremployee-safetypinewood-derbybirthdayboypistols-frdogs-frbeer-pong-frhorseshoes-fremployee-excellence-awardfamily-reunionspecialcommunity-servicecertificate-of-recognition-freespecial-person-freewell-done-freeservice-award-freevolunteering-award-freesponsorship-award-freethank-you-award-freebest-camper-mbest-camper-fcamp-spiritcamper-of-the-weekcamping-awardsummer-campbaking-2-freebaking-521culinary-award-freebbq-cook-off-521chili-cook-off-521cooking-award-freecooking-female-521cooking-male-521bake-off-521culinary-male-521apprecfrdance-female-521ballet-freedance-contest-femaledance-male-521dance-contest-maleperforming-arts-freechorus-freeband-freepiano-freeviolin-freemusic-521music-award-521guitar-521orchestra-a-521orchestra-b-521achievement-band-521band-award-521choir-5211certificates1"Award Certificates and Diploma Covers" "Award Certificates and Diploma Holders" "Award Certificates and Diploma Frames" "Award Certificate and Diploma Holders" "Certificate and Diploma Holders" "Certificates and Frames" "Certificates and Diploma Holders" "Diploma Covers and Certificates" "Diploma Covers and Award Certificates" "Diploma Covers, Frames and Holders" "Diploma Covers, Frames, Holders and Certificates"Find the perfect free certificate template from our vast collection. Customize for schools, sports teams, businesses, or any special recognition. Download now.Free certificate templates at TrophyCentral! Choose from many popular subjects and then simply download and print! freeawardcertificates

Free Printable Certificate Templates - Download, Customize, and Print Instantly

Free certificate templates give teachers, coaches, employers, and event organizers a fast, flexible way to recognize achievement without spending a cent, making it practical to honor every participant in any program regardless of budget constraints. From elementary school classrooms where teachers need to print a certificate for every student who hit a reading goal, completed a math challenge, or earned perfect attendance across the semester, to youth sports leagues where coaches want to present every player with an end-of-season certificate at the team party, from workplace recognition programs where a weekly employee shoutout deserves a printed certificate without requiring a purchase order, to family reunions, cooking contests, field day events, fantasy sports leagues, and community service programs where a personalized certificate makes the moment feel official and meaningful, our free templates cover the full range of occasions with professionally designed layouts ready to personalize and print. Each template is formatted to standard 8.5 by 11 inch size and prints cleanly on any home inkjet or laser printer. For occasions where you want a more substantial printed certificate on quality paper, browse our school certificates and sports award certificates for professionally printed options starting at under fifty cents each.

Frequently Asked Questions About Free Certificate Templates

What type of paper should I use to print certificates?

Heavyweight paper makes the biggest difference in how professional a printed certificate looks and feels. Bright white cardstock at 60 lb. or heavier produces a crisp, modern result that holds up well. Parchment paper adds a traditional, formal feel well suited to academic and graduation certificates. Specialty certificate paper with preprinted borders or subtle watermarks is available at most office supply stores and elevates the finished product further. Avoid standard 20 lb. copy paper if the certificate will be presented, displayed, or kept as a keepsake.

Can I print free certificate templates on a regular home printer?

Yes. Most home inkjet and laser printers handle our templates well. Laser printers produce sharper, smudge-resistant text ideal for name lines and formal text. Inkjet printers handle colors and graphic elements with excellent results. Set your printer to the highest quality setting for the best output, and confirm your printer supports the paper weight you have chosen before loading a full stack. Most templates are designed to be filled in by printer or by hand after printing.

How can I make a free certificate look more official?

A few simple additions transform a printed certificate into something recipients are proud to frame and display. Adding an embossed gold or silver seal is the single most effective upgrade, instantly conveying an official and prestigious appearance. Our certificate seals are available in gold and silver finishes and apply easily to any printed certificate. Presenting the certificate inside a diploma cover adds a formal presentation layer. Using quality cardstock paper, adding a handwritten or printed signature, and including the date and issuing organization name all contribute to a more complete and meaningful finished award.

If you need more information before deciding, see our expert resource section:
]]>
embossed-seals
1111Find free cooking, baking and culinary templates at TrophyCentral. Each certificate and template measures 11 x 8 1/2" and can be easily downloaded and printed for free.11Find free dance templates at TrophyCentral. Simply download and print! Choose from ballet, dance marathon, dance contest and more!certificates11TrophyCentral's fantasy sports certificates for football, baseball and basketball are free! Each award template measures 11" x 8 1/2" and can be easily downloaded and printed.Fantasy Sportscustom-pagefreeawardcertificatesfielddayfrfield-day-certificate-2ndfield-day-certificate-honorable-mentionfield-day-certificate-1stfield-day-certificate-3rdfield-day-certificate-participantfield-day-certificate-4th11Find Field Day Templates free at TrophyCentral. Each Field Day Template can be easily downloaded and printed. Choose from 1st to 4th place, participant and more!Field Day Certificates The award certificates above are free! Simply download them to your computer and print.

Shop with Ease at TrophyCentral

TrophyCentral also has a huge selection of custom and stock certificate templates. Choose from popular school, sports and general subjects. Shipping is fast, typically 1-2 days. If you have any questions, our expert staff in Michigan, New York and online can help! Just give us a call!!
]]>
custom-pagefreeawardcertificatesgift-certificate-a1gift-certificate-a2gift-certificate-a3gift-certificate-a4gift-certificate-a5gift-certificate-a6gc-birthday-521gc-celebrate-521gc-party-521gc-holiday-521gc-winter-521gc-christmas-52111Find gift certificate templates at TrophyCentral. Each gift certificate template can be downloaded and printed for free! Choose from a great variety of designs!.Gift Certificate Templatesmusic-award-certificates11pickleball-medals11Find Pickleball Templates free at TrophyCentral. Each Pickleball Certificate Template can be easily downloaded and printed. Choose from singles and doubles styles.Pickleball Certificates The award certificates above are free! Simply download them to your computer and print.

Shop with Ease at TrophyCentral

TrophyCentral also has a huge selection of custom and stock certificate templates. Choose from popular school, sports and general subjects. If you have any questions, our expert staff in Michigan, New York and online can help! Just give us a call!!]]>
custom-pagefreeawardcertificatesartistfrstudentfrmathfrhonor-roll-freeoutstanding-student-freeschool-newspaper-freeacademic-achievement-freecertificate-of-scholarshipmost-improved-student-freestar-student-award-freehonorrollstudent-of-the-week-freemale-student-of-the-month-freescholarship-freekindergarten-diploma-freeperfect-attendance-awardteaching-excellence-awardacademic-award-freefemale-special-teacher-freespecial-student-freefemale-student-of-the-month-freeacademic-excellence-freehigh-school-diploma-freeschool-yearbook-freeelementary-diplomaprincipals-award-freeacademic-freemale-special-teacher-freemiddle-school-diploma-freesafety-patrol-freeenglish-award-freereading-freegraduationsciencereligious-school-diplomascience-freespellinglanguage-arts-freesciencefairspelling-freereadingcreative-writingmath-excellencemost-improved-freewomens-history-monthblack-history-month-freewriting-freeessay-contest-award-freedebate-awardattendanceearth-day-recognition-awardperfect-attendance-frparticipation11See a great selection of free school certificate templates at TrophyCentral. Each free school award certificate template can be easily download and printed. Choose from a great variety of designs!.custom-pagefreeawardcertificatessoccerfrfootballfrvolleyballfrswimmingfrtrackfrcheerleadingfrcoachfrbasketball-freebasketballfrscholar-athlete-freesnowboarding-freeice-hockey-freemale-track-and-field-freemale-gymnastics-freesnowmobiling-freewrestling-freefutbol-freesoftball-freevolleyball-freearchery-freefemale-gymnastics-freefootball-freefield-hockeylacrosse-freediving-freeboxing-freedownhill-skiingbaseballfrtennis-freefemale-track-and-field-freeswimming-freedarts-freesailing-freemarksman-freemost-valuable-freemartial-arts-freemost-improved-athletevideography-freeboating-freechess-freephotography-freemarathon-m-frtable-tennis-frgymnastics-frt-ball-frcycling-frsoftball-frfantasy-baseball-almostfantasy-baseball-asleepfantasy-baseball-champfantasy-baseball-comebackfantasy-baseball-commissionerfantasy-baseball-loserfantasy-baseball-upfantasy-sports-couchfantasy-basketball-almostfantasy-basketball-asleepfantasy-basketball-champfantasy-basketball-comebackfantasy-basketball-commissionerfantasy-basketball-loserfantasy-basketball-upfantasy-football-almostfantasy-football-asleepfantasy-football-champfantasy-football-comebackfantasy-football-commissionerfantasy-football-loserfantasy-football-uppickleball-mixed-doublespickleball-womens-singlespickleball-mens-doublespickleball-womens-doublespickleball-mens-singles11custom-pagewalmouncascase1comsooncas311404-ck-sn11405-ck-sn11406-ck-sn11408-ck-sn11410-ck-sn11412-ck-sn10404ck-sn-w10405ck-sn-w10406ck-sn-w10408ck-sn-w10410ck-sn-w10412ck-sn-w13404-ck-sn13405-ck-sn13406-ck-sn10404ck-sn-k10405ck-sn-k10406ck-sn-k10408ck-sn-k10410ck-sn-k10412ck-sn-k11404-pb-sn11405-pb-sn11406-pb-sn11408-pb-sn11410-pb-sn11412-pb-sn10404pb-sn-w10405pb-sn-w10406pb-sn-w10408pb-sn-w10410pb-sn-w10412pb-sn-w13404-pb-sn13405-pb-sn13406-pb-sn10404pb-sn-k10405pb-sn-k10406pb-sn-k10408pb-sn-k10410pb-sn-k10412pb-sn-k11404-wb-sn11405-wb-sn11406-wb-sn11408-wb-sn11410-wb-sn11412-wb-sn10404wb-sn-w10405wb-sn-w10406wb-sn-w10408wb-sn-w10410wb-sn-w10412wb-sn-w13404-wb-sn13405-wb-sn13406-wb-sn10404wb-sn-k10405wb-sn-k10406wb-sn-k10408wb-sn-k10410wb-sn-k10412wb-sn-k2605-pb-gd2606-pb-gd2605-pb-bz2606-pb-bz2605-pb-sn2606-pb-sn2605-wb-gd2606-wb-gd2605-wb-bz2606-wb-bz2605-wb-sn2606-wb-sn91lfbs-bz-bk91lfbs-bz-cd91lfbs-bz-fw93lfbs-bz-bk93lfbs-bz-cd93lfbs-bz-fw91lfbs-sn-bk91lfbs-sn-cd91lfbs-sn-fw93lfbs-sn-bk93lfbs-sn-cd93lfbs-sn-fw91lfco-bz-bk91lfco-bz-cd91lfco-bz-fw91lfco-sn-bk91lfco-sn-cd91lfco-sn-fw91lfhb-bz-bk91lfhb-bz-cd91lfhb-bz-fw91lfhb-sn-bk91lfhb-sn-cd91lfhb-sn-fw91lfsl-bz-bk91lfsl-bz-cd91lfsl-bz-fw91lfsl-sn-bk91lfsl-sn-cd91lfsl-sn-fw91lfwh-bz-bk91lfwh-bz-cd91lfwh-bz-fw91lfwh-sn-bk91lfwh-sn-cd91lfwh-sn-fw94lfbs-bz-bk94lfbs-bz-cd94lfbs-bz-fw94lfbs-sn-bk94lfbs-sn-cd94lfbs-sn-fw93lfco-bz-bk93lfco-bz-cd93lfco-bz-fw94lfco-bz-bk94lfco-bz-cd94lfco-bz-fw93lfco-sn-bk93lfco-sn-cd93lfco-sn-fw94lfco-sn-bk94lfco-sn-cd94lfco-sn-fw93lfhb-bz-bk93lfhb-bz-cd93lfhb-bz-fw94lfhb-bz-bk94lfhb-bz-fw93lfhb-sn-bk93lfhb-sn-cd93lfhb-sn-fw94lfhb-sn-bk94lfhb-sn-cd94lfhb-sn-fw93lfsl-bz-bk93lfsl-bz-cd93lfsl-bz-fw94lfsl-bz-bk94lfsl-bz-cd94lfsl-bz-fw93lfsl-sn-bk93lfsl-sn-cd93lfsl-sn-fw94lfsl-sn-bk94lfsl-sn-cd94lfsl-sn-fw93lfwh-bz-bk93lfwh-bz-cd93lfwh-bz-fw94lfwh-bz-bk94lfwh-bz-cd94lfwh-bz-fw93lfwh-sn-bk93lfwh-sn-cd93lfwh-sn-fw94lfwh-sn-bk94lfwh-sn-cd94lfwh-sn-fw4024mb-gd-mk4024mb-gd-ak4024mb-gd-wv4124mb-gd-mk4024mb-gd-dk4124mb-gd-ak4124mb-gd-wv4024mb-gd-lv4124mb-gd-dk4124mb-gd-lv4024mb-bz-mk4024mb-bz-ak4024mb-bz-wv4124mb-bz-mk4024mb-bz-dk4124mb-bz-ak4124mb-bz-wv4024mb-bz-lv4124mb-bz-dk4124mb-bz-lv4024mb-sn-mk4024mb-sn-ak4024mb-sn-wv4124mb-sn-mk4024mb-sn-dk4124mb-sn-ak4124mb-sn-wv4024mb-sn-lv4124mb-sn-dk4124mb-sn-lv4024pb-gd-mk4024pb-gd-ak4024pb-gd-wv4124pb-gd-mk4024pb-gd-dk4124pb-gd-ak4124pb-gd-wv4024pb-gd-lv4124pb-gd-dk4124pb-gd-lv4024pb-bz-mk4024pb-bz-ak4024pb-bz-wv4124pb-bz-mk4024pb-bz-dk4124pb-bz-ak4124pb-bz-wv4024pb-bz-lv4124pb-bz-dk4124pb-bz-lv4024pb-sn-mk4024pb-sn-ak4024pb-sn-wv4124pb-sn-mk4024pb-sn-dk4124pb-sn-ak4124pb-sn-wv4024pb-sn-lv4124pb-sn-dk4124pb-sn-lv4024cb-gd-ak4024cb-gd-dk4024cb-gd-lv4024cb-gd-mk4024cb-gd-wv4124cb-gd-ak4124cb-gd-dk4124cb-gd-lv4124cb-gd-mk4124cb-gd-wv4024cb-bz-ak4024cb-bz-dk4024cb-bz-lv4024cb-bz-mk4024cb-bz-wv4124cb-bz-ak4124cb-bz-dk4124cb-bz-lv4124cb-bz-mk4124cb-bz-wv4024cb-sn-ak4024cb-sn-dk4024cb-sn-lv4024cb-sn-mk4024cb-sn-wv4124cb-sn-ak4124cb-sn-dk4124cb-sn-lv4124cb-sn-mk4124cb-sn-wv3148ht-gd-lb3160ht-gd-lb3148ht-bz-lb3160ht-bz-lb3148ht-sn-lb3160ht-sn-lb3148sd-gd-lb3160sd-gd-lb3148sd-bz-lb3160sd-bz-lb3148sd-sn-lb3160sd-sn-lb2010-4-gd-lv2010-4-gd-wv2010-5-gd-lv2010-5-gd-wv2010-6-gd-lv2010-6-gd-wv2010-4-bz-lv2010-4-bz-wv2010-5-bz-lv2010-5-bz-wv2010-6-bz-lv2010-6-bz-wv2010-4-sn-lv2010-4-sn-wv2010-5-sn-lv2010-5-sn-wv2010-6-sn-lv2010-6-sn-wv2074mb-gd-mk2075mb-gd-mk2076mb-gd-mk2281mb-gd-mk2074mb-gd-ak2075mb-gd-ak2076mb-gd-ak2281mb-gd-ak2074mb-gd-wv2075mb-gd-wv2076mb-gd-wv2281mb-gd-wv2074mb-gd-dk2076mb-gd-dk2281mb-gd-dk2074mb-gd-lv2075mb-gd-lv2076mb-gd-lv2281mb-gd-lv2174mb-gd-mk2175mb-gd-mk2176mb-gd-mk2075mb-gd-dk2174mb-gd-ak2175mb-gd-ak2176mb-gd-ak2174mb-gd-wv2175mb-gd-wv2176mb-gd-wv2174mb-gd-dk2175mb-gd-dk2176mb-gd-dk2174mb-gd-lv2175mb-gd-lv2176mb-gd-lv2074mb-bz-mk2075mb-bz-mk2076mb-bz-mk2281mb-bz-mk2074mb-bz-ak2075mb-bz-ak2076mb-bz-ak2281mb-bz-ak2074mb-bz-wv2075mb-bz-wv2076mb-bz-wv2281mb-bz-wv2074mb-bz-dk2075mb-bz-dk2076mb-bz-dk2281mb-bz-dk2074mb-bz-lv2075mb-bz-lv2076mb-bz-lv2281mb-bz-lv2174mb-bz-mk2175mb-bz-mk2176mb-bz-mk2174mb-bz-ak2175mb-bz-ak2176mb-bz-ak2174mb-bz-wv2175mb-bz-wv2176mb-bz-wv2174mb-bz-dk2175mb-bz-dk2176mb-bz-dk2174mb-bz-lv2175mb-bz-lv2176mb-bz-lv2074mb-sn-mk2075mb-sn-mk2076mb-sn-mk2281mb-sn-mk2074mb-sn-ak2075mb-sn-ak2076mb-sn-ak2281mb-sn-ak2074mb-sn-wv2075mb-sn-wv2076mb-sn-wv2281mb-sn-wv2074mb-sn-dk2075mb-sn-dk2076mb-sn-dk2281mb-sn-dk2074mb-sn-lv2075mb-sn-lv2076mb-sn-lv2281mb-sn-lv2174mb-sn-mk2175mb-sn-mk2176mb-sn-mk2174mb-sn-ak2175mb-sn-ak2176mb-sn-ak2174mb-sn-wv2175mb-sn-wv2176mb-sn-wv2174mb-sn-dk2175mb-sn-dk2176mb-sn-dk2174mb-sn-lv2175mb-sn-lv2176mb-sn-lv2074pb-gd-mk2075pb-gd-mk2076pb-gd-mk2281pb-gd-mk2074pb-gd-ak2075pb-gd-ak2076pb-gd-ak2281pb-gd-ak2074pb-gd-wv2075pb-gd-wv2076pb-gd-wv2281pb-gd-wv2074pb-gd-dk2075pb-gd-dk2076pb-gd-dk2281pb-gd-dk2074pb-gd-lv2075pb-gd-lv2076pb-gd-lv2281pb-gd-lv2174pb-gd-mk2175pb-gd-mk2176pb-gd-mk2174pb-gd-ak2175pb-gd-ak2176pb-gd-ak2174pb-gd-wv2175pb-gd-wv2176pb-gd-wv2174pb-gd-dk2175pb-gd-dk2176pb-gd-dk2174pb-gd-lv2175pb-gd-lv2176pb-gd-lv2074pb-bz-mk2075pb-bz-mk2076pb-bz-mk2281pb-bz-mk2074pb-bz-ak2075pb-bz-ak2076pb-bz-ak2281pb-bz-ak2074pb-bz-wv2075pb-bz-wv2076pb-bz-wv2281pb-bz-wv2074pb-bz-dk2075pb-bz-dk2076pb-bz-dk2281pb-bz-dk2074pb-bz-lv2075pb-bz-lv2076pb-bz-lv2281pb-bz-lv2174pb-bz-mk2175pb-bz-mk2176pb-bz-mk2174pb-bz-ak2175pb-bz-ak2176pb-bz-ak2174pb-bz-wv2175pb-bz-wv2176pb-bz-wv2174pb-bz-dk2175pb-bz-dk2176pb-bz-dk2174pb-bz-lv2175pb-bz-lv2176pb-bz-lv2074pb-sn-mk2075pb-sn-mk2076pb-sn-mk2281pb-sn-mk2074pb-sn-ak2075pb-sn-ak2076pb-sn-ak2281pb-sn-ak2074pb-sn-wv2075pb-sn-wv2076pb-sn-wv2281pb-sn-wv2074pb-sn-dk2075pb-sn-dk2076pb-sn-dk2281pb-sn-dk2074pb-sn-lv2075pb-sn-lv2076pb-sn-lv2281pb-sn-lv2174pb-sn-mk2175pb-sn-mk2176pb-sn-mk2174pb-sn-ak2175pb-sn-ak2176pb-sn-ak2174pb-sn-wv2175pb-sn-wv2176pb-sn-wv2174pb-sn-dk2175pb-sn-dk2176pb-sn-dk2174pb-sn-lv2175pb-sn-lv2176pb-sn-lv2074wb-gd-mk2075wb-gd-mk2076wb-gd-mk2281wb-gd-mk2074wb-gd-ak2075wb-gd-ak2076wb-gd-ak2281wb-gd-ak2074wb-gd-wv2075wb-gd-wv2076wb-gd-wv2281wb-gd-wv2074wb-gd-dk2075wb-gd-dk2076wb-gd-dk2281wb-gd-dk2074wb-gd-lv2075wb-gd-lv2076wb-gd-lv2281wb-gd-lv2174wb-gd-mk2175wb-gd-mk2176wb-gd-mk2174wb-gd-ak2175wb-gd-ak2176wb-gd-ak2174wb-gd-wv2175wb-gd-wv2176wb-gd-wv2174wb-gd-dk2175wb-gd-dk2176wb-gd-dk2174wb-gd-lv2175wb-gd-lv2176wb-gd-lv2074wb-bz-mk2075wb-bz-mk2076wb-bz-mk2281wb-bz-mk2074wb-bz-ak2075wb-bz-ak2076wb-bz-ak2281wb-bz-ak2074wb-bz-wv2075wb-bz-wv2076wb-bz-wv2281wb-bz-wv2074wb-bz-dk2075wb-bz-dk2076wb-bz-dk2281wb-bz-dk2074wb-bz-lv2075wb-bz-lv2076wb-bz-lv2281wb-bz-lv2174wb-bz-mk2175wb-bz-mk2176wb-bz-mk2174wb-bz-ak2175wb-bz-ak2176wb-bz-ak2174wb-bz-wv2175wb-bz-wv2176wb-bz-wv2174wb-bz-dk2175wb-bz-dk2176wb-bz-dk2174wb-bz-lv2175wb-bz-lv2176wb-bz-lv2074wb-sn-mk2075wb-sn-mk2076wb-sn-mk2281wb-sn-mk2074wb-sn-ak2075wb-sn-ak2076wb-sn-ak2281wb-sn-ak2074wb-sn-wv2075wb-sn-wv2076wb-sn-wv2281wb-sn-wv2074wb-sn-dk2075wb-sn-dk2076wb-sn-dk2281wb-sn-dk2074wb-sn-lv2075wb-sn-lv2076wb-sn-lv2281wb-sn-lv2174wb-sn-mk2175wb-sn-mk2176wb-sn-mk2174wb-sn-ak2175wb-sn-ak2176wb-sn-ak2174wb-sn-wv2175wb-sn-wv2176wb-sn-wv2174wb-sn-dk2175wb-sn-dk2176wb-sn-dk2174wb-sn-lv2175wb-sn-lv2176wb-sn-lv3174mb-gd-rd3175mb-gd-rd3176mb-gd-rd374mb-gd-rd375mb-gd-rd376mb-gd-rd3174mb-gd-ny3175mb-gd-ny3176mb-gd-ny374mb-gd-ny375mb-gd-ny376mb-gd-ny3174mb-gd-bk3175mb-gd-bk3176mb-gd-bk374mb-gd-bk375mb-gd-bk376mb-gd-bk3174mb-gd-mn3174mb-gd-or3174mb-gd-pe3175mb-gd-mn3175mb-gd-or3175mb-gd-pe3176mb-gd-mn3176mb-gd-or3176mb-gd-pe374mb-gd-mn374mb-gd-or374mb-gd-pe375mb-gd-mn375mb-gd-or375mb-gd-pe376mb-gd-mn376mb-gd-or376mb-gd-pe3174mb-gd-gr3175mb-gd-gr3176mb-gd-gr374mb-gd-gr375mb-gd-gr376mb-gd-gr3174mb-gd-ry3175mb-gd-ry3176mb-gd-ry374mb-gd-ry375mb-gd-ry376mb-gd-ry3174mb-gd-kg3175mb-gd-kg3176mb-gd-kg374mb-gd-kg375mb-gd-kg376mb-gd-kg3174mb-bz-rd3175mb-bz-rd3176mb-bz-rd374mb-bz-rd375mb-bz-rd376mb-bz-rd3174mb-bz-ny3175mb-bz-ny3176mb-bz-ny374mb-bz-ny375mb-bz-ny376mb-bz-ny3174mb-bz-bk3175mb-bz-bk3176mb-bz-bk374mb-bz-bk375mb-bz-bk376mb-bz-bk3174mb-bz-mn3174mb-bz-or3174mb-bz-pe3175mb-bz-mn3175mb-bz-or3175mb-bz-pe3176mb-bz-mn3176mb-bz-or3176mb-bz-pe374mb-bz-mn374mb-bz-or374mb-bz-pe375mb-bz-mn375mb-bz-or375mb-bz-pe376mb-bz-mn376mb-bz-or376mb-bz-pe3174mb-bz-gr3175mb-bz-gr3176mb-bz-gr374mb-bz-gr375mb-bz-gr376mb-bz-gr3174mb-bz-ry3175mb-bz-ry3176mb-bz-ry374mb-bz-ry375mb-bz-ry376mb-bz-ry3174mb-bz-kg3175mb-bz-kg3176mb-bz-kg374mb-bz-kg375mb-bz-kg376mb-bz-kg3174mb-sn-rd3175mb-sn-rd3176mb-sn-rd374mb-sn-rd375mb-sn-rd376mb-sn-rd3174mb-sn-ny3175mb-sn-ny3176mb-sn-ny374mb-sn-ny375mb-sn-ny376mb-sn-ny3174mb-sn-bk3175mb-sn-bk3176mb-sn-bk374mb-sn-bk375mb-sn-bk376mb-sn-bk3174mb-sn-mn3174mb-sn-or3174mb-sn-pe3175mb-sn-mn3175mb-sn-or3175mb-sn-pe3176mb-sn-mn3176mb-sn-or3176mb-sn-pe374mb-sn-mn374mb-sn-or374mb-sn-pe375mb-sn-mn375mb-sn-or375mb-sn-pe376mb-sn-mn376mb-sn-or376mb-sn-pe3174mb-sn-gr3175mb-sn-gr3176mb-sn-gr374mb-sn-gr375mb-sn-gr376mb-sn-gr3174mb-sn-ry3175mb-sn-ry3176mb-sn-ry374mb-sn-ry375mb-sn-ry376mb-sn-ry3174mb-sn-kg3175mb-sn-kg3176mb-sn-kg374mb-sn-kg375mb-sn-kg376mb-sn-kg3174pb-gd-rd3175pb-gd-rd3176pb-gd-rd374pb-gd-rd375pb-gd-rd376pb-gd-rd3174pb-gd-ny3175pb-gd-ny3176pb-gd-ny374pb-gd-ny375pb-gd-ny376pb-gd-ny3174pb-gd-bk3175pb-gd-bk3176pb-gd-bk374pb-gd-bk375pb-gd-bk376pb-gd-bk3174pb-gd-mn3174pb-gd-or3174pb-gd-pe3175pb-gd-mn3175pb-gd-or3175pb-gd-pe3176pb-gd-mn3176pb-gd-or3176pb-gd-pe374pb-gd-mn374pb-gd-or374pb-gd-pe375pb-gd-mn375pb-gd-or375pb-gd-pe376pb-gd-mn376pb-gd-or376pb-gd-pe3174pb-gd-gr3175pb-gd-gr3176pb-gd-gr374pb-gd-gr375pb-gd-gr376pb-gd-gr3174pb-gd-ry3175pb-gd-ry3176pb-gd-ry374pb-gd-ry375pb-gd-ry376pb-gd-ry3174pb-gd-kg3175pb-gd-kg3176pb-gd-kg374pb-gd-kg375pb-gd-kg376pb-gd-kg3174pb-bz-rd3175pb-bz-rd3176pb-bz-rd374pb-bz-rd375pb-bz-rd376pb-bz-rd3174pb-bz-ny3175pb-bz-ny3176pb-bz-ny374pb-bz-ny375pb-bz-ny376pb-bz-ny3174pb-bz-bk3175pb-bz-bk3176pb-bz-bk374pb-bz-bk375pb-bz-bk376pb-bz-bk3174pb-bz-mn3174pb-bz-or3174pb-bz-pe3175pb-bz-mn3175pb-bz-or3175pb-bz-pe3176pb-bz-mn3176pb-bz-or3176pb-bz-pe374pb-bz-mn374pb-bz-or374pb-bz-pe375pb-bz-mn375pb-bz-or375pb-bz-pe376pb-bz-mn376pb-bz-or376pb-bz-pe3174pb-bz-gr3175pb-bz-gr3176pb-bz-gr374pb-bz-gr375pb-bz-gr376pb-bz-gr3174pb-bz-ry3175pb-bz-ry3176pb-bz-ry374pb-bz-ry375pb-bz-ry376pb-bz-ry3174pb-bz-kg3175pb-bz-kg3176pb-bz-kg374pb-bz-kg375pb-bz-kg376pb-bz-kg3174pb-sn-rd3175pb-sn-rd3176pb-sn-rd374pb-sn-rd375pb-sn-rd376pb-sn-rd3174pb-sn-ny3175pb-sn-ny3176pb-sn-ny374pb-sn-ny375pb-sn-ny376pb-sn-ny3174pb-sn-bk3175pb-sn-bk3176pb-sn-bk374pb-sn-bk375pb-sn-bk376pb-sn-bk3174pb-sn-mn3174pb-sn-or3174pb-sn-pe3175pb-sn-mn3175pb-sn-or3175pb-sn-pe3176pb-sn-mn3176pb-sn-or3176pb-sn-pe374pb-sn-mn374pb-sn-or374pb-sn-pe375pb-sn-mn375pb-sn-or375pb-sn-pe376pb-sn-mn376pb-sn-or376pb-sn-pe3174pb-sn-gr3175pb-sn-gr3176pb-sn-gr374pb-sn-gr375pb-sn-gr376pb-sn-gr3174pb-sn-ry3175pb-sn-ry3176pb-sn-ry374pb-sn-ry375pb-sn-ry376pb-sn-ry3174pb-sn-kg3175pb-sn-kg3176pb-sn-kg374pb-sn-kg375pb-sn-kg376pb-sn-kg3174wb-gd-rd3175wb-gd-rd3176wb-gd-rd374wb-gd-rd375wb-gd-rd376wb-gd-rd3174wb-gd-ny3175wb-gd-ny3176wb-gd-ny374wb-gd-ny375wb-gd-ny376wb-gd-ny3174wb-gd-bk3175wb-gd-bk3176wb-gd-bk374wb-gd-bk375wb-gd-bk376wb-gd-bk3174wb-gd-mn3174wb-gd-or3174wb-gd-pe3175wb-gd-mn3175wb-gd-or3175wb-gd-pe3176wb-gd-mn3176wb-gd-or3176wb-gd-pe374wb-gd-mn374wb-gd-or374wb-gd-pe375wb-gd-mn375wb-gd-or375wb-gd-pe376wb-gd-mn376wb-gd-or376wb-gd-pe3174wb-gd-gr3175wb-gd-gr3176wb-gd-gr374wb-gd-gr375wb-gd-gr376wb-gd-gr3174wb-gd-ry3175wb-gd-ry3176wb-gd-ry374wb-gd-ry375wb-gd-ry376wb-gd-ry3174wb-gd-kg3175wb-gd-kg3176wb-gd-kg374wb-gd-kg375wb-gd-kg376wb-gd-kg3174wb-bz-rd3175wb-bz-rd3176wb-bz-rd374wb-bz-rd375wb-bz-rd376wb-bz-rd3174wb-bz-ny3175wb-bz-ny3176wb-bz-ny374wb-bz-ny375wb-bz-ny376wb-bz-ny3174wb-bz-bk3175wb-bz-bk3176wb-bz-bk374wb-bz-bk375wb-bz-bk376wb-bz-bk3174wb-bz-mn3174wb-bz-or3174wb-bz-pe3175wb-bz-mn3175wb-bz-or3175wb-bz-pe3176wb-bz-mn3176wb-bz-or3176wb-bz-pe374wb-bz-mn374wb-bz-or374wb-bz-pe375wb-bz-mn375wb-bz-or375wb-bz-pe376wb-bz-mn376wb-bz-or376wb-bz-pe3174wb-bz-gr3175wb-bz-gr3176wb-bz-gr374wb-bz-gr375wb-bz-gr376wb-bz-gr3174wb-bz-ry3175wb-bz-ry3176wb-bz-ry374wb-bz-ry375wb-bz-ry376wb-bz-ry3174wb-bz-kg3175wb-bz-kg3176wb-bz-kg374wb-bz-kg375wb-bz-kg376wb-bz-kg3174wb-sn-rd3175wb-sn-rd3176wb-sn-rd374wb-sn-rd375wb-sn-rd376wb-sn-rd3174wb-sn-ny3175wb-sn-ny3176wb-sn-ny374wb-sn-ny375wb-sn-ny376wb-sn-ny3174wb-sn-bk3175wb-sn-bk3176wb-sn-bk374wb-sn-bk375wb-sn-bk376wb-sn-bk3174wb-sn-mn3174wb-sn-or3174wb-sn-pe3175wb-sn-mn3175wb-sn-or3175wb-sn-pe3176wb-sn-mn3176wb-sn-or3176wb-sn-pe374wb-sn-mn374wb-sn-or374wb-sn-pe375wb-sn-mn375wb-sn-or375wb-sn-pe376wb-sn-mn376wb-sn-or376wb-sn-pe3174wb-sn-gr3175wb-sn-gr3176wb-sn-gr374wb-sn-gr375wb-sn-gr376wb-sn-gr3174wb-sn-ry3175wb-sn-ry3176wb-sn-ry374wb-sn-ry375wb-sn-ry376wb-sn-ry3174wb-sn-kg3175wb-sn-kg3176wb-sn-kg374wb-sn-kg375wb-sn-kg376wb-sn-376wb-sn-kg1trophycases1"Retail Displays" "Retail Display Cases" "Retail Display" "Retail Cases" "Retail Store Display" "Retail Store Displays" "Retail Display Case"trophycases

Freestanding Trophy Display Cases - Showcase Your Collection with Pride

Freestanding trophy display cases turn accumulated awards into an organized, visible collection that communicates achievement to everyone who walks past. Where wall-mounted cases require installation hardware and fixed placement, freestanding cases stand independently on any floor surface and can be repositioned as needs change, making them the practical choice for schools updating hallway displays, athletic programs growing their trophy collections, and businesses adding recognition displays to lobbies and conference areas. Available in single-door and double-door configurations, with single-shelf to multi-shelf layouts accommodating anywhere from a handful of featured trophies to dozens of awards across an entire season's worth of championships, our freestanding cases feature tempered glass or acrylic panels for clear visibility from multiple angles, adjustable shelves that accommodate trophy heights from small participation awards to large championship pieces, and lockable doors that protect contents from handling while keeping the display fully visible. Interior lighting options add dramatic presentation impact in dimly lit hallways and reception areas.

Frequently Asked Questions About Freestanding Trophy Display Cases

What size freestanding display case do I need?

Size selection depends on the number of trophies you need to display, the height of your tallest pieces, and the available floor space in your display area. A practical starting point is to count your current trophies and estimate how many you expect to add over the next three to five years, then select a case that comfortably holds that future total rather than just what you have today. Single-door cases in the 36-inch to 48-inch height range suit smaller collections and tighter spaces such as office reception areas and classroom corners. Double-door cases in the 60-inch to 72-inch range are the standard choice for school hallways and athletic lobbies where larger collections need to be visible from a distance. Adjustable shelving is an important feature to look for since it lets you configure shelf spacing to match your trophy heights rather than forcing you to leave wasted vertical space between fixed shelves. If your collection includes large championship cups or multi-tier trophies, measure your tallest piece before ordering to confirm it fits within the interior clearance of your chosen case.

What is the difference between freestanding and wall-mounted trophy display cases?

Freestanding trophy cases stand independently on the floor without requiring wall attachment, making them easy to reposition and suitable for spaces where wall installation is not practical or permitted. They typically offer more total display volume than wall-mounted cases since they can be built taller and deeper without the limitations of wall bracket systems. Freestanding cases work best in open hallway spaces, lobbies, and rooms where the display can be approached from multiple sides. Wall-mounted cases attach directly to the wall and are ideal when floor space is limited, when the display area is a narrow corridor, or when you want to dedicate a specific wall section to permanent recognition. Wall-mounted cases often present more cleanly in architectural terms since they integrate with the wall surface rather than projecting into the room. Many schools and athletic programs use both formats together, with freestanding cases in central lobby areas for their visual impact and wall-mounted cases lining hallways where floor space is at a premium.

How should I arrange trophies inside a display case?

Effective trophy display arranges pieces so the most significant awards are immediately visible and the overall collection tells a coherent story at a glance. A common approach places the largest and most prestigious trophies at eye level in the center of the case, with smaller awards flanking them and filling upper and lower shelves. Grouping by sport, year, or achievement category creates visual organization that helps viewers understand the collection rather than seeing an undifferentiated pile of hardware. Championship trophies benefit from a dedicated shelf or prominent central position that signals their importance relative to participation and category awards. Name plates or small printed labels identifying the award, year, and team add context that makes the display meaningful to visitors unfamiliar with your program's history. Leaving some open space between trophies rather than packing shelves to capacity makes each piece easier to see and gives the display a more intentional, curated appearance. For cases with lighting, positioning taller trophies toward the back of shelves prevents them from blocking light from reaching shorter pieces in front.

If you need more information before deciding, see our expert resource section:
]]>
Display Cases
custom-pagetrophies-swimming-divingplasticpinboxvelapinbox151-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
lapel pins105502-30.31150030.3Classic MedallicsLapel PinsSports, Hobby, Org, Livestock1:30%,50:36%,100:39%,500:42%,1000:48%"Swimming Awards" "Swimming Ribbons" "Swimming Pins" "SwimmingLapel Pins"Find these boy's freestyle swimming pins discounted at TrophyCentral. Each pin features a gold finish and clutch back.cl38Swimming / Diving, Sports
custom-pagetrophies-swimming-divingplasticpinboxvelapinbox151-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
lapel pins105502-30.31150030.3Classic MedallicsLapel PinsSports, Hobby, Org, Livestock1:30%,50:36%,100:39%,500:42%,1000:48%"Swimming Awards" "Swimming Ribbons" "Swimming Pins" "SwimmingLapel Pins"Find these girl's freestyle swimming pins discounted at TrophyCentral. Each pin features a gold finish and clutch back.cl37Swimming / Diving, Sports
custom-pagemusicartpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsMusic, Drama, Art, Dance1:22%,50:30%,100:33%,500:45%"Music Lapel Pins" "Band Lapel Pins" "Music Pins"Find These French Horn Lapel Pins Discounted at TrophyCentral. Features a Clutch-Pin Back and Fast 1-2 Day Shipping!mp8Music / Band / Chorus11These personalized medals are available in several finishes and styles. Each medals can be personalized with an organization name imprinted on the front.custommedalsShop for Personalized Awards with Confidence at TrophyCentral

We offer a huge selection, discounted prices and great customer service. Do you need help with some ideas or with ordering? Yes, we sell online, but we have real people who would love to help you! Feel free to call our customer service experts in Michigan, New York and online. TrophyCentral - delivering smiles since 1999!]]>custom-pagecospwabo50"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745315125016.5PepcoPromotional ProductsSports / Water Bottles1:14%,250:21%,500:31%,1000:45%,2500:49%Find These Frosted Clear Custom Sports Bottles Discounted At TrophyCentral. Also Available In Other Popular Colors. Large Quantity Discounts.Sports / Water Bottles11Explore fun and unique ideas for personalizing awards, making them memorable and meaningful for every occasion. Discover creative ways to celebrate achievements.11Check out this great baseball infographic. Add some fun to your next baseball awards ceremony by sharing these fun baseball facts.11Check out this great basketball infographic. Add some fun to your next basketball awards ceremony by sharing fun basketball trivia!sports-resource-hub11Discover creative fun award ideas for special events! From wedding celebrations to potluck dinners, find unique recognition that makes every gathering memorable and entertaining.11Check out this great football infographic. Add some fun to your next football awards ceremony by sharing these fun football facts.custom-pagesports-resource-hub11GOAT stands for Greatest of All Time. Learn what a GOAT award means, where the acronym comes from, who earns one, and how to present it memorably.custom-pagetrophies-music1"1-2 business days" "Topeka, Indiana" "UPS (Priority Mail also available)"ribbons465711-21 2618024.36Tower RibbonRibbonsStock Ribbons1:22%,2:27%,3:31%"Award Ribbons"Find these Fun School Ribbons Discounted at TrophyCentral. Top-Rated Provider of Discounted School Award Ribbon Products.Birthday, Participant, Music / Band / Chorus, Attendance, Reading, Science, Speller, A Honor, A-B Honor, Improved, Citizenship, Awesome, Outstanding, Academiccustom-pageblog-trophycentral11Transform your wedding reception with 15 fun award ideas and creative activities. From Best Dancer trophies to interactive games, discover budget-friendly ways to keep guests engaged and create unforgettable moments under $200.trophy-and-award-buying-lists11Discover 5-7 funny awards for volunteers to add a touch of humor to your next event. Celebrate your volunteers with these lighthearted and unique awards!custom-pageaward-medalssingle-column-b-toilet-bowldouble-toilet-bowlperpetual-toilet-bowlplace-toilet-bowlsingle-column-toilet-bowlthree-column-toilet-bowlbdg-toilet-bowlparticipation-toiletqthorsencqthorsescqthorsedmqthorseyrqthorseplqthorsettqthorsettwqthorse3cmqthorsescbcup-horse-scbcup-horse-pbdg-horses-rearsingle-column-b-comic-turkeydouble-comic-turkeyperpetual-comic-turkeyplace-comic-turkeysingle-column-comic-turkeythree-column-comic-turkeybdg-comic-turkeyparticipation-turkeyloser-award-plaque1shop-by-category1

Funny Trophies and Gag Awards - Celebrate Last Place in Style

Funny trophies turn the bottom of the standings into the most anticipated award of the season. Where a traditional trophy celebrates the winner, a well-chosen gag award celebrates the personality of a league, the camaraderie of a group, and the good humor of the person receiving it. Our collection centers on three iconic figures that have become staples of fantasy leagues, office competitions, and casual tournaments everywhere: the horse's rear, the toilet bowl, and the comic turkey, each available in a full range of sizes from budget participation trophies to towering two-tier championship gag trophies that demand to be photographed at the awards ceremony. Perpetual toilet bowl and comic turkey trophies add an extra layer of tradition, passing from last-place finisher to last-place finisher each season with new engraving adding to the trophy's running history. Every funny trophy includes free personalized engraving, so the joke is always specific to the recipient, the league, and the season, making each award a conversation piece rather than a generic gag gift.

Frequently Asked Questions About Funny Trophies

What occasions are funny trophies best suited for?

Funny trophies work best in any setting where competition is genuine but the social atmosphere is lighthearted and the group knows each other well enough to share a laugh at each other's expense. Fantasy football and fantasy baseball leagues are the most popular use case, particularly for last-place finishers who face a season of good-natured mockery from the rest of the league. Office competitions, friendly golf tournaments, bowling leagues, poker nights, and family game tournaments all benefit from a gag trophy that gives the event a running joke and something to talk about year after year. Bachelor and bachelorette parties sometimes use funny trophies for competitive games, and team-building events where the goal is as much laughter as friendly competition are a natural fit. The key in any setting is that everyone involved understands the intent is affectionate rather than mean-spirited, which is usually not a problem when the award comes with a well-engraved inside joke that only the group would understand.

What should I engrave on a funny trophy?

The engraving is where a funny trophy goes from a generic gag gift to a truly memorable award, so it is worth spending a few minutes getting it right. The best approach starts with the recipient's name and year to anchor the award in time, then adds a title or description that captures the specific reason they earned it. Generic options like Last Place, Fantasy Football 2025 or Worst Record, Office League 2025 are perfectly serviceable, but league-specific inside jokes land harder: Traded Away the League MVP, Still Thinks He Knows Football, or Picked a Kicker in Round 3 will get a bigger reaction at the ceremony and make the trophy more meaningful as a keepsake. For perpetual trophies that pass between recipients each season, each year's loser gets their own engraving line added to the trophy's growing history, which turns the award into a running record of the league's most memorable failures over time. Keep the tone consistent with how the group interacts, and when in doubt, specific and personal beats generic every time.

What size funny trophy should I order?

Trophy size matters more for gag awards than almost any other category because the visual impact at the presentation ceremony is a big part of the joke. A tiny budget participation trophy handed to last place with great ceremony gets a laugh, but a towering two-tier gag trophy carried into the room gets a bigger one. For casual groups and office settings where the award will sit on a desk, the single column and double platform sizes in the 12-inch to 18-inch range strike the right balance between impressive and absurd. For fantasy leagues that have developed real traditions around the last-place award, the two-tier and three-column championship gag trophies in the 20-inch-plus range create the kind of moment that the league talks about for years. Perpetual trophies are worth the investment for leagues that have been running for several years and want an award that accumulates history rather than starting fresh each season. Budget participation trophies work well for large groups where everyone gets a funny award in a different category, keeping the cost manageable while still giving each person something specific and personal.

If you need more information before deciding, see our expert resource section:
]]>
fantasy-sports-certificatesFunny / Gag
custom-pagefree-sports-templates1"Download Only"free-sports4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our futbol certificate template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-futbol-Certificatefutbol-freeFootball, Sportscustom-pagemedallion-inserts-organizations12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Future Farmers Of America Inserts (Litho) at TrophyCentral. Each 2" insert can be used to create a unique plaque, medal or trophy.493851
custom-pageletter-shaped-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoName Badges1Find these popular G-shaped custom mascot badges at TrophyCentral. Great for fundraising! TrophyCentral is a top-rated Yahoo merchant.letterbadges-gcustom-pageglass-crystal-awards1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"general410187-1010.45424.45JcharlesCrystal Awards1:22%,25:25%"crystal awards" "Retirement Awards" "Retirement Plaques, Awards and Gifts"Galileo Awards are inspired works of art. The Galileo Award is available in two sizes and includes free engraving. Check out our discounted prices!040xGeneralcustom-pagemascotinserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsMascots1Buy these quality Gators Mascot Medal Inserts at TrophyCentral. Each Gators Insert can be used to create a unique plaque, medal or trophy.489935Mascot
custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Gavel Inserts (Litho) at TrophyCentral. Each Gavel Insert can be used to create a unique plaque, medal or trophy.501361Occupations
custom-pagegavelplaques11plaques105503-610.451814.85PlaquesGavel Plaques1:22%This gavel plaque comes with a 2" subject insert (sports, academics, etc.)See all ourGavelcustom-pagesimenplaqfreesgav9x12gavelplaquerewagaplwafigarosewoodgaveldegablmoneybagplaque10x13gavelplaquekey-insert-plaqueshovel-plaquecrkeytocikeycomingsoon1plaques2-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
498555-8.52Discover elegant gavel plaques and engraved gavels at TrophyCentral. Perfect for honoring leaders, board members, judges, or retiring officers with free engraving and fast shipping.

Gavel Plaques and Awards - Distinguished Recognition for Leaders and Officers

Gavel plaques are the traditional recognition award for board officers, committee chairpersons, organizational presidents, and judges whose leadership and service merit lasting acknowledgment. The gavel has symbolized authority and order in deliberative bodies for centuries, making a gavel plaque one of the most immediately understood and universally respected leadership awards available. Our collection includes walnut and rosewood wall-mounted gavel plaques in sizes from 9x12 to 13x10 shadowbox presentations, standalone engraved gavels in walnut and rosewood finishes for desk display, and deluxe gavel and block sets for organizations that want a functional presentation piece alongside the recognition plaque. Specialty awards including ceremonial shovel plaques for groundbreaking honors and key to the city awards round out the collection for civic and organizational recognition needs beyond traditional board service. Every award includes free personalized engraving documenting the recipient's name, title, organization, and years of service.

Frequently Asked Questions About Gavel Plaques

What occasions are gavel plaques most appropriate for?

Gavel plaques are most commonly presented to outgoing board presidents, committee chairpersons, and organizational officers completing their terms of service in nonprofits, civic organizations, professional associations, homeowner associations, and fraternal organizations. Retiring judges and court officers are another primary recipient group, where the gavel's association with judicial authority makes it a natural and appropriate recognition symbol. Organizations presenting these awards typically do so at annual installation ceremonies when incoming officers are sworn in and outgoing leaders are formally thanked, or at retirement dinners and farewell events where the full tenure of service is being recognized. School board members, city council members, and municipal leaders whose service involves presiding over public meetings are also common recipients. The key common thread across all these occasions is that the recipient held formal authority within a deliberative body and exercised that authority in service of others over a meaningful period of time.

What engraving details should a gavel plaque include?

Gavel plaque engraving should document the full context of the leadership being honored so the award serves as a meaningful record of service rather than a generic recognition piece. Essential elements include the recipient's full name, official title, organization name, and years of service. For example: Margaret Sullivan, Board President, Community Arts Foundation, 2020-2025, or Honorable Robert Martinez, Circuit Court Judge, 25 Years of Distinguished Service, 2000-2025. Multi-term leaders benefit from noting specific accomplishments such as Led Capital Campaign or Expanded Services Statewide when space allows. Retirement plaques often include a gratitude statement such as In Appreciation for Dedicated Leadership or Presented in Recognition of Unwavering Commitment to close the engraving on a warm note. Some organizations include the organization's motto or a brief mission statement beneath the service details. The engraving plate size on larger gavel plaques accommodates several lines of text, so there is generally enough space to include all meaningful details without sacrificing readability.

When should I choose a shovel plaque or key award instead of a gavel plaque?

Shovel plaques commemorate groundbreaking achievements, both literal and figurative. The most common use is recognizing donors, project leaders, and elected officials at building groundbreaking ceremonies for construction projects, facility expansions, and capital campaigns, where a mounted ceremonial shovel serves as a fitting memento of the occasion. Metaphorical applications honor innovators and founders who broke new ground for an organization, launched pioneering programs, or led significant initiatives that changed the direction of a community or institution. Key to the city awards are civic recognition pieces traditionally presented by mayors and municipal officials to distinguished visitors, community leaders, and individuals making significant contributions to a city or region. They are appropriate for formal civic ceremonies and distinguished service recognition at the municipal level. Gavel plaques remain the strongest choice specifically for board and committee leadership recognition where the authority and governance role is the central element being honored. When the recognition is about presiding and leading rather than building or civic distinction, the gavel plaque is the right award.

If you need more information before deciding, see our expert resource section:
]]>
custom-pagegifts-desk-general11105503-61311623.8Classic MedallicsPlaquesDesk Sets1:22%Shop for Gavel Set from TrophyCentral. Discounted Trophies, Awards and Promotional Products.Engraved Giftscustom-page12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
498555-8.52
custom-pageacademic-general-medals50"4-6 business days" "Mount Vernon, NY" "UPS"105502-50.75130033.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,100:33%,300:41%Find these fabulous Gold Achievement Medals discounted at TrophyCentral. Price includes the name of your school or organization imprinted on the front of the medal!m155General, Custom Medalscustom-pagesporcer1certificates290631-31 2 3 230.45100020.45Certificate SourceCertificatesAward Certificates1:22%,25:27%,100:40%,500:50%Give athletes the recognition they deserve with sports and athletic certificates from Trophy Central. See our quality sports certificates at discounted prices.1032Sports, Academiccustom-page12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
498555-8.52Find our Michigan trophy and awards store in Marquette and online. Here is some general information regarding policies.
custom-page12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
498555-8.52This page includes general information pertaining to trophy and display cases, including shipping times, delivery options and general FAQs. It also includes pictures of finishes and display backs.
1index1General Information for TrophyCentral. This section includes engraving faq's, aboutus, privacy policy and much more.1custom-pagesports-inserts1105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%General Soccer Litho Medal Insert. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.507396Soccer, Sportscustom-pageinserts1volunteer-eitorch-eihonorable-ei4th-place-ei2nd-ei3rd-ei1st-ei513051512931512911513421512341505711495836518402502441517598505061501861518158491771505191505131505451503941502138507409507416501281497652501311506271504881504761489902489792518245502461507382506701501811507490513451507439507472495335507407513461517648493521503991517797518199507015042711inserts11Browse our large selection of general subject inserts. These 2" inserts can be used to create a unique medal, trophy or plaque.1inserts1General Subjectscustom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these high-quality GENERAL Track (Male) Inserts at TrophyCentral. Each GENERAL Track (Male) Insert can be used to create a unique plaque, medal or trophy.502371
custom-pagebottles-st72"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14142013.6Glass AmericaPromotional ProductsSports / Water Bottles1:14%,576:35%Find These Blue Geyser Collection Stainless Water Bottles Discounted At TrophyCentral. Free One-Color Imprint!56084Sports / Water Bottlescustom-pagebottles-st72"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14142013.6Glass AmericaPromotional ProductsSports / Water Bottles1:14%,576:35%"Basketball Water Bottles" "Logo Sports Bottles" "Sports Bottles" "Promotional Sports Bottles" "Aluminum Sports Bottles" "Stainless Water Bottles" "Aluminum Water Bottles" "Bike Water Bottles" "Bicycle Water Bottles" "Baseball Water Bottles" "Football Water Bottles" "Promotional Water Bottles" "Soccer Water Bottles"Stainless Steel Geyser Collection - Orange from TrophyCentral.56085Sports / Water Bottlescustom-pagebottles-st72"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14142013.6Glass AmericaPromotional ProductsSports / Water Bottles1:14%,576:35%Find These Black Geyser Collection Stainless Steel Water Bottles Discounted At TrophyCentral. Free One-Color Imprint!56077Sports / Water Bottlescustom-pagebottles-st72"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14142013.6Glass AmericaPromotional ProductsSports / Water Bottles1:14%,576:35%Find These Lime Green Geyser Collection Stainless Steel Water Bottles Discounted At TrophyCentral. Free One-Color Imprint!56088Sports / Water Bottlescustom-pagebottles-st72"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14142013.6Glass AmericaPromotional ProductsSports / Water Bottles1:14%,576:35%Find These Purple Geyser Collection Stainless Steel Water Bottles Discounted At TrophyCentral. Free One-Color Imprint!56032Sports / Water Bottlescustom-page25gifcer35gice50gifcer100gifcer250gifcer11custom-pagetrophies-basketball12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,100:28%,500:34%,1000:45%"Basketball Awards" "Award Medals - All Subjects" "Sports Medals" "Basketball Medals"Basketball Medal, Female (1 1/4"). Ideal for leagues, schools, and tournaments. Fast shipping.e9015Basketball, Sports
custom-pagetrophies-soccer12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
"PT1=Medals" "PC12=105503-60.7530033.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,100:28%,500:34%,1000:45%"Soccer Medals" "Soccer Awards" "Award Medals - All Subjects" "Sports Medals" "Soccer Medals and Trophies" "Soccer Trophies and Medals"Girls Soccer 1 1/4 Inch E-Series Medals. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.1e932812-05-2006Soccer, Sports
custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-31130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Girls Basketball Litho Medal Insert. Ideal for leagues, schools, and tournaments. Fast shipping.501831Basketball, Sports
custom-pagetrophies-golf1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.7169.14Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,5:26%,50:30%"Golf Trophies" "Golf Trophy"Golf (Female) - Burst-Thru Series Trophy. Ideal for leagues, schools, and tournaments. Fast shipping.wbt75404-20-2021Golf, Sportscustom-pagetrophies-lacrosse1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.7169.14Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,5:26%,50:30%"Lacrosse Trophies" "Lacrosse Awards"This fun Lacrosse (Girls) 'Burst Thru' trophy has an exciting and captivating design that your athletes and kids will love. Lacrosse (Girls) trophies include free engraving.wbt789Lacrosse, Sportscustom-pagetrophies-soccer1trophies465713-410.7169.14Tower RibbonTrophiesSports, Hobby, Org, Livestock1"Soccer Trophy" "Soccer Trophies" "Soccer Trophies" "Soccer Medals and Trophies" "Soccer Trophies and Medals"Female Soccer Burst-Thru Series Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.trophies-soccerSoccer, Sportscustom-pagetrophies-swimming-diving1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.7169.14Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,5:26%,50:30%"Swimming Trophies"This fun Swimming (Girls) 'Burst Thru' trophy has an exciting and captivating design that your athletes and kids will love. Swimming (Girls) trophies include free engraving.wbt780Swimming / Diving, Sportscustom-pagetrophies-track-field1"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.7149.14Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,5:26%,50:30%"Track Trophy" "Track Trophies"This fun Track (Girls) 'Burst Thru' trophy has an exciting and captivating design that your athletes and kids will love. Track (Girls) trophies include free engraving.wbt7748-23-2023custom-pagecustommedalswhitcarboarbvelourbox50"5-7 business days" "Mt. Vernon, NY" "UPS"medals105503-610.45115024.45Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,100:33%,300:41%"New Products" "Track Medals"Find these fabulous Personalized Girls Track Medals (Gold) at TrophyCentral. Price includes the name of your school or organization imprinted on the front of the medal!m157gcustom-pagetrophies-soccer1trophies465713-410.451810.3Tower RibbonTrophiesSports, Hobby, Org, Livestock1"Soccer Trophies"Motion Xtreme 5" Girl's Soccer Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagetrophies-swimming-diving11"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.451810.3Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,10:28%,25:34%moxtfeswtrBe sure to see our other greatin a variety of styles.trophies-swimming-diving9-30-24Swimming / Diving, Sportscustom-pagetrophies-track-field11"1-2 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.451810.3Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,100:29%Find This Popular Motion Xtreme 500 Girls Track Trophy At TrophyCentral. The Price Of Each Motion Xtreme 500 Track (Girls) Trophy Includes Engraving.moxtfetrtr1custom-pagetrophies-baseball1trophies465713-410.451613.1Tower RibbonTrophiesSports, Hobby, Org, Livestock1Motion Xtreme (700 Series Trophy) - Female Baseball Batter. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Baseball / T-Ball, Sportscustom-pagetrophies-lacrosse11"2-3 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-4141613.1Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,100:29%"Lacrosse Awards"These Unique Motion Xtreme 700 Lacrosse (Female) Ship In Just 1-2 Business Days And Include Engraving.felatrLooking for something different? See morein other great styles.trophies-lacrosse05-23-2009Lacrosse, Sportscustom-pagetrophies-soccer1trophies465713-410.451613.1Tower RibbonTrophiesSports, Hobby, Org, Livestock1Motion Xtreme (700 Series) Girl's Soccer Figure Trophies. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagetrophies-softball1"2-3 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.451613.1Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,100:29%"Softball Awards" "Baseball Awards" "Softball Awards"These Unique Motion Xtreme 700 Girls Softball Trophies Ship In Just 1-2 Business Days And Include Engraving.mxx02Softball, Sportscustom-pagetrophies-track-field111041 cl50 cl42"2-3 business days + shipping time" "Topeka, Indiana" "UPS (Post Office Priority Mail may be available on request)"trophies465713-410.451613.1Tower RibbonTrophiesSports, Hobby, Org, Livestock1:22%,100:29%These Unique Girls Track Motion Xtreme 700 Trophies Ship In Just 1-2 Business Days And Include Free Engraving!moxtfetrtrSee additionalin a large variety of styles.trophies-track-fieldcustom-pagetrophies-basketball1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511224.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,6:24%,12:26%,24:29%,48:31%"Basketball Awards"Star Series Resin Basketball Trophy (Female). Ideal for leagues, schools, and tournaments. Fast shipping.tr7001Basketball, Sportscustom-pagetrophies-cheerleading-spirit1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511224.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,6:24%,12:26%,24:29%,48:31%"Cheerleader Awards"Star Series female cheerleading trophies have been meticulously sculptured and hand painted in an antique gold finish with a star shape base.tr7003Cheerleading, Sportscustom-pagequickshiptrophies-graduate1trophies105503-610.4513028.65Classic MedallicsTrophiesAcademic1:22%,10:25%,50:29%,100:34%"Graduation Award" "Graduation Awards"This sculptured resin Graduation Award (Girl) Trophy Includes Engraving. Be sure to see other section for additional Girl's Graduation Awards.schooltrophies20Graduation, Academiccustom-pagetrophies-lacrosse1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511224.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,6:24%,12:26%,24:29%,48:31%"Lacrosse Awards"Star Series female lacrosse trophies have been meticulously sculptured and hand painted in an antique gold finish with a star shape base.tr7005Lacrosse, Sportscustom-pagetrophies-soccer1trophies105503-610.4511224.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1"Soccer Awards"Female Soccer Resin Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagetrophies-swimming-diving1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.451 2 3 4 5 6 7 8 911224.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,6:24%,12:26%,24:29%,48:31%"Swimming Awards"tr7010Swimming / Diving, Sportscustom-pagetrophies-tennis1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.451 2 3 4 5 6 7 8 911224.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,6:24%,12:26%,24:29%,48:31%"Tennis Awards"Star Series female tennis trophies have been meticulously sculptured and hand painted in an antique gold finish with a star shape base.tr7006Tennis, Sportscustom-pagetrophies-track-field1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.451 2 3 4 5 6 7 8 911224.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,6:24%,12:26%,24:29%,48:31%"Track Awards"Star Series female track trophies have been meticulously sculptured and hand painted in an antique gold finish with a star shape base.tr7012custom-pagetrophies-volleyball1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.451 2 3 4 5 6 7 8 911224.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,6:24%,12:26%,24:29%,48:31%"Volleyball Awards"Star Series female volleyball trophies have been meticulously sculptured and hand painted in an antique gold finish with a star shape base.tr7008Volleyball, Sportscustom-pagetrophies-soccer1trophies465713-410.45169.5Tower RibbonTrophies1Female Rock N Jox Soccer Trophy. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Soccer, Sportscustom-pagetrophies-track-field50"4-6 business days" "Mount Vernon, NY" "UPS"medals105502-50.75130033.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,100:33%,300:41%"Track Medals"Find these fabulous Personalized Girls Track Front Imprint Medals at TrophyCentral. Price includes the name of your school or organization imprinted on the front of the medal!m157custom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic MedallicsMedalsSports, Hobby, Org, Livestock Bottles1:22%,100:28%,500:34%,1000:45%"Track Medals"These inexpensive 1 1/4 inch Triple Jump (Girls) Medals offer a high quality, but low price for those on a tight budget.e986812-20-2020
custom-pagetrophies-gymnastics12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Gymnastics Medals"2-inch Girls' Gymnastics litho insert featuring all major gymnastics events, for medals, plaques, and trophies. Discounted at TrophyCentral.506361Gymnastics, Sports
custom-pagebaseballdisplay11"5-7 business days w/Logo, 2-4 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 23 24 251.5123.5Perfect CaseDisplay Cases11:14%,5:19%Glass Baseball Bat Display Case. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.Baseball / T-Ball, Sportscustom-pageracingdisplays1"7-10 business days w/Logo, 4-6 without" "Apopka, FL 32712" "UPS (FedEx available on request)"display case327765-101 3 22 23 24 251110Perfect CaseDisplay Cases11:14%,10:25%This Hat / Cap Glass Display Case is a perfect way for you to showcase your treasured baseball, basketball, football, NASCAR or any prized cap. Display case is made with mirror on the bottom and back.Baseball / T-Ball, Sportscustom-pagegolfballdisplay1"7-10 business days w/Logo, 4-6 without" "Apopka, FL 32712" "UPS (FedEx available on request)"327765-101 3 22 23 24 2511413Perfect CaseDisplay Cases1:14%,5:13%Glass Golf Ball Display Case. Ideal for leagues, schools, and tournaments. Fast shipping.Golf, Sportscustom-pageglass-crystal-awards1"5-10 business days" "Mount Vernon, NY" "UPS"general105503-610.4511236.45Classic MedallicsCrystal Awards1:22%"Crystal Awards"Shop for Optical Cut Crystal House from TrophyCentral.Leadershipcustom-pageglass-crystal-awards1"10 business days" "Aliquippa, PA" "UPS"general1500110-1410.451236.45Glass AmericaCrystal Awards1:22%,10:25%Find these Iceberg Optical Crystal Awards discounted at TrophyCentral. Features free engraving and a free gift box.custom-pagefootballdisplay11"7-10 business days w/Logo, 4-6 without" "Apopka, FL 32712" "UPS (FedEx available on request)"327765-101 3 22 23 24 25118Perfect CaseDisplay Cases11:14%,5:17%Glass Mini Helmet Display Cases from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.Football, Sportscustom-pageplaques12x9floatingpiano9x12floatingpiano12x9floatingrosewood9x12floatingrosewooddplt044dignityplaquedplt028novaaftr02911Find glass plaques discounted at TrophyCentral. Each glass plaque includes free custom engraving. Find Custom Glass Plaques for Every Occasion Whether you choose an inexpensive acrylic plaque for an employee event, or an elegant floating glass plaque for a board member or special milestone, we can help you find perfect award. Be sure to also see our large selection of glass and crystal awards. We offer a large selection, discounted prices and great customer service. Our experts online and in New York and Michigan have been providing suggestions and guidance since 1999!]]>custom-pagepersonalized-gifts1105503-6121247.52Insert Award1:22%custom-pagenoname111"7-10 business days w/Logo, 4-6 without" "Apopka, FL 32712" "UPS (FedEx available on request)"327765-101 3 22 23 24 2511413Perfect CaseDisplay Cases1:14%,5:13%Find this Glass Tennis Display Cases at TrophyCentral; Tennis Display ships in just a couple of days!Tennis, Sports1glass-crystal-awards1Final global awards discounted at TrophyCentral. Each global award includes free personalization and a gift box for a special touch.high-end-awardsGlobal Awardscustom-pageglass-crystal-awards11"10-15 business days w/engraving (rush service may be available for additional charge)" "Chicago, Illinois" "UPS (FedEx available on request)"6063010-151 3 230.451638.85RS OwensTrophies1:22%These exquisite jade glass awards are perfect for your global or international teams. Available in 3 sizes. Price includes text etching and gift box!custom-pagegeneral-corporate-awards1"7-10 business days w/engraving" "Chicago, Illinois" "UPS (FedEx available on request)"606307-101 3 230.45840.45RS OwensTrophies1:22%Find this Globe Award discounted at TrophyCentral. Includes a beautiful Walnut base and free engraving.custom-pagetrophies-baseballplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsSports, Hobby, Org, Livestock1:22%,50:30%,100:33%,500:47%"Baseball Awards" "Baseball Pins" "Baseball Lapel Pins"ec09Baseball / T-Ball, Sportscustom-pagefloating-plaques1"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"plaques458221510.45413.65Vision AwardsPlaquesEngraved Plaques1:22%,6:24%,26:30%,51:33% "General Recognition Awards"Find Glowing Globe Award Plaques at TrophyCentral. Globe plaques include free engraving!custom-pagetrophies-go-kart1trophies498551-310.452429Trophies1Find this popular Go Kart trophy discounted at TrophyCentral. Features a real marble base, stylish 4-inch gold cup, free engraving and fast shipping.go-kart-cup-place-trophycustom-pagetrophies-go-kart1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:16%Fabulous Go Kart Figure trophy with choice of 1st, 2nd or 3rd place trim. Each Go Kart Place trophy Includes Free Personalization!qtcartplReturn to ourfor our complete selection.trophies-go-kartGo Kartcustom-pagetrophies-go-kart1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:16%This popular Go Kart Trophy features a real marble base, column, figure and trim indicating year of award. All trophies include free engraving!qtcartyrGo Kartcustom-pagetrophies-go-kart1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with go kart figure discounted at TrophyCentral. Includes free text engraving!cup-cart-pGo Kartcustom-pagefreeawardcertificates1"Download Only"free-sports49855011TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Go Kart template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Go-Kart-Certificatego-kart-freeGo Kartcustom-pagetrophies-go-kart1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these go kart budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtcartscbGo Kartcustom-pagetrophies-go-kart1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:26%Find these fabulous two-tier Go Kart Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtcartttGo Kartcustom-pagetrophies-go-kart1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-411.2115Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:28%See this championship trophy with a Go Kart figure at TrophyCentral. Be sure to see all of our Go Kart figure awards.qtcartttwGo Kartcustom-pagetrophies-go-kart1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:22%Find these popular Go Kart Single Column Elite Series trophies discounted and with free personalization at TrophyCentral.qtcartscGo Kartcustom-pagetrophies-go-kart1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.451622.05Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:16%Find These Popular Go Kart Deluxe Platform Trophies Discounted at TrophyCentral. Features Real Marble and Free Engraving!qtcartdmSee all of our greatin a variety of sizes and styles.trophies-go-kartGo Kartcustom-pagetrophies-go-kart1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Go Kart figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-cart-scbGo Kartcustom-pagetrophies-go-kart1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-411.4118Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:18%,10:23%Find these fabulous two-tier, 3-column champion Go Kart Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtcart3cGo Kartcustom-pageplaques1"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498852-310.45811.6Quick TrophyPlaquesInsert1:14%,3:14%"Go Kart Awards"See this stunning Go Kart plaque and other Holographic Plaques at TrophyCentral.qsinplaqkartGo Kartcustom-pagetrophies-go-kart1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:25%Our popular Go Kart Economy Participation Trophies feature a real slant-front marble base and free personalization. Significant quantity discounts available.qtcartncReturn to oursection form more great choices.trophies-go-kartGo Kartcustom-pagetrophies-go-kart1trophies498551-310.452429Trophies1Find our Go Kart star column trophy discounted at TrophyCentral. Features a real marble base, 6 inch gold star-shaped column, free engraving and fast shipping.go-kart-star-column-trophycustom-pagequickshiptrophies-wheelqtcartncqtcartscqtcartdmqtcartyrqtcartplqtcartttqtcart3cwss698qtcartttwmqtcartscbcup-cart-scbcup-cart-pgo-kart-cup-place-column-trophygo-kart-cup-place-trophygo-kart-star-column-trophy1trophies1Fin Go Kart Trophies Discounted at TrophyCentral. Each Go Kart Trophy Includes Free Personalization! Fast 1-2 Day Shipping!Custom Go Kart Trophies and Awards TrophyCentral has a great online selection of Go Kart trophies to meet all of your award recognition needs. Be sure to see our Single Column Trophies with a Go Kart figure, available with your choice of column color and size. Also see our 1st through 3rd Place Go Kart Trophies, perfect for recognizing multiple levels of achievement. Our Go Kart Champion Trophies are also popular for scouting events.
Each Go Kart trophy and award includes up to three lines of FREE PERSONALIZATION (larger awards include additional lines).]]>
Go Kart
custom-pagesports-inserts1105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Goal Soccer Litho Medal Insert. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.507453Soccer, Sportscustom-pagetrophies-hockey-goalie1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular goalie figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at TrophyCentral. Ships in a fast 1-2 days!qtgoalplHockey, 1st / 2nd / 3rd / Etc., Sportscustom-pagetrophies-hockey-goalie1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find these popular Goalie year trim trophies discounted at TrophyCentral. Available in multiple sizes and includes free personalization. Features gold year of event trim.qtgoalyrHockey, Sportscustom-pagetrophies-hockey-goalie1trophies498852-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with goalie figure discounted at TrophyCentral. Includes free text engraving!cup-goal-pHockey, Sportscustom-pagetrophies-hockey-goalie1trophies498852-312421.33TrophiesSports, Hobby, Org, Livestock1Find these goalie budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtgoalscbHockey, Sportscustom-pagetrophies-hockey-goalie1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous two-tier Goalie Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtgoalttHockey, Sportscustom-pagetrophies-hockey-goalie1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-411.2115Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%Find this awesome Hockey Goalie two tier championship trophy discounted at TrophyCentral. Add up to 3 lines of Free Personalization!qtgoalttwHockey, Sportscustom-pagetrophies-hockey-goalie1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%This popular Goalie Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtgoalscHockey, Sportscustom-pagetrophies-hockey-goalie1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.451623.65Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%Find Our Goalie Deluxe Platform Series Trophies Discounted at TrophyCentral. Real Marble Base; Free Personalization!qtgoaldmHockey, Sportscustom-pagetrophies-hockey-goalie1trophies498852-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Goalie figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-goal-scbHockey, Sportscustom-pagetrophies-hockey-goalie1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-411.4118Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous two-tier, 3-column champion Goalie Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtgoal3cHockey, Sportscustom-pagetrophies-hockey-goalie1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-410.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,100:36%Our popular Goalie participation trophies feature a real slant-front marble base and free engraving.qtgoalncHockey, Sportscustom-pagetrophies-hockey-goalie1trophies498551-310.452429Trophies1Find our Goalie star column trophy discounted at TrophyCentral. Features a real marble base, 6 inch gold star-shaped column, free engraving and fast shipping.goalie-star-column-trophycustom-pageaward-medalsqtgoalncmqtgoalscbqtgoalsccup-goal-pcup-goal-scbqtgoaldmqtgoalplqtgoalyrqtgoalttqtgoalttwqtgoal3cgoalie-star-column-trophy1trophies-ice-hockey1Find a great selection of goalie trophies at TrophyCentral. Each goalie trophy and award includes free engraving. Fast 1-2 day shipping! 1

Hockey Goalie Trophies and Awards - Recognize the Backbone of Every Team

Hockey goalie trophies honor the most unique and demanding position in the sport, recognizing the athlete who faces every shot, absorbs every pressure moment, and often determines the outcome of a game more decisively than any other player on the ice. Where scoring trophies celebrate the visible highlights of offensive production, a goalie trophy acknowledges the saves, positioning, rebound control, and unshakeable focus that keep teams in games when momentum shifts against them. Our hockey goalie trophy collection features goaltender figurine designs in classic save and stance positions suited for youth hockey associations, travel and AAA programs, high school varsity teams, and adult recreational leagues at every competitive level. From economy goalie trophies for youth programs presenting position-specific awards to the entire team at end of season banquets to premium single-column pieces honoring a season-long outstanding goaltending performance, every hockey goalie trophy includes free engraving personalized with player name, award title, team name, league or association, and season year.

Frequently Asked Questions About Hockey Goalie Trophies

What hockey programs and occasions use goalie trophies?

Hockey goalie trophies are used across every level of the sport where end of season recognition programs present position-specific awards alongside team and individual honors. Youth hockey associations presenting awards at end of season banquets use goalie trophies to recognize the best goaltender in each age division, giving young netminders a position-specific award that communicates the coach and program specifically valued their contribution rather than presenting a generic player award. Travel and AAA hockey programs use goalie trophies for most valuable goaltender, best goals against average, and most shutouts awards that reflect the statistical and performance standards that define elite goaltending at competitive levels. High school varsity programs present goalie trophies at athletic awards nights and team banquets alongside all-conference recognition and team MVP honors, with the goalie award carrying genuine prestige within programs where the starting goaltender position is among the most competitive on the roster. Adult recreational and beer league hockey programs use goalie trophies with the same enthusiasm as youth and competitive programs, since recreational goalies invest considerable time, equipment cost, and personal courage in a position that every recreational team desperately needs. Tournament goalie awards for best goaltender across a bracket are a popular addition to tournament award programs that already present trophies for champion and runner-up team finishes.

What engraving details work best for hockey goalie trophies?

Hockey goalie trophy engraving should capture the specific achievement and seasonal context so the award remains meaningful as a keepsake long after the season ends. Essential elements include player name, award title, team name, league or association, and season year. For example: Tyler Brennan, Most Valuable Goaltender, River City Rockets, Metro Youth Hockey Association, 2024-2025 Season, or Emma Walsh, Best Goalie Award, Lincoln High School Varsity Hockey, Winter 2025. Statistical achievements carry particular weight in goalie recognition and add powerful context when space allows, such as 1.4 Goals Against Average, 8 Shutouts or .934 Save Percentage, since these numbers tell the story of a goaltending performance far more completely than a title alone. Team record context is also meaningful on hockey goalie trophies since goaltender performance and team success are deeply connected, and noting a season record such as Team Record 22-4-2 or Championship Season alongside the individual award communicates the shared accomplishment behind the individual recognition. For tournament best goalie awards, noting the specific tournament name and bracket level alongside the award title distinguishes the recognition from a regular season award. When engraving plate size requires choices between elements, player name, award title, team, and season are the four essential pieces that make any goalie trophy a meaningful keepsake rather than a generic figurine.

How should hockey goalie trophies fit into a complete team award program?

Hockey goalie trophies work most effectively as part of a complete end of season award structure that recognizes every meaningful contribution to team success rather than focusing exclusively on scoring and offensive statistics. A well-designed hockey award program typically includes a team MVP award for the player who contributed most broadly across the full season, a top scorer or offensive MVP for leading offensive production, a best defensive player award for the skater who anchored the blue line, a best goalie or most valuable goaltender award for the netminder who kept the team in games, and a most improved player award for the skater who showed the greatest development from start to finish. Presenting a dedicated goalie trophy within this structure signals clearly to the entire team and their families that goaltending is valued as a distinct and essential contribution rather than an afterthought in the award program, which matters significantly for youth programs trying to develop and retain goalies in age divisions where willing netminders are always scarce. Programs with multiple goalies sharing time benefit from framing the award around season-long statistical performance rather than subjective most valuable language, since a goals against average or save percentage award is a more objective and less contentious recognition in situations where playing time was divided. See our complete collection of hockey trophies and awards for all available styles that complete a full team and individual hockey award program.

If you need more information before deciding, see our expert resource section:
]]>
Goalie (Hockey)
custom-pagequickshiptrophies-goat1trophies498551-310.452429Trophies1Find this popular Goat trophy discounted at TrophyCentral. Features a real marble base, stylish 4-inch gold cup, free engraving and fast shipping.goat-cup-place-trophycustom-pagequickshiptrophies-goat1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Fabulous Goat Figure trophy with choice of 1st, 2nd or 3rd place trim. Fast 1-2 day shipping and free engraving.qtgoatplcustom-pagequickshiptrophies-goat1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular Goat Figure year trim trophy discounted at trophyCentral. Available in multiple sizes and includes free personalization.qtgoatyrcustom-pagequickshiptrophies-goat1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with goat figure discounted at TrophyCentral. Includes free text engraving!cup-goat-pcustom-pagegoat-award1Nameplates1This is an additional perpetual plate for the GOAT Award, item 106575-va. Includes up to 3 lines of engraving. , Goatcustom-pagequickshiptrophies-goat1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these goat figure budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtgoatscbcustom-pagequickshiptrophies-goat1498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Find this budget goat award trophy discounted at Trophy Central. Features a real marble base and plastic goat figure. Engraving is free. Fast 1-2 day shipping.bdg-goatcustom-pagequickshiptrophies-goat1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:26%Find these fabulous two-tier Goat Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtgoatttcustom-pagequickshiptrophies-goat1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.751434.75Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:28%See this championship trophy with a Goat figure at TrophyCentral. Be sure to see all of our Goat figure awards.qtgoatttwcustom-pagequickshiptrophies-goat1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:21%,100:24%These popular Goat Figure Elite Series Trophies feature a choice of column size and color, a white marble base and free trophy personalization!custom-pagequickshiptrophies-goat1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.05Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%Find These Popular Goat Figure Deluxe Platform Series Trophies Discounted at TrophyCentral. Real Marble Base. Free Personalization!custom-pagequickshiptrophies-goat1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Goat Figure figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-goat-scbcustom-pagequickshiptrophies-goat1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.41226Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:18%,10:23%Find these fabulous Champions Line 3-Column Goat Trophies discounted at TrophyCentral. Free personalization and fast 1-2 day shipping!qtgoat3ccustom-pagequickshiptrophies-goat1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:27%,100:32%Our popular Goat Figure participation trophies feature a real slant-front marble base and free engraving.qtgoatnccustom-pagequickshiptrophies-goat1trophies498551-310.452429Trophies1Find our Goat star column trophy discounted at TrophyCentral. Features a real marble base, 6 inch gold star-shaped column, free engraving and fast shipping.goat-star-column-trophycustom-pageaward-medalsqtgoatncqtgoatdmqtgoatplqtgoatyrqtgoatttqtgoatttwqtgoat3cqtgoatscmqtgoatscbcup-goat-pcup-goat-scbbdg-goatgoat-cup-place-trophygoat-cup-place-column-trophygoat-star-column-trophy1trophies-livestock-farm-animals1

Quick-Ship GOAT Trophies: Fun Meets Function

Need a trophy in a hurry? Our Quick-Ship GOAT collection delivers the perfect award for any celebration. Whether you're honoring the "Greatest of All Time" in sports, academics, or the office, or showcasing livestock champions at county fairs and 4-H events, these trophies make a bold, memorable statement.

Each award arrives ready for engraving, with three free lines included, and ships rapidly so you're always prepared for ceremonies. Choose from budget-friendly columns, stylish two-tier designs, championship trophies, and more - each crafted to celebrate excellence with humor and prestige.

From playful recognition to serious livestock competition, our GOAT trophies combine speed, customization, and standout design. Let TrophyCentral help you honor champions - both the Greatest of All Time and the greatest in the pen - with a trophy that's as unforgettable as the moment.

Be sure to see our fun trophy and engraving guides: ]]>
place-trophiesGoat
custom-pagesports-pinsplasticpinboxvelapinbox151-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
lapel pins105502-30.31150030.3Classic MedallicsLapel PinsSports, Hobby, Org, Livestock1:30%,50:36%,100:39%,500:42%,1000:48%"Baseball Pins" "Baseball Lapel Pins" "Soccer Pins" "Soccer Lapel Pins" "Football Pins" "Football Lapel Pins" "Basketball Pins" "Basketball Lapel Pins"Find this fabulous "Captain" letter pin at TrophyCentralcl4712-18-2009Sports
custom-pagesports-pinsplasticpinboxvelapinbox151-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
lapel pins105502-30.31150030.3Classic MedallicsLapel PinsSports, Hobby, Org, Livestock1:30%,50:36%,100:39%,500:42%,1000:48%"Baseball Pins" "Baseball Lapel Pins" "Soccer Pins" "Soccer Lapel Pins" "Football Pins" "Football Lapel Pins" "Basketball Pins" "Basketball Lapel Pins" "Coach Pins"Find this fabulous "Coach" letter pin at TrophyCentralcl87Coach, Sports
custom-pagegold-pins-lapelplasticpinboxvelapinbox151-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
lapel pins105502-30.31 2 3 4 5 6 7 8 91150030.3Classic MedallicsLapel PinsSports, Hobby, Org, Livestock1:30%,50:36%,100:39%,500:42%,1000:48%Find this fabulous #1 Gold letter pin at TrophyCentralcl119See more:lapel-award-pins12-20-2020General
custom-pageservicepins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:22%,50:30%,100:35%,500:48%"School Pins" "School Lapel Pins"Find these Gold Service HP Series Pins Discounted at TrophyCentral. Fast 1-2 Days Shipping. Buy in Bulk and Save!hp21Business, Generalcustom-pagewalnut-insert-plaques1"3-6 business days with engraving, Without engraving: 1-3 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"plaques105503-610.4511222.05Classic MedallicsPlaquesInsert1:22%,3:23%,5:24%Genuine Walnut Gold Achievement Torch Plaque with 2 Inch Insert and Free Engraving.70-7028Generalcustom-pageiabas151-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
"PT1=105502-30.3150030.3Classic MedallicsLapel PinsSports, Hobby, Org, Livestock1:30%,50:36%,100:39%,500:42%,1000:48%"Baseball Pins" "Baseball Lapel Pins" "Soccer Pins" "Soccer Lapel Pins" "Football Pins" "Football Lapel Pins" "Basketball Pins" "Basketball Lapel Pins"Find this fabulous All Stars letter pin and other Gold Award Pins at Top-Rated TrophyCentral.cl6112-20-2040Sports
custom-pagetrophies-baseballplasticpinboxvelapinbox151-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
lapel pins105502-30.31150030.3Classic MedallicsLapel PinsSports, Hobby, Org, Livestock1:30%,50:36%,100:39%,500:42%,1000:48%"Baseball Awards" "Baseball Pins" "Baseball Lapel Pins"Gold Baseball Pins. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.cl02Baseball / T-Ball, Sports
custom-pagetrophies-basketballplasticpinboxvelapinbox151-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
lapel pins105502-30.31150030.3Classic MedallicsLapel PinsSports, Hobby, Org, Livestock1:30%,50:36%,100:39%,500:42%,1000:48%Gold Basketball-Shaped Pin. Ideal for leagues, schools, and tournaments. Fast shipping.cl04Basketball, Sports
custom-pagetrophies-bowling12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-31130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Gold Bowling (506651) Inserts Medal Inserts (Litho) at TrophyCentral. Each Gold Bowling (506651) Inserts Medal Insert can be used to create a unique plaque, medal or trophy.506651Bowling
custom-pagegold-pins-lapelplasticpinboxvelapinbox151-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
lapel pins105502-30.31150030.3Classic MedallicsLapel PinsSports, Hobby, Org, Livestock1:30%,50:36%,100:39%,500:42%,1000:48%"Bowling Awards" "Bowling Pins"Find this fabulous Bowling letter pin and other great gold pins discounted at TrophyCentral.cl0504-05-2010Bowling
1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"290631-330181Find gold certificate seals discounted at TrophyCentral. Each gold seal features a pressure back for easy attachment to your certificates. 1certificates-seals-allGeneralcustom-pagegold-pins-lapelplasticpinboxvelapinbox151-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
lapel pins105502-30.31150030.3Classic MedallicsLapel PinsSports, Hobby, Org, Livestock1:30%,50:36%,100:39%,500:42%,1000:48%"Lacrosse Awards" "Baseball Pins" "Baseball Lapel Pins" "Soccer Pins" "Soccer Lapel Pins" "Football Pins" "Football Lapel Pins" "Basketball Pins" "Basketball Lapel Pins"Find this fabulous Champs letter pin at TrophyCentralcl48Sports
custom-pagetrophies-cheerleading-spiritplasticpinboxvelapinbox151-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
lapel pins105502-30.31150030.3Classic MedallicsLapel PinsSports, Hobby, Org, Livestock1:30%,50:36%,100:39%,500:42%,1000:48%"Cheerleading Awards" "Cheeleading Pins" "Cheer Pins" "Cheerleader Pins" "Cheerleading Lapel Pins"Find this fabulous Cheerleader letter pin at TrophyCentralcl107Cheerleading, Sports
custom-pagesports-pinsplasticpinboxvelapinbox151-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
lapel pins105502-30.31150030.3Classic MedallicsLapel PinsSports, Hobby, Org, Livestock1:30%,50:36%,100:39%,500:42%,1000:48%"Baseball Pins" "Baseball Lapel Pins" "Soccer Pins" "Soccer Lapel Pins" "Football Pins" "Football Lapel Pins" "Basketball Pins" "Basketball Lapel Pins"Find this fabulous MVP letter pin and other fabulous award pins at TrophyCentral.cl95Sports
custom-pagetrophies-cheerleading-spiritplasticpinboxvelapinbox151-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
lapel pins105502-30.31150030.3Classic MedallicsLapel PinsSports, Hobby, Org, Livestock1:30%,50:36%,100:39%,500:42%,1000:48%"Cheerleading Awards" "Cheeleading Pins" "Cheer Pins" "Cheerleader Pins" "Cheerleading Lapel Pins"Find this fabulous Megaphone letter pin and other sports award pins discounted at TrophyCentral.cl26Cheerleading, Sports
custom-pagetrophies-track-fieldplasticpinboxvelapinbox151-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
lapel pins105502-31.41150031.4Classic MedallicsLapel PinsSports, Hobby, Org, Livestock1:30%,50:36%,100:39%,500:42%,1000:48%"Track Awards" "Cross Country Awards" "Track Pins" "Track Lapel Pins"Find this fabulous Track Shoe pin discounted at TrophyCentral. Lapel pins ship in a fast 1-2 days!cl4207-30-2012
custom-pagetrophies-track-fieldplasticpinboxvelapinbox151-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
lapel pins105502-30.31150030.3Classic MedallicsLapel PinsSports, Hobby, Org, Livestock1:30%,50:36%,100:39%,500:42%,1000:48%"Cross Country Awards" "Track Pins"Find this fabulous Cross Country letter pin at TrophyCentralcl12
custom-pagetrophies-baseballplasticpinboxvelapinbox151-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
lapel pins105502-30.31150030.3Classic MedallicsLapel PinsSports, Hobby, Org, Livestock1:30%,50:36%,100:39%,500:42%,1000:48%"Baseball Pins" "Baseball Lapel Pins"Crossed Bats Baseball Pins. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.cl0306-30-2012Baseball / T-Ball, Sports
custom-pageribbons1-crowns1"1-3 business days" "Topeka, Indiana" "UPS (Post Office Priority Mail also available)"465711-21 261.5413.5Tower RibbonSpiritCrowns1:22%Find this gold crown discounted at TrophyCentral. Perfect for the king of the parade or homecoming. Ships in just 1-2 days.c80201-11-2017custom-pagewalnut-insert-plaques1"3-6 business days with engraving, Without engraving: 1-3 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"plaques105503-610.4511222.05Classic MedallicsPlaquesInsert1:22%,3:23%,5:24%"School Awards" "School Products" "Culinary Arts Awards" "Cooking Awards" "Culinary Arts (Cooking) Awards"Genuine Walnut Gold Culinary Arts (Cooking) Plaque with 2 Inch Insert and Free Engraving.50-1654Cooking / Culinarycustom-pagetrophies-danceplasticpinboxvelapinbox151-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
lapel pins105502-30.31150030.3Classic MedallicsLapel PinsMusic, Drama, Art, Dance1:30%,50:36%,100:39%,500:42%,1000:48%"Dance Awards" "Dance Pins" "Dance Lapel Pins"Find this fabulous Dance Slippers letter pin at TrophyCentralcl3606-12-2011Dance
custom-pagetrophies-dramaplasticpinboxvelapinbox151-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
lapel pins105502-30.31150030.3Classic MedallicsLapel PinsMusic, Drama, Art, Dance1:30%,50:36%,100:39%,500:42%,1000:48%"Drama Awards" "Drama Medals and Lapel Pins"Find this fabulous Drama Mask letter pin and other drama awards - all discounted - at TrophyCentral.cl13Drama
custom-pagemusicartpins1plasticpinboxvelapinbox1"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsMusic, Drama, Art, Dance1:22%,50:30%,100:40%,500:46%"Music Lapel Pins" "Band Lapel Pins" "Band Awards" "School Pins"Find these Choir Award pins discounted at TrophyCentral. Each Choir Award pin features a clutch-back and fast 1-2 day shipping.br57506-01-2018Music / Band / Choruscustom-pagesports-pinsplasticpinboxvelapinbox151-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
lapel pins105502-30.31150030.3Classic MedallicsLapel PinsSports, Hobby, Org, Livestock1:30%,50:36%,100:39%,500:42%,1000:48%"Baseball Pins" "Baseball Lapel Pins" "Soccer Pins" "Soccer Lapel Pins" "Football Pins" "Football Lapel Pins" "Basketball Pins" "Basketball Lapel Pins"Find this fabulous Manager letter pin and other gold lapel pins at TrophyCentral.cl5111-21-2008Sports
custom-pagegold-pins-lapelplasticpinboxvelapinbox151-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
lapel pins105502-30.31150030.3Classic MedallicsLapel PinsSports, Hobby, Org, Livestock1:30%,50:36%,100:39%,500:42%,1000:48%"Hockey Awards" "Hockey Pins" "Hockey Lapel Pins"Find this fabulous Field Hockey Jacket letter pin at TrophyCentralcl1611-21-2008Field Hockey, Sports
custom-pagetrophies-footballplasticpinboxvelapinbox151-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
lapel pins105502-30.31150030.3Classic MedallicsLapel PinsSports, Hobby, Org, Livestock1:30%,50:36%,100:39%,500:42%,1000:48%"Football Pins" "Football Lapel Pins"cl0712-14-2009Football, Sports
custom-pagedebate-trophiesplasticpinboxvelapinbox151-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
lapel pins105502-30.31150030.3Classic MedallicsLapel PinsGeneral1:30%,50:36%,100:39%,500:42%,1000:48%"School Pins" "School Lapel Pins"Find this fabulous Gavel letter pin and other gold lapel pins at TrophyCentral.cl17Gavel
custom-pagetrophies-golfplasticpinboxvelapinbox151-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
lapel pins105502-30.31150030.3Classic MedallicsLapel PinsSports, Hobby, Org, Livestock1:30%,50:36%,100:39%,500:42%,1000:48%"Golf Awards" "Golf Pins"Golf Bag Lapel and Letter Pins - Gold. Ideal for leagues, schools, and tournaments. Fast shipping.cl18Golf, Sports
custom-pagetrophies-gymnasticsplasticpinboxvelapinbox151-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
lapel pins105502-30.31150030.3Classic MedallicsLapel PinsSports, Hobby, Org, Livestock1:30%,50:36%,100:39%,500:42%,1000:48%"Gymnastics Awards" "Gymnastics Pins" "Gymnastics Lapel Pins"Find this fabulous Female Gymnast letter pin and other Gold Award Pins at Top-Rated TrophyCentral.cl20Gymnastics, Sports
1"2-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)""PT5=Miscellaneous"105503-610.3150030.3Classic Medallics1:22%,10:32%,100:45%,500:51%1custom-pagetrophies-track-fieldplasticpinboxvelapinbox151-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
lapel pins105502-30.31150030.3Classic MedallicsLapel PinsSports, Hobby, Org, Livestock1:30%,50:36%,100:39%,500:42%,1000:48%"Baseball Pins" "Basketball Pins" "Football Pins" "Soccer Pins" "Volleyball Pins" "Swimming Pins" "Track Pins"cl5006-30-2017Sports
custom-pagegavelplaques1crkeytoci key-insert-plaque"4-7 business days with engraving, 2-3 without" "Mt. Vernon, New York" "UPS (FedEx available on request)"plaques105503-610.417265.2Plaques1"Engraving"Find this Key to the City discounted at TrophyCentral. This gold Key to the City features a beautiful finish and free engraving.Key, Key to the City, Gold Keycustom-pagegold-pins-lapelplasticpinboxvelapinbox151-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
lapel pins105502-30.31150030.3Classic MedallicsLapel PinsSports, Hobby, Org, Livestock1:30%,50:36%,100:39%,500:42%,1000:48%"Lacrosse Awards" "Lacrosse Pins"Find this fabulous Lacrosse letter pin at TrophyCentralcl2506-25-2016Lacrosse, Sports
custom-pagegold-pins-lapelplasticpinboxvelapinbox151-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:30%,50:36%,100:39%,500:42%,1000:48%"School Pins" "School Lapel Pins"Find this fabulous Lamp Of Learning letter pin at TrophyCentralcl23General, Academic
custom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceSealsEmbosser Seals1:22%,3:28%,5:31%Find these Lamp of Learning Embossed Certificate Seals Discounted at TrophyCentral.803Generalcustom-pagelapel-award-pinscl119br22711"Homecoming Sashes" "Sashes" "Homecoming Sash" "School Sashes" "Pageant Sashes" "Custom Sashes" "Beauty Pageant Sashes" "Graduation Sashes" "Pageant Sash" "Prom Sashes" "Prom Sash" "Lapel Pins" "Trading Pins" "Lapel Trading Pins" "High School Awards" "Awards For School" "Elementary School Awards" "Middle School Awards" "School Academic Awards" "Awards For Elementary School" "Awards for Middle School" "Awards for High School" "End of School Year Awards" "High School Academic Awards" "High School Awards Ceremony"Find gold pins discounted at TrophyCentral. Gold lapel pins ship in just 1-2 business days. Be sure to see our bulk pricing.

Gold Lapel Pins - Small Recognition, Big Impact

Gold lapel pins deliver instant wearable recognition perfect for students earning letter jacket privileges, athletes celebrating championship seasons, employees marking years of service, volunteers deserving daily appreciation, and anyone whose achievements merit something more permanent than verbal praise but less formal than framed certificates. These affordable pins transform ordinary jackets, caps, and shirts into personal trophy cases where accomplishments accumulate visibly over time, creating walking resumes of dedication. Featuring high-quality gold finishes that actually look impressive rather than suspiciously plasticky, secure clutch-pin backs preventing embarrassing losses during important moments, and extensive subject variety spanning academics, athletics, leadership roles, and specialized achievements, gold lapel pins suit schools distributing hundreds annually, organizations recognizing volunteers, businesses marking milestones, and competitions awarding immediate on-site recognition. Available across countless designs including sport-specific imagery for every conceivable athletic activity, academic symbols from lamps of knowledge to discipline-specific icons, leadership designations like Captain and Coach, service bars accumulating to document tenure, and custom options for organizations needing unique branding. Perfect for letterman and letterwomen jacket decoration, employee recognition programs, volunteer appreciation, perfect attendance rewards, or any achievement deserving tangible acknowledgment without trophy case requirements.

Expand your recognition program: Explore All Lapel Pins style="color: #1976d2 !important; text-decoration: underline !important; font-weight: 600 !important;">Explore Sports Pins for specialized recognition. Learn more: History and Significance of Lapel Pins.

Frequently Asked Questions About Gold Lapel Pins

How do schools determine which achievements earn gold lapel pins versus other recognition?

Successful pin programs establish clear criteria preventing confusion and ensuring fairness across recognition tiers. Gold lapel pins typically reward specific measurable achievements including varsity letter qualifications through athletic participation or performance thresholds, academic honors like honor roll placement or subject excellence, leadership positions including team captains and student council officers, special achievements such as perfect attendance or competition victories, and milestone accomplishments like years of service or program completion. Schools often create hierarchies using gold for first-tier achievements, silver for secondary recognition, and bronze for participation, though some programs reserve gold exclusively for premium accomplishments making pins more prestigious. Service bars accumulate over multiple years allowing students to display progression visibly. Clear published criteria prevent the awkward situation where some students sport jacket collections resembling military generals while others wonder why their equally impressive achievements went unrecognized, maintaining program credibility and perceived value.

Can gold lapel pins be worn on clothing other than letter jackets?

Gold lapel pins attach securely to any fabric thick enough to support the clutch-pin back, making them versatile beyond traditional letter jacket applications. Students wear pins on backpacks, baseball caps, uniform shirts, choir robes, graduation gowns, and even instrument cases creating mobile displays of achievement wherever they go. Professional settings embrace lapel pins on suit jackets, blazers, name tag lanyards, conference badges, and uniforms where visible recognition matters. Volunteers display service pins on vests, aprons, polo shirts, and casual attire during organizational activities. The key is ensuring fabric thickness prevents pins pulling through material and that placement remains visible without appearing cluttered. Multiple pins benefit from strategic arrangement rather than random clustering, with sports pins grouped together, academic achievements in another section, and leadership designations prominently placed. Some recipients collect pins on display boards at home after accumulating more than clothing reasonably accommodates, transforming collections into permanent achievement records rather than wearing all simultaneously.

How long do gold lapel pins typically last before showing wear?

Quality gold lapel pins maintain appearance through years of regular wear when properly cared for, though longevity depends on usage intensity and storage practices. Pins worn daily on items experiencing frequent washing, physical activity, or environmental exposure show wear faster than those reserved for special occasions or rotated seasonally. Gold finish resists tarnishing better than cheaper metallic coatings but eventually dulls from repeated handling and contact with other surfaces. Protecting pins during clothing laundering by removing them beforehand prevents damage from washing machines and harsh detergents. Storing pins in protective cases or pin boards when not displayed prevents scratching and preserves finish quality. Clutch backs occasionally loosen over time requiring replacement to maintain secure attachment, though quality pins feature durable backing mechanisms lasting years. Most recipients treasure gold lapel pins as keepsakes long after active wear, displaying collections on memory boards or shadow boxes preserving achievements indefinitely beyond their original functional purpose as wearable recognition.

If you need more information before deciding, see our expert resource section:
]]>
custom-pagemusicartpins1plasticpinboxvelapinbox151-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
lapel pins105502-30.31150030.3Classic MedallicsLapel PinsMusic, Drama, Art, Dance1:30%,50:36%,100:39%,500:42%,1000:48%"Music Lapel Pins" "Band Lapel Pins" "Band Awards" "School Pins"Find this fabulous Band letter pin and other great music pins at TrophyCentral.cl4605-24-2013Music / Band / Chorus
custom-page1st-place-medals1st-mg2nd-ms3rd-mbacademic-mgbaseball-mgbasketball-mgcheer-mgfootball-mggolf-mgpickleball-mgreading-mgscience-mgsoccer-mgspelling-mgswimming-mgtennis-mgtorch-mgtrack-mgvolleyball-mg1award-medals1Find gold medals discounted at TrophyCentral. Each gold medal measures 2 1/4" and includes a neck ribbon. Fast 1-2 day shipping.1

Gold Award Medals - The Highest Honor for Sports, Academics, and Achievement

Gold medals have represented the pinnacle of human achievement for centuries, from ancient Olympic competitions to today's youth sports tournaments, academic championships, and community recognition events. TrophyCentral's exclusive gold award medals carry that same symbolism in an affordable, customizable format designed for leagues, schools, and organizations recognizing their own champions. Each antique gold medal measures 2-1/4 inches, includes a free neck ribbon, and is available in sport-specific designs spanning football, soccer, baseball, basketball, swimming, track and field, golf, tennis, and more, plus academic disciplines including spelling, reading, science, and academic excellence. Optional engraving on the back personalizes each medal with a recipient name, event title, and date, transforming a stock award into a lasting keepsake. Volume pricing makes gold medals practical for large tournaments and field days where every first-place finisher deserves the recognition their performance earned.

Frequently Asked Questions About Gold Medals

What are award gold medals made of, and how do they differ from Olympic gold medals?

Award gold medals are die-cast zinc alloy medals finished with gold-tone plating, producing the rich antique gold appearance associated with first-place recognition at a cost appropriate for tournaments, schools, and leagues ordering in volume. Olympic gold medals are a different category entirely: the International Olympic Committee requires them to be made from at least 92.5% silver with a minimum of 6 grams of gold plating, making each one a significant precious metal item produced specifically for the Games and never available for general purchase. Award medals used in youth sports, academic competitions, community events, and corporate recognition programs are purpose-built for practical recognition programs, designed to be durable, attractive, and affordable enough to present to every worthy recipient. The symbolic meaning of gold as the highest honor translates completely across both contexts, which is why a gold medal presented at a local swim meet or spelling bee carries the same motivational impact for a young athlete or student as the international version does for elite competitors.

When should I choose gold medals over trophies for a recognition event?

Gold medals are the practical choice for events where recipients receive their awards immediately after competing rather than at a separate banquet, where large numbers of first-place finishers across multiple age divisions or events need to be recognized within a budget, or where portability matters since medals are easy for participants to take home without carrying a box. Track meets, swim meets, field days, spelling bees, and multi-bracket tournaments all suit medals well because the neck ribbon allows immediate, ceremonial presentation on the spot. Trophies are the stronger choice when a formal banquet setting allows for presentation, when the award will be displayed on a shelf or desk rather than worn, when the visual impact of a standing award reinforces a championship accomplishment, or when the recipient is a team rather than an individual. Many programs combine both formats, awarding gold medals to all first-place finishers across divisions while reserving larger championship trophies for overall tournament winners, using each format where it performs best.

What should be engraved on a gold medal?

Gold medal engraving appears on the back of the medal and works best when kept concise given the limited surface area. For sports events, include the recipient name, place finish or award title, event or tournament name, and year, for example: Jordan Rivera, 1st Place, 100 Meter Dash, Metro Track Classic 2025. For academic awards, the subject and school add helpful context: Maya Chen, Spelling Champion, Lincoln Elementary, Spring 2025. General achievement medals benefit from the award category: Outstanding Volunteer, Community Service Award, 2025. When space allows, adding the division or age group helps recipients remember exactly what they won years later. For large tournaments where engraving every medal is impractical due to time constraints, the sport-specific design on the front of the medal already communicates the achievement clearly, and a simple year or event name on the back provides enough context. Orders with engraving ship within the standard processing window, making it practical to personalize gold medals for planned events without significantly extending lead time.

If you need more information before deciding, see our expert resource section:
]]>
custom-pagemusicartpins1plasticpinboxvelapinbox151-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
lapel pins105502-30.31150030.3Classic MedallicsLapel PinsMusic, Drama, Art, Dance1:30%,50:36%,100:39%,500:42%,1000:48%"Music Lapel Pins" "Band Lapel Pins" "Band Awards" "School Pins"Find this fabulous Music Clef Lapel letter pin at TrophyCentralcl27Music / Band / Chorus
custom-pagetagsbadges5"4-7 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"105503-60.361100030.36Name Badges1:22%Find gold name badges discounted at TrophyCentral. Each gold badge features black lettering and is made of plastic. Fast shipping.custom-pageschool-pins1"1-2 business days" "Columbia, SC"lapel pins292121-31 2 3 230.4150030.4Certificate SourceLapel PinsAcademic1:22%,50:28%,100:32%,500:36%"Honor Roll" "Honor Roll Pins" "Honor Roll Trophies" "School Pins"Find Gold School Pins Discounted At TrophyCentral. Gold School And Student Pins Ship In Just 1 Business Day. Large Quantity Discounts andSee more:lapel-award-pinsGeneralcustom-pagetrophies-soccerplasticpinboxvelapinbox151-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
lapel pins105502-30.31150030.3Classic MedallicsLapel PinsSports, Hobby, Org, Livestock1:30%,50:36%,100:39%,500:42%,1000:48%"Soccer Lapel Pins" "Soccer Pins"Soccer Ball Letter Pins. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.cl08Soccer, Sports
custom-pagetrophies-softballplasticpinboxvelapinbox151-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
lapel pins105502-30.31150030.3Classic MedallicsLapel PinsSports, Hobby, Org, Livestock1:30%,50:36%,100:39%,500:42%,1000:48%"Softball Awards" "Softball Pins" "Softball Lapel Pins"Find this fabulous Softball letter pin and other Softball Lapel Pins Discounted at TrophyCentral.cl0905-16-2011Softball, Sports
custom-pagemedallion-inserts-motivational--recognition--sales12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsGeneral1:22%Buy these high-quality Gold Star Award Inserts at TrophyCentral. Each Gold Star Award Insert can be used to create a unique plaque, medal or trophy.518601General, Star
custom-pagestar-pinsplastic-pinbox-t10star-pinslapel pins498552-30.3102300020TCLapel Pins11:22%,100:38%,250:42%,500:52%,1000:59%Find This Gold Star Lapel Pin Discounted At TrophyCentral! Each Gold Star Pin Includes A Clutch-Back For Easy Attachment to Clothing. Available in Two Sizes. Large Quantity Discounts.Gold Star Lapel Pin | TrophyCentralGold Star Lapel Pin | TrophyCentralReturn to oursection for more great choices!star-pinscustom-pagestar-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsGeneral1:30%,50:34%,100:38%"Star Pins" "Star Lapel Pins" "Star Award Pins"Find this Gold Star With Wreath Pin discounted at TrophyCentral. This popular lapel pin features a gold finish and measures 7/8".br476gStar, Generalcustom-page1st-place-medals11-2 business days
With engraving:
1-3 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105502-30.371 3 4 5 6 7 8 930042.37Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,25:24%Find these gold torch medals discounted at Trophy Central. Optional engraving. Fast 1-2 day shipping.Torch, 1st / 2nd / 3rd / Etc.
custom-pagetrophies-track-fieldplasticpinboxvelapinbox151-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
lapel pins105502-30.31150030.3Classic MedallicsLapel PinsSports, Hobby, Org, Livestock1:30%,50:36%,100:39%,500:42%,1000:48%"Track Awards" "Cross Country Awards" "Track Pins" "Track Lapel Pins"Find this fabulous Track Winged Foot letter pin and other Track Pins Discounted at TrophyCentral.cl41
custom-pagetrophies-volleyballplasticpinboxvelapinbox15ec05 cl144 j95881-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
lapel pins105502-30.31150030.3Classic MedallicsLapel PinsSports, Hobby, Org, Livestock1:30%,50:36%,100:39%,500:42%,1000:48%"Volleyball Pins" "Volleyball Lapel Pins"Find this fabulous Volleyball Letter Pin and other Volleyball Pins at TrophyCentral.cl10Volleyball, Sports
custom-pagegold-pins-lapel151-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
"PT1=105502-30.31150030.3Classic MedallicsLapel PinsSports, Hobby, Org, Livestock1:30%,50:36%,100:39%,500:42%,1000:48%"Track Awards" "Cross Country Awards" "Track Pins" "Track Lapel Pins"Find this fabulous Winged Foot Torch letter pin at TrophyCentralcl12212-20-2020
custom-pagecustommedalswhitcarboarbvelourbox50"5-7 business days" "Mt. Vernon, NY" "UPS"medals105503-610.45115024.45Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,100:33%,300:41%"Wrestling Medals"Find these fabulous Gold Wrestling Medals discounted at TrophyCentral. Price includes the name of your school or organization imprinted on the front of the medal!m162gWrestling, Sportscustom-pagegold-pins-lapelplasticpinboxvelapinbox151-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
lapel pins105502-30.31150030.3Classic MedallicsLapel PinsSports, Hobby, Org, Livestock1:30%,50:36%,100:39%,500:42%,1000:48%"Wrestling Awards" "Wrestling Pins" "Wrestling Lapel Pins"Find this fabulous Wrestling letter pin at TrophyCentralcl14012-18-2009Wrestling, SportsWrestling
11Find a great selection of gold, silver and bronze medals - all discounted - at TrophyCentral! Each medal includes a neck ribbon!custom-pagehonorrollpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:30%,50:32%,100:35%,500:39%"Honor Roll" "Honor Roll Pins" "Honor Roll Trophies" "School Pins"Find this Gold-Finish Honor Student BR Series Lapel Pin at TrophyCentral. Features Clutch-Pin Back For Easy Attachment to Clothing. Fast 1-2 Day Shipping.br317Honor Roll, Academiccustom-pagesports-inserts1105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Golden Glove Baseball Litho Medal Insert. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.507464Baseball / T-Ball, Sportscustom-pagetrophies-golf12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Golf Medals"Golf "18th Hole" Litho Medal Insert. Ideal for leagues, schools, and tournaments. Fast shipping.493011Golf, Sports
custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Golf Medals"Golf (GENERAL) Litho Medal Insert. Ideal for leagues, schools, and tournaments. Fast shipping.506671Golf, Sports
custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Golf Medals"Golf (Male) (502080) Medal Insert. Ideal for leagues, schools, and tournaments. Fast shipping.502080Golf, Sports
custom-pagetrophies-golf1trophies498551-310.452429Trophies1Find this popular Golf trophy discounted at TrophyCentral. Features a real marble base, stylish 4-inch gold cup, free engraving and fast shipping.golf-cup-place-trophycustom-pagetrophies-golf1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)""PT1=Trophies" "PC12=498552-310.451622.85TrophyCentralTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Golf trophy with place trim (1st, 2nd, 3rd). Ideal for leagues, schools, and tournaments. Fast shipping. Free engraving.qtgolfplGolf, 1st / 2nd / 3rd / Etc., Sportscustom-pagetrophies-golf20498552-40.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Golf Epoxy Decal (2"). Ideal for leagues, schools, and tournaments. Fast shipping.Golf, Sportscustom-pagetrophies-golf1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%trophy with Year Indicator - Golf. Ideal for leagues, schools, and tournaments. Fast shipping.qtgolfyrGolf, Sportscustom-pagetrophies-golf1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Achievement Cup Trophy - Golf. Ideal for leagues, schools, and tournaments. Fast shipping.cup-golf-pGolf, Sportscustom-pagetrophies-golf1medals498552-30.525033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this Golf Swing 2 1/4" Antique Gold Medal Discounted at TrophyCentral. Each medal features a free ribbon. Fast shipping!Golf, Sportscustom-pagetrophies-golf12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
"PT1=Medals" "PC12=105503-60.75130033.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,100:28%,500:34%,1000:45%"Golf Awards" "Award Medals - All Subjects" "Sports Medals" "Golf Medals" "Golf Medals"Golf Award Medal (1 1/4"). Ideal for leagues, schools, and tournaments. Fast shipping.golfmedals1Golf, Sports
11Complete guide to golf awards, tournament recognition, and trophy selection. Learn about golf award categories, tournament organization, and how to celebrate achievements from amateur to professional levels. custom-pagegolfballdisplay11"3-5 business days" "Tamarac, FL" "UPS (FedEx available on request)"display case333213-51 3 22 230.45121.45Case WorksDisplay Cases11:14%"Sports Display Case" "Sports Displays" "Sports Display" "Sports Display Cases" "Sport Display Cases" "Acrylic Sports Display" "Acrylics Displays" "Acrylic Display Cases" "Sports Ball Holder" "Sports Ball Holders" "Golf Ball Display" "Golf Ball Display Case" "Golf Ball Display Case" "Golf Ball Display Cases"Golf Ball Cabinet Display. Ideal for leagues, schools, and tournaments. Fast shipping.12-20-2020Golf, Sportscustom-pagenoname11wallmountgolfgolfdisplaygobacadi11Golf Ball Display Cases. Ideal for leagues, schools, and tournaments. Fast shipping.

Shop for Golf & Sports Display Cases with Confidence at TrophyCentral

We offer a huge selection, discounted prices and fabulous customer service. Do you need help with some ideas or with ordering? Yes, we sell online, but we have real people who would love to help you! Feel free to call our experts in Michigan, New York and online. TrophyCentral - delivering smiles since 1999!


]]>
custom-pagegifts-desk-general1105503-610.451810.85Gifts1"Golf Awards" "Executive Gifts" "Father's Day Gifts" "Hole-in-One Awards"Golf Ball Gift Box with Engraving Plate. Ideal for leagues, schools, and tournaments. Fast shipping.Golf, Sportscustom-pagetrophies-golf1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%2 3/4" T-Series Medal with Bronze Frame: Golf. Ideal for leagues, schools, and tournaments. Fast shipping.Golf, Sportscustom-pagetrophies-golf1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Single Column Budget Trophy - Golf. Ideal for leagues, schools, and tournaments. Fast shipping.mqtgolfscbGolf, Sportscustom-pagetrophies-golf1498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Budget Award Trophy - Golf. Ideal for leagues, schools, and tournaments. Fast shipping.bdg-golfGolf, Sportscustom-pagetrophies-golf1trophies498552-411229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Champion's Cup - Golf. Ideal for leagues, schools, and tournaments. Fast shipping.Champion's Cup - GolfGolf, Sportscustom-pagetrophies-golf1trophies498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Champion's Trophy with Golf Insert. Ideal for leagues, schools, and tournaments. Fast shipping.Champion's-Trophy-with-Golf-InsertGolf, Sportscustom-pagetrophies-golf1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Quick-Ship Two-Tier Trophy with Golf Figure. Ideal for leagues, schools, and tournaments. Fast shipping.qtgolfttGolf, Sportscustom-pagetrophies-golf1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.2115Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%Two-Tier Championship Trophy w/ Wood Base - Golf. Ideal for leagues, schools, and tournaments. Fast shipping.qtgolfttwGolf, Sportscustom-pagetrophies-golf1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Single Column Insert Trophy - Golf. Ideal for leagues, schools, and tournaments. Fast shipping.Single Column Insert Trophy - GolfGolf, Sportscustom-pagetrophies-golf1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%Single Column Trophy - Golf. Ideal for leagues, schools, and tournaments. Fast shipping.qtgolfscSee our other populartrophies-golfGolf, Sportscustom-pagetrophies-golf1trophies498551-311821.06TrophyCentralTrophies1Golf, Sportscustom-pagename-badges-tagswoyoulipr100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoName Badges1Golf Custom Badge. Ideal for leagues, schools, and tournaments. Fast shipping.namebadges-golfcustom-pagetrophies-golf1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451623.65Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%Double Platform Trophy in 3 Sizes - Golf. Ideal for leagues, schools, and tournaments. Fast shipping.qtgolfdmGolf, Sportscustom-pagetrophies-golf1"3-6 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"trophies105503-610.611815Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,3:22%"Golf Awards"Golf, Sportscustom-pagetrophies-golf1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Single Column Cup Trophy - Golf. Ideal for leagues, schools, and tournaments. Fast shipping.cup-golf-scbGolf, Sportscustom-pagetrophies-golf1trophies498551-310.71217.38Trophies1Golf, Sportscustom-pagetrophies-golf1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%2 3/4" T-Series Medal with Gold Frame: Golf. Ideal for leagues, schools, and tournaments. Fast shipping.Golf, Sportscustom-pagetrophies-golf1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.4118Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Quick-Ship Two-Tier 3-Column Trophy - Golf. Ideal for leagues, schools, and tournaments. Fast shipping.qtgolf3cGolf, Sportscustom-pagetrophies-golf1medals498552-30.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Golf Insert Medal. Ideal for leagues, schools, and tournaments. Fast shipping.Golf, Sportscustom-pagetrophies-golf1medals498552-40.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Golf Insert Medal with Personalized Rim. Ideal for leagues, schools, and tournaments. Fast shipping.Golf, Sportscustom-pageplaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Golf Insert Plaque (Multiple Styles). Ideal for leagues, schools, and tournaments. Fast shipping.Golf, Sportscustom-pageplaques149-3011 ps5866 8xwalplaqwsu"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498852-310.45811.6Quick TrophyPlaquesInsert1:14%,3:14%"Golf Awards"Golf Plaque. Ideal for leagues, schools, and tournaments. Fast shipping.qsinplaqgolfGolf, Sportscustom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Golf Medals"Golf Male (505941) Litho Medal Insert. Ideal for leagues, schools, and tournaments. Fast shipping.505941Golf, Sports
golf-awards1sports-medals1Golf Medals. Ideal for leagues, schools, and tournaments. Fast shipping.Shop with Confidence at TrophyCentral! If you are looking to buy golf medals online, look no further! TrophyCentral has an industry-leading selection that will fit any budget, all at discounted prices. We also have great customer service. Our experts in New York and Michigan have been providing suggestions and guidance since 1999. The would be happy to help you, too!

Frequently Asked Questions (FAQ)

⛳ What types of golf medals do you offer?

We offer a wide selection of high-quality golf medals in gold, silver, and bronze finishes. Many feature classic golf designs such as clubs, golf balls, and greens, making them perfect for tournaments, school competitions, and charity events.

🏆 Who are golf medals ideal for?

Our golf medals are perfect for youth golf tournaments, high school and college golf championships, corporate golf outings, and charity scrambles. They make great awards for longest drive, closest to the pin, and overall winners.

🖋️ Can I customize golf medals with engraving?

Yes! Many of our golf medals include free engraving, allowing you to personalize each award with the player's name, event title, or tournament date. Custom engraving makes each medal a unique keepsake.

📦 How fast do golf medals ship?

Most golf medals ship in just 1-2 business days! If you need them even faster, we offer expedited shipping options to ensure you receive your awards on time.

🎨 Can I choose different ribbon colors for my golf medals?

Yes! We offer a variety of ribbon colors so you can match your golf tournament theme, school colors, or corporate branding.

🏅 Do you sell golf trophies in addition to medals?

Yes! In addition to golf medals, we offer a variety of golf trophies and awards to recognize top players, tournament champions, and hole-in-one achievers.

]]>
trophies-golfGolf
custom-pagetrophies-golf12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713006.37Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Golf Medals"Golf Mylar Decal Medal Insert. Ideal for leagues, schools, and tournaments. Fast shipping.489601Golf, Sports
custom-pagetrophies-golf1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Participation Insert Trophy - Golf. Ideal for leagues, schools, and tournaments. Fast shipping.Participation Insert Trophy - GolfGolf, Sportscustom-pagetrophies-golf1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%,25:23%,50:29%,100:34%Participation Trophy - Golf. Ideal for leagues, schools, and tournaments. Fast shipping.qtgolfncGolf, Sportscustom-pagetrophies-golf1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.41234Quick TrophyTrophiesPerpetual Trophies11:14%,3:15%,10:16%"Golf Awards" "Golf Trophies"Find this Perpetual Golf Trophy Discounted at TrophyCentral. Each Trophy has enough room for 32 names. Ships in just 1-2 days.qtgolfperpGolf, Sportscustom-pagekeychains21105502-40.39125035.39Classic MedallicsGiftsKeychains1:22%,10:25%,25:32%,50:39%,100:47%"Father's Day Gifts"Golf Pewter Key Chains. Ideal for leagues, schools, and tournaments. Fast shipping.pk57-cmKeychainsacpin11Golf Pins. Ideal for leagues, schools, and tournaments. Fast shipping.Lapel Pins: Golf Our golf lapel pins are available with a color or gold finish. Choose from two unique designs, a golf bag or crossed clubs with a golf ball and cup.

Shop with Ease at TrophyCentral

TrophyCentral offers discounted and bulk prices, and great customer service. Do you have a question? Contact our experts in Michigan and NY. They would be thrilled to help you.]]>
trophies
custom-pagetrophies-golfplastic-pinbox-t5lapel pins498551-20.525040.5TrophyCentralLapel Pins11:22%,25:24%,100,27%,500:30%Golf Lapel Pin. Ideal for leagues, schools, and tournaments. Fast shipping.golf-u-pbGolf, Sportscustom-pagetrophies-golf1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%2 3/4" Silver Frame Medal: Golf. Ideal for leagues, schools, and tournaments. Fast shipping.Golf, Sportscustom-pagetrophies-golf1trophies498551-310.452429Trophies1Find our Golf star column trophy discounted at TrophyCentral. Features a real marble base, 6 inch gold star-shaped column, free engraving and fast shipping.golf-star-column-trophycustom-pagetrophies-golf1"10 business days" "Aliquippa, PA" "UPS"trophies1500110-1412.5650.5Glass AmericaCrystal Awards1:22%,10:23%Golf Tangent Award. Ideal for leagues, schools, and tournaments. Fast shipping.Golf, Sports12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
498555-8.52Browse a variety of golf recognition ideas at Trophy Central. From classic to custom designs, find the perfect award for your next tournament or special event.
custom-pagecrystalcupsqtgolfncqtgolftrmqtgolfscbgolf-e-part-igolf-e-single-igolf-part-ibdg-golfqtgolfttwqtgolfscqtgolfdmqtgolfyrqtgolfttqtgolfplqtgolf3ctr5419tr5422tr5859tr5860tr5329wbt653wbt754mxx03cup-golf-scbcup-golf-pcup-golf-scb-iqtgolfperp7619904x90xx937x669x953x936x814695xx9535680x664x930x8778665x6725ac26xafta031champ-cup-golf-tcgolf-single-igolf-champ-icup-golf-ingolf-cup-place-trophygolf-cup-place-column-trophyqtholencqtholescqtholedmqtholeyrqtholeplqtholettqtholettwqthole3cmqtholescbcup-hole-scbcup-hole-phole-in-one-award-plaquee9019ir18golfmedalsme108ggolf-mcgolf-mggolf-mc-prgolf-jigfgolf-jibfgolf-jisfgolf-plaque-i49-3011golf-ei49-30114896014930111063golf-star-column-trophyhole-in-one-star-column-trophycl18golf-u-pb1trophies1"Golf Awards" "Trophies" "Sports Trophies"Shop custom golf trophies, medals and plaques for tournaments, club championships and hole-in-one awards. Free trophy engraving. Medals include a ribbon. Fast shipping.

Custom Golf Trophies & Awards — Honor Every Tournament, Every Achievement

Golf trophies serve a wider range of events and award categories than almost any other sport, and the recognition program behind a well-run tournament is often what players remember longest. Club championship events call for traditional cup trophies and perpetual designs that carry a new champion's name each season, building a record of excellence that spans decades. Charity and corporate golf outings — scrambles, best ball, and captain's choice formats — typically award multiple categories per flight: Low Gross, Low Net, Closest to the Pin on multiple holes, Longest Drive, Longest Putt, and Most Honest Score, making it practical to recognize every foursome in the field. Junior golf programs and high school teams use participation trophies and placement awards to build the next generation of players, with golfer figurines in full swing poses the classic choice. Hole-in-one trophies occupy a category of their own — a permanent memorial to one of the rarest achievements in sports, engraved with the course name, hole number, yardage, and date, and displayed for years in a home or office. Women's leagues, senior leagues, and adult recreational programs each bring their own award traditions, from season-long points champions to weekly closest-to-the-pin winners. Crystal and acrylic awards are especially popular for corporate outings where a sleek, desk-worthy design matters as much as the recognition itself. Every golf trophy includes free engraving personalized with player names, tournament details, and achievement specifics.

Frequently Asked Questions About Golf Trophies

What trophy styles and sizes work best for different golf award categories?

Club championships and annual league champions deserve perpetual trophies or large cup trophies in the 14-inch to 20-inch range, built to carry a new engraved nameplate each season and display permanently in a clubhouse or trophy case. Tournament flight winners and low gross and low net honors are well served by 10-inch to 14-inch column or cup trophies that feel substantial at the awards ceremony. Hole-in-one trophies work best as dedicated designs featuring a ball holder or golfer figure, engraved with full achievement details, in the 8-inch to 12-inch range for lasting desktop or shelf display. Closest to the pin, longest drive, and other contest awards typically call for 6-inch to 10-inch trophies or acrylic and crystal awards that are practical for a one-day outing while still feeling like genuine recognition. Corporate and charity outings often favor crystal or acrylic awards for their professional appearance on an office desk.

What details should golf trophy engraving include?

Golf trophies benefit from more specific engraving than most other sports because the achievement details are what make the award meaningful years later. For tournament winners, include the player name, award category, tournament or event name, and year. For hole-in-one trophies, include the player name, course name, hole number, yardage, and date. Keep text concise and readable, prioritizing the most meaningful details when space is limited.

How many award categories should a golf tournament or outing include?

Most well-run golf tournaments award far more categories than players expect, which is a large part of what makes the post-round ceremony memorable. A typical 18-hole scramble or best ball outing awards 1st, 2nd, and 3rd place by flight, Closest to the Pin on two or three designated holes, Longest Drive for both men and women, and sometimes Longest Putt or Most Honest Score. Club championships and seasonal leagues add categories like Most Improved Handicap, Ladies Champion, Senior Champion, and a dedicated award for the outgoing champion. The more categories an event includes, the more players leave with something to show for the day, which drives participation in future years.

If you need more information before deciding, see our expert resource section: If you need more information before deciding, see our expert resource section:
]]>
1st-place-medals cuptrophies1Golf / Hole-in-One
custom-page70231290631-31 2 3 230.45100020.45Certificate SourceCertificatesAward Certificates1:22%,25:24%,100:40%,500:50%Find These Printed Good Citizen certificates at TrophyCentral. Each Good Citizen certificate measures 11 x 8 1/2 inches.923Citizenshipcustom-pageawardcertificates11certificates290631-31 2 3 230.45100020.45Certificate SourceCertificatesAward Certificates1:22%,25:24%,100:40%,500:50%Find these Good Work Certificates discounted at TrophyCentral. Each Good Work Certificate measures 8 1/2" x 11".942Academiccustom-pageinserts15174195176405155095177055176725176795176105170505176355155245157695176155176135176575184765176565189135170341inserts11Find Government Agency Inserts at TrophyCentral. Each 2" inserts fits in a medal frame, trophy or plaque to create a unique recognition item.Governmentcustom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceSealsEmbosser Seals1:22%,3:28%,5:31%Find these Graduate Certificate Seals discounted at TrophyCentral. Seals are easy to apply with a pressure-sensitive backing.803gGraduation, Academiccustom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these quality Graduate Inserts (Litho) at TrophyCentral. Each Graduate Insert can be used to create a unique plaque, medal or trophy.507421Graduation, Academic
custom-pagequickshiptrophies-graduate102-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic MedallicsMedalsAcademic1:22%,25:24%,50:30%,100:36%,500:42%"Graduation Award" "Graduation Awards" "Graduation Gifts" "Graduation Gift" "School Medals" "School Award Medals" "Scholastic Medals" "Scholastic Award Medals" "Academic Medals" "Academic Award Medals" "Medals, School"Your students will love these colorful Mylar Graduate / Graduation Medals from TrophyCentral. Each Graduate / Graduation medal includes a neck ribbon!tm9781Graduation, Academic
custom-pagequickshiptrophies-graduate12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic MedallicsMedalsAcademic1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "School Medals" "Graduation Award" "Graduation Awards"These inexpensive 1 1/4 inch Graduate Medals offer a high quality, but low price for those on a tight budget.e91318-31-2011Graduation, Academic
custom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsAcademic1:22%"Graduation Award" "Graduation Awards" "Award Medals" "School Medals" "Award Medals - All Subjects"Buy these quality Mylar Graduate Decal Inserts at TrophyCentral. Each decal can be used to create a unique plaque, medal or trophy.489781Graduation, Academic
custom-pageschool-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:30%,50:32%,100:35%,500:39%"Graduation Award" "Graduation Awards" "School Pins"Find these Graduate pins discounted at TrophyCentral. Each Graduate Lapel pin features a gold finish and clutch-back.br357Graduation, Academiccustom-pagequickshiptrophies-graduate1trophies498551-310.452429Trophies1Find our Graduate star column trophy discounted at TrophyCentral. Features a real marble base, 6 inch gold star-shaped column, free engraving and fast shipping.graduate-star-column-trophycustom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these quality Graduation (505491) Inserts (Litho) at TrophyCentral. Each Graduation (505491) Insert can be used to create a unique plaque, medal or trophy.505491Graduation, Academic
custom-pagequickshiptrophies-graduate1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.85Quick TrophyTrophiesAcademic1:14%,10:18%,50:22%,100:25%Find this popular graduate figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at trophyCentral. Ships in a fast 1-2 days!qtgradplGraduation, 1st / 2nd / 3rd / Etc., Academiccustom-pagemedallion-inserts-academic-medallion-inserts20498552-40.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful Graduation 2" Epoxy-covered insert decal discounted at TrophyCentral. Fast 1-2 day shipping.Graduation, Academiccustom-pagequickshiptrophies-graduate1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.85Quick TrophyTrophiesAcademic1:14%,10:18%,50:22%,100:25%"Graduation Gifts"This popular Graduate trophy features a real marble base, column, figure and trim indicating year of award. Includes up to three lines of free engraving!qtgradyrGraduation, Academiccustom-pagequickshiptrophies-graduate1trophies498552-311821.06TrophiesAcademic1Find this achievement cup trophy with graduate figure discounted at TrophyCentral. Includes free text engraving!cup-grad-pGraduation, Academiccustom-pagequickshiptrophies-graduate1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Graduation Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Graduation, Academiccustom-pagequickshiptrophies-graduate1trophies498552-312421.33TrophiesAcademic1Find these graduate budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtgradscbGraduation, Academicacademic-resource-hub11Discover creative graduation ceremony award ideas for every level! From kindergarten celebrations to high school ceremonies, plus specialty club recognition that makes graduation unforgettable.custom-pagefree-school-certificate-templates1"Download Only"free-academic49855011TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"See this Graduation Certificate designed exclusively for TrophyCentral! Graduation Certificates can be downloaded for free! Each Graduation Certificate measures 11 x 8 1/2 inches.graduationAcademic, Graduationcustom-pagequickshiptrophies-graduate1trophies498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Graduation insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-Graduation-InsertGraduation, Academiccustom-pagequickshiptrophies-graduate1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.75219Quick TrophyTrophiesAcademic1:14%,3:19%,10:27%Find these fabulous two-tier Graduate Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtgradttGraduation, Academiccustom-pagequickshiptrophies-graduate1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-411.2115Quick TrophyTrophiesAcademic1:14%,3:19%,10:28%Find this Awesome Graduation Two Tier Recognition Trophy Discounted at TrophyCentral. Add up to 3 lines of Free Personalization!qtgradttwGraduation, Academiccustom-pagequickshiptrophies-graduate1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Graduation single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - GraduationGraduation, Academiccustom-pagequickshiptrophies-graduate1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.452421.33Quick TrophyTrophiesAcademic1:14%,10:18%,50:24%,100:28%"Graduation Gifts" "Graduation Gift"Find these popular Graduate Elite Series trophies discounted and with free personalization at TrophyCentral.qtgradscGraduation, Academiccustom-pagequickshiptrophies-graduate1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451623.65Quick TrophyTrophiesAcademic1:14%,10:18%,50:24%,100:28%"Graduation Gifts"Find Our Deluxe Platform Graduate Figure Trophies Discounted at TrophyCentral. Features a Real Marble Base and Free Personalization!qtgraddmGraduation, Academiccustom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these quality Graduation (493311) Inserts (Litho) at TrophyCentral. Each 2 inch insert can be used to create a unique plaque, medal or trophy.493311Graduation, Academic
custom-pagequickshiptrophies-graduate1trophies498552-311218.84TrophiesAcademic1Find this unique cup trophy with Graduate figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-grad-scbGraduation, Academiccustom-pagequickshiptrophies-graduate1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Graduation Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Graduation, Academiccustom-pagequickshiptrophies-graduate1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-411.4118Quick TrophyTrophiesAcademic1:14%,3:19%,10:24%Find these fabulous two-tier, 3-column champion Graduate Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtgrad3cGraduation, Academiccustom-pagequickshiptrophies-graduate1medals498552-30.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this Colorful Graduation insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Graduation, Academiccustom-pagequickshiptrophies-graduate1medals498552-40.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this Graduation insert medal With A Personalized Front Rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Graduation, Academiccustom-pageplaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these graduation insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Graduation, Academic1academic-general-medals1Make graduation day unforgettable with TrophyCentral's graduation medal selection. Our academic medals combine meaningful designs with quality craftsmanship, creating lasting mementos that graduates will treasure for years to come. Every graduation medal includes free custom engraving with student names, graduation year, and school information. Bulk pricing is available for graduating classes, and most orders ship within 1-2 business days. Complete your graduation ceremony with our full collection of school awards including graduation trophies, academic plaques, and diploma frames for comprehensive graduate recognition.quickshiptrophies-graduateGraduationcustom-pagequickshiptrophies-graduate1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our graduation insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - GraduationGraduation, Academiccustom-pagequickshiptrophies-graduate1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.453633.4Quick TrophyTrophiesAcademic1:14%,10:17%,25:23%,50:29%,100:34%"Graduation Gifts" "Graduation Gift" "Graduation Award" "Graduation Awards"Our popular Graduation participation trophies feature a real slant-front marble base and free engraving.qtgradncGraduation, Academiccustom-pagequickshiptrophies-graduate1plaques498552-41JDSPlaques1Find this graduate plaque discounted at TrophyCentral. Our graduate plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Graduation, Academiccustom-pageschool-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:30%,50:32%,100:35%,500:39%"Graduation Award" "Graduation Awards" "School Pins"br601Graduation, Academiccustom-pagequickshiptrophies-graduate1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Graduation Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Graduation, Academiccustom-pageacademic-general-medalsgraduation-plaque-i961969971diploma803dg1trophies-academic1"Homecoming Sashes" "Sashes" "Homecoming Sash" "School Sashes" "Pageant Sashes" "Custom Sashes" "Beauty Pageant Sashes" "Graduation Sashes" "Pageant Sash" "Promo Sashes" "Prom Sash"See a fabulous selection of graduation trophies at TrophyCentral. Our graduation trophies and awards are discounted and ship in just a few days!

Awards for Graduates and Graduation Ceremonies

TrophyCentral has a great selection of graduation trophies online to recognize your graduate! Graduation recognition awards are available in a variety of different styles, including certificates, medals, trophies and pins. Our colorful graduation certificates and pins are an inexpensive way to recognize your special graduation, whether it is for kindergarten, elementary school, middle school, high school or college! Graduation plaques, trophies and medals are a great way to have graduation last a lifetime! Also be sure to see our huge selection of personalized gifts, many which would make fabulous graduation presents!
Be sure to see our expert award resource guides: ]]>
trophiesGraduation
custom-pagetrophies1trophies498551-2121Trophies1:14%,3:19%,10:24%Find this fabulous two-tier, 3-column champion trophy discounted at TrophyCentral. Fast 1-2 day shipping! Features free engraving. Fast 1-2 day shipping.custom-pageglass-crystal-awards1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"general410187-1010.45432.45JcharlesCrystal Awards1:22%,25:25%"crystal awards" "Retirement Awards" "Retirement Plaques, Awards and Gifts"Grande Planet from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.See our fabulous selection of05-10-2016custom-pagemedals-general20medals498552-40.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful Great Job 2" Epoxy-covered insert decal discounted at TrophyCentral. Fast 1-2 day shipping.custom-pagemedals-general1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Great Job Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Great Job, Academiccustom-pagetrophies-general1trophies498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Great Job insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-Great Job-Insertcustom-pagetrophies-general1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Great Job single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - Great JobGreat Job, Academiccustom-pagetrophies-general1trophies498551-311821.06TrophyCentralTrophies1custom-pagetrophies-general1trophies498551-310.71217.38Trophies1custom-pagemedals-general1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Great Job Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Great Job, Academiccustom-pagemedals-general1medals498552-30.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this Colorful Great Job insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Great Job, AcademicGreat Jobcustom-pagemedals-general1medals498552-40.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this Great Job insert medal With A Personalized Front Rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Great Job, Academiccustom-pageplaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these Great Job insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Academiccustom-pagetrophies-general1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Great Job insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - Great JobGreat Job, Academiccustom-pagemedals-general1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Great Job Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Great Job, Academiccustom-pagemedallion-inserts-government-agencies-and-logos12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%"Award Medals" "Award Medals - All Subjects" "Medals - All Others"Buy these high-quality Great Seal Of New Jersey Inserts at TrophyCentral. Each Great Seal Of New Jersey Insert can be used to create a unique plaque, medal or trophy.517610General
custom-pagemedallion-inserts-government-agencies-and-logos12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsHero1:22%"Award Medals" "Award Medals - All Subjects" "Medals - All Others"Buy these high-quality Great Seal Of New York Inserts at TrophyCentral. Each Great Seal Of New York Insert can be used to create a unique plaque, medal or trophy.517050General
custom-pagebottles-st80"7-14 business days from receipt of artwork" "Aliquippa, PA" "UPS"150017-14142014.8Glass AmericaPromotional ProductsSports / Water Bottles1:14%,640:26%Our custom green water bottle collection features retractable sipper straws with matching carabineers. Choice of imprint color choices. Buy bulk and save!11379Sports / Water Bottlescustom-pagecertificateplaques1"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"plaques105502-310.45158.45Classic MedallicsPlaquesCertificate Plaques1:14%,100:25%"Certificate Plaques" "Plaques That Hold Certificates" "Plaques For Certificates" "Graduation Plaques"See This Popular Green PN Series Certificate Frame Discounted at TrophyCentral. Measures 10 1/2" x 13" and Holds 8 1/2" x 11" Certificate. Large Quantity Discounts.pn4931grgCertificates / Sealscustom-pagecertificateplaques1"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"plaques105502-310.451813.25Classic MedallicsPlaquesCertificate Plaques1:14%,10:18%,50:23%,100:27%"Certificate Plaques" "Plaques That Hold Certificates" "Plaques For Certificates" "Graduation Plaques"Find this Green Certificate Plaque discounted at TrophyCentral. Each certificate plaque is gift-boxed.pn4642grCertificates / Sealscustom-pagebadgeribbonsholders1"7-10 business days from receipt of camera-ready artwork" "City of Industry, CA" "UPS (FedEx available on request)"917457-10146022.6BNRibbonsBadge Holders1Find these gray neck wallets discounted at TrophyCentral. Price includes a free one-color imprint!nw-3633grycustom-pagefreeawardcertificates1"Download Only"certificates49855011TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Group Award template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Group-Award-Certificategroup-award-freeTeam, Business, Employeecustom-pagemascottrophies1"4-6 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511016.25Classic MedallicsTrophiesAcademic1:22%,5:24%,10:28%,50:32%"Mascot Awards"Find Tiger Trophies Discounted at TrophyCentral. Each Mascot and Growling Tiger Trophy Includes Engraving. Fast Shipping!mt203504-15-2018Mascotemployee-resource-hub11Discover the ultimate guide to employee awards. Learn about award types, recognition strategies, and creative ideas to celebrate workplace achievements.custom-pagesports-resource-hub11employee-resource-hub11A professional guide to proper service pin etiquette, including how to wear, present, and maintain pins to honor years of dedication and achievement.custom-pagefreeawardcertificates1"Download Only"free-music4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our guitar template is free and designed exclusively for TrophyCentral. Templates and award certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.guitar-templateguitar-521Guitar, Musiccustom-pagemusicartpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsMusic, Drama, Art, Dance1:22%,50:30%,100:33%,500:45%"Music Lapel Pins" "Band Lapel Pins" "Music Pins"Find These Guitar Lapel Pins Discounted at TrophyCentral. Features a Clutch-Pin Back and Fast 1-2 Day Shipping!mp12Music / Band / Choruscustom-pagetrophies-gymnastics12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Gymnastics Medals"2-inch Gymnastics (Female) litho insert for medals, plaques, and trophies. Buy at TrophyCentral to create a custom gymnastics award.501391Gymnastics, Sports
custom-pagetrophies-gymnastics1trophies498551-310.452429Trophies1Find this popular Gymnastics trophy discounted at TrophyCentral. Features a real marble base, stylish 4-inch gold cup, free engraving and fast shipping.gymnastics-cup-place-trophycustom-pagetrophies-gymnastics1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%"Gymnastics Awards" "Gymnastics Trophies" "Gymnast Trophies" "Gymnastics Trophy" "Gymnast Trophy"Find this popular gymnast figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at trophyCentral. Ships in a fast 1-2 days!1Gymnastics, 1st / 2nd / 3rd / Etc., Sportscustom-pagetrophies-gymnastics20medals498554-Feb0.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful Gymnastics 2" Epoxy-covered insert decal discounted at TrophyCentral. Fast 1-2 day shipping.Gymnastics, Sportscustom-pagetrophies-gymnastics1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%"Gymnastics Awards" "Gymnastics Trophies" "Gymnast Trophies" "Gymnastics Trophy" "Gymnast Trophy"This popular Gymnastics trophy features a real marble base, column, figure and trim indicating year of award. Includes up to three lines of free engraving!qtgymyrGymnastics, Sportscustom-pagetrophies-gymnastics1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with gymnastics figure discounted at TrophyCentral. Includes free text engraving!cup-gym-pGymnastics, Sportscustom-pagefree-sports-templates1"Download Only"free-sports49855011TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Gymnastics template (female) is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Female-Gymnastics-Certificatefemale-gymnastics-freeGymnastics, Sportscustom-pagefree-sports-templates1"Download Only"free-sports49855011TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Gymnastics template (male) is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Male-Gymnastics-Certificatemale-gymnastics-freeGymnastics, Sportscustom-pagetrophies-gymnastics1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Gymnastics Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Gymnastics, Sportscustom-pagetrophies-gymnastics1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these gymnastics budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtgymscbGymnastics, Sportscustom-pagetrophies-gymnastics1498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Find this budget gymnastics award trophy discounted at Trophy Central. Features a real marble base and plastic gymnastics figure (female or male). Engraving is free. Fast 1-2 day shipping.bdg-gymnasticsGymnastics, Sportscustom-pagefree-sports-templates1"Download Only"free-sports4985501Trophy CentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Gymnastics template is free and designed exclusively for Trophy Central. Gymnastics certificate templates measure 11" x 8 1/2" and can be easily downloaded and printed.gymnastics-certificategymnastics-frGymnastics, Sportscustom-pagetrophies-gymnastics1trophies498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Gymnastics insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-Gymnastics-InsertGymnastics, Sportscustom-pagetrophies-gymnastics1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%"Gymnastics Awards" "Gymnastics Trophies" "Gymnast Trophies" "Gymnastics Trophy" "Gymnast Trophy"Find these fabulous Gymnastics Figure Winners Line Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qtgymttGymnastics, Sportscustom-pagetrophies-gymnastics1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-411.2115Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%"Gymnastics Trophies" "Gymnast Trophies" "Gymnastics Trophy" "Gymnast Trophy"Find this awesome Gymnastics two tier championship trophy discounted at TrophyCentral. Add up to 3 lines of Free Personalization!qtgymttwGymnastics, Sportscustom-pagetrophies-gymnastics1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Gymnastics single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - GymnasticsGymnastics, Sportscustom-pagetrophies-gymnastics1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%"Gymnastics Awards" "Gymnastics Trophies" "Gymnast Trophies" "Gymnastics Trophy" "Gymnast Trophy"This popular Gymnastics Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtgymscGymnastics, Sportscustom-pagetrophies-gymnastics1trophies498551-311821.06TrophyCentralTrophies1Gymnastics, Sportscustom-pagetrophies-gymnastics50medals9303310-May1Simba CalMedals1These 2 1/2 inch custom gymnastics medals come with an outer-ring which allows you to add your school or league name, date and location.custom-pagetrophies-gymnastics1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451623.65Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%"Gymnastics Trophies" "Gymnast Trophies" "Gymnastics Trophy" "Gymnast Trophy"Find This Popular Gymnastics Deluxe Platform Series Trophies Discounted at TrophyCentral. Real Marble Base; Free Personalization!qtgymdmGymnastics, Sportscustom-pagetrophies-gymnastics1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Gymnastics figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-gym-scbGymnastics, Sportscustom-pagetrophies-gymnastics1trophies498551-310.71217.38Trophies1Gymnastics, Sportscustom-pagetrophies-gymnastics1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Gymnastics Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Gymnastics, Sportscustom-pagetrophies-gymnastics1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-411.4118Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%"Gymnastics Trophies" "Gymnast Trophies" "Gymnastics Trophy" "Gymnast Trophy"Find these fabulous two-tier, 3-column champion Gymnastic Figure Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtgym3cGymnastics, Sportscustom-pagetrophies-gymnastics1medals498553-Feb0.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this colorful Gymnastics insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Gymnastics, Sportscustom-pagetrophies-gymnastics1medals498553-Feb0.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this Gymnastics insert medal with a personalized front rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Gymnastics, Sportscustom-pageplaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these gymnastics insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Gymnastics, Sportscustom-pagetrophies-gymnastics12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Gymnastics Medals"Buy these quality Gymnastics Male Inserts (Litho) at TrophyCentral. Each Gymnastics Male Insert can be used to create a unique plaque, medal or trophy.506371Gymnastics, Sports
1award-medals1Find gymnastics medals your gymnasts and squad will love discounted at TrophyCentral. Each gymnastics medal Includes a free neck ribbon! Shop for Gymnastics Medals & Awards with Ease at TrophyCentral TrophyCentral has a large selection of gymnastics awards, discounted prices and great customer service. Feel free to email or call us toll-free. Our customer service experts in Michigan and NY will be happy to help you!]]>trophies-gymnasticsGymnasticscustom-pagetrophies-gymnastics12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
"PT1=Medals" "PC12=105503-60.7530033.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,100:28%,500:34%,1000:45%"Gymnastics Awards" "Award Medals - All Subjects" "Sports Medals" "Gymnastics Medals"These inexpensive 1 1/4 inch Gymnastics (Female) Medals offer a high quality, but low price for those on a tight budget.e9030Gymnastics, Sports
custom-pagetrophies-gymnastics12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
"PT1=Medals" "PC12=105503-60.7530033.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,100:28%,500:34%,1000:45%"Gymnastics Awards" "Award Medals - All Subjects" "Sports Medals" "Gymnastics Medals"These inexpensive 1 1/4 inch Gymnastics (Male) Medals offer a high quality, but low price for those on a tight budget.e9031Gymnastics, Sports
custom-pagetrophies-gymnastics12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Gymnastics Medals"Buy these quality Mylar Gymnastics Decal Inserts at TrophyCentral. Each Gymnastics Decal can be used to create a unique plaque, medal or trophy.511341Gymnastics, Sports
custom-pagetrophies-gymnastics1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our gymnastics insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - GymnasticsGymnastics, Sportscustom-pagetrophies-gymnastics1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%,25:23%,50:29%,100:34%"Gymnastics Trophies" "Gymnast Trophies" "Gymnastics Trophy" "Gymnast Trophy" "Gymnastics Awards"Our popular Gymnastics participation trophies feature a real slant-front marble base and free engraving.qtgymncGymnastics, Sportscustom-pagetrophies-gymnastics1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Gymnastics Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Gymnastics, Sportscustom-pagetrophies-gymnastics1trophies498551-310.452429Trophies1Find our Gymnastics star column trophy discounted at TrophyCentral. Features a real marble base, 6 inch gold star-shaped column, free engraving and fast shipping.gymnastics-star-column-trophycustom-pagetrophies-cheerleading-spiritgymnastics-plaque-icl201063gymnastics-ei5013915063615063715113411trophies1"Gymnastics Awards" "Sports Trophies"Find a great selection of gymnastics trophies discounted at TrophyCentral. Each gymnastics trophy and award includes free engraving. Medals include a ribbon.

Custom Gymnastics Trophies & Awards — Honor Every Routine and Champion

Gymnastics trophies celebrate the dedication, discipline, and artistry of a sport where every routine represents hundreds of hours of training and an unwavering pursuit of excellence. From recreational clubs where young athletes take their first steps on the beam or floor, to competitive club programs where gymnasts chase invitational titles and state championships, from end-of-season banquets honoring every participant in a youth program, to travel team meets recognizing all-around excellence and individual event winners, quality gymnastics awards honor athletes and coaches across every level of the sport. Our versatile selection includes participation trophies and budget series awards ideal for rec league recognition, single and double column trophies featuring female and male gymnast figurines in dynamic poses, place trim trophies for 1st, 2nd, and 3rd in individual events and all-around, two-tier and three-column championship trophies for meet and invitational winners, insert plaques customizable for any gym or program name, and medals in gold, silver, and bronze perfect for large meets recognizing multiple events and age divisions.

Frequently Asked Questions About Gymnastics Trophies

What trophy sizes work best for different gymnastics award categories?

Recreational programs and end-of-season banquets benefit from 6-inch to 9-inch participation trophies ensuring every gymnast receives recognition for completing the season, building confidence and encouraging return participation. Individual event placers and level champions at club meets deserve 10-inch to 14-inch single column trophies with gymnast figurines that distinguish their achievement from participation awards. All-around winners and top finishers at invitationals warrant 15-inch to 18-inch premium trophies with substantial presence reflecting superior performance across multiple events. Meet championships and season-ending club titles demand 20-inch to 24-inch two-tier or three-column trophies whose height and weight convey the prestige of the achievement. Medals in gold, silver, and bronze work especially well for large meets with multiple age divisions and events where recognizing every placer with a trophy is impractical.

What details should gymnastics trophy engraving include?

Essential elements include athlete name, award title, gym or club name, meet or event name, and year. For competitive meets, adding the level, age division, and place finish creates a more complete record of the achievement. Participation awards gain warmth from titles like Most Improved or Best Sportsmanship. Keep text concise and readable, prioritizing the most meaningful details when space on smaller trophies requires choices.

Do you offer bulk discounts for gymnastics meets and programs?

Yes, Trophy Central offers significant bulk discounts on gymnastics trophies and medals that scale with order quantity, keeping award budgets manageable for programs and meets of any size. Rec league coordinators ordering participation trophies for an entire season roster, meet directors purchasing medals across multiple age divisions and events, and gym owners buying end-of-season awards for all levels all benefit from bulk pricing. Browse our gymnastics medals above for the most budget-friendly option when recognizing large fields.

If you need more information before deciding, see our expert resource section:
]]>
Gymnastics
custom-pageletter-shaped-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoName Badges1Find these popular H-shaped custom mascot badges at TrophyCentral. Great for fundraising! TrophyCentral is a top-rated Yahoo merchant.letterbadges-hcustom-pagemedallion-inserts-general-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these quality Hair Design Inserts (Litho) at TrophyCentral. Each Hair Design Insert can be used to create a unique plaque, medal or trophy.497652Occupations
custom-pagemedallion-inserts-general-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these quality Hair Styling Inserts (Litho) at TrophyCentral. Each Hair Styling Insert can be used to create a unique plaque, medal or trophy.501311Occupations
custom-pagefreeawardcertificates1"Download Only"certificates49855011TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Halloween certificate template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Halloween-Certificatehalloween-freeHoliday, Halloweencustom-pageribbons11muimse1100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Texas" "UPS (FedEx available on request)"7745310-1410.4510030.45PepcoSpiritSpirit1Spiritcustom-pagemedallion-inserts-general-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these quality Handshake Inserts (Litho) at TrophyCentral. Each Handshake Insert can be used to create a unique plaque, medal or trophy.506271General
custom-pageawardcertificates11certificates290631-31 2 3 230.45100020.45Certificate SourceCertificatesAward Certificates1:22%,25:24%,100:40%,500:50%Find these Happy Birthday Certificates discounted at TrophyCentral. Each Happy Birthday Certificate measures 8 1/2" x 11".962Birthdaycustom-pageglass-crystal-awards14582210-14VissionsTrophies1Find This Harmony Humanitarian Globe Award Discounted At TrophyCentral. Price Includes Engraving! Gift Box Also Included.custom-pagemascotpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:22%,50:30%,100:33%,500:47%"Mascot Awards"Find these Hawk Lapel Pins and other colorful mascot pins at TrophyCentral. Fast 1-2 day shipping!em15Mascotcustom-pageplaques1plaques498552-41JDSPlaques1Find this hawk plaque discounted at TrophyCentral. Our hawk mascot plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Mascotcustom-pagemascotinserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsMascots1Buy these quality Hawks Mascot Medal Inserts at TrophyCentral. Each Hawks Insert can be used to create a unique plaque, medal or trophy.489943Mascot
employee-resource-hub11Comprehensive healthcare worker recognition guide for hospitals, medical practices, and healthcare organizations. Discover meaningful award ideas for medical excellence, patient care, nursing appreciation, and healthcare team recognition.custom-pagename-badges-tagswoyoulipr100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoName Badges1Find These Custom Heart Badges Discounted At TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.namebadges-heartcustom-pagegold-pins-lapelplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"Find this heart-shaped pin discounted at TrophyCentral. Heart pins feature a beautiful finish and design with a clutch-back.br227Generalcustom-pageflaglapelpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsGeneral1:22%,50:30%,100:38%,500:58%"Flag Pin Section" "Flag Lapel Pins" "Lapel Pins - Flag" "Discount Flag Pins" "Cheap Flag Pins" "Flag Pins Cheap" "Buy Flag Pins" "Shop For Flag Pins" "U.S. Flag Pins" "American Flag Pins" "Flag Pins US" "Flag Pins American"Find this Heart Shaped American Flag Pin Discounted at TrophyCentral. Each Heart Shaped Flag Pin Ships in Just 1-2 Business Days!heshflpinSee morein a large variety of sizes and styles.flaglapelpins02-10-2010Flagcustom-pagesoccerwaterbottles196"5-8 business days (rush service may be available for additional charge - please call)" "Los Angeles, CA" "UPS (FedEx available on request)"910105-810.453614.85Cosmo FiberPromotional ProductsWater Bottles1Find this Heavy Duty Soccer Bottle discounted at TrophyCentral. This rectangle shape easy-grip water bottle is made of durable Polycarbonate. Holds 24 oz.Sports / Water Bottlescustom-pagewalmouncas11"3 1/2 - 4 1/2 weeks" "Greenfield, Ohio" "Truck (please allow 2-7 days for shipping)"display case45135128-421 3 4 5 6 7 8 9 10 22 230.451WaddellTrophy Cases11"Display Cases" "Popular Display Cases" "Most Popular Display Cases"walmoundisWall-Mountedwall-mounted-champion wall-mounted-legacy11A deep dive into the top Heisman Trophy prospects and candidates for 2024-2025, with a look back at past winners and their schools.custom-pagetrophies-football12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.37115021.37Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,50:28%,100:34%,500:41%Helmets and Footballs: 2" Olympic-Style J-Series Medals. Ideal for leagues, schools, and tournaments. Fast shipping.j954401-15-2011Football, Sports
custom-pageawardcertificates11certificates290631-31 2 3 230.45100020.45Certificate SourceCertificatesAward Certificates1:22%,25:24%,100:40%,500:50%Find These Printed Helping Hand certificates at TrophyCentral. Each Helping Hand certificate measures 11 x 8 1/2 inches.940Academiccustom-pagedisplaycases111"3 1/2 - 4 1/2 weeks" "Greenfield, Ohio" "Truck (please allow 2-7 days for shipping)"display case45135128-421 3 4 5 6 7 8 9 10 22 230.451WaddellTrophy Cases11"Display Cases" "Popular Display Cases" "Most Popular Display Cases" "Glass Display Case" "Glass Display Cases" "Glass Trophy Cases" "Glass Trophy Case"Find the best prices on a Heritage 891 Trophy and Display Case and other Heritage Trophy Cases at TrophyCentral.trophy cases, heritage trophy case, heritage display case, heritage display cases, heritage trophy cases, display case, trophy casecomsooncas3Floor-Standingfloor-standing-edge floor-standing-colossuscustom-pagedisplaycases211display case286125-1010.458144.45SpartaCraftDisplay CasesSpecialty Cases11:14%Heritage Flag Cases from TrophyCentral. Great Selection of Quality Flag Cases.Flag Casescustom-pagedisplaycases11exshelfor89o1"3 1/2 - 4 1/2 weeks" "Greenfield, Ohio" "Truck (please allow 2-7 days for shipping)"display case45135128-421 3 4 5 6 7 8 9 10 22 230.451WaddellTrophy Cases11"Display Cases" "Popular Display Cases" "Most Popular Display Cases" "Glass Display Case" "Glass Display Cases" "Glass Trophy Cases" "Glass Trophy Case"See this Fabulous Heritage Floor-Standing Trophy and Display Case at TrophyCentraltrophy case, display case, trophy cases, display cases, heritage display case, heritage floor displaycase1Floor-Standingfloor-standing-edge floor-standing-colossuscustom-pagecase111display case45123128-421 3 4 5 6 7 8 9 10 22 2311436.2WaddellTrophy Cases11custom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic MedallicsMedalsSports, Hobby, Org, Livestock Bottles1:22%,100:28%,500:34%,1000:45%"Track Medals"These inexpensive 1 1/4 inch High Jump (Female) Medals offer a high quality, but low price for those on a tight budget.e923707-12-2015
custom-pagefree-school-certificate-templates1"Download Only"free-academic4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our High School Diploma template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-High-School-Diploma-Certificatehigh-school-diploma-freeDiploma, Academic, Graduationcustom-pageacademic-resource-hub11Discover scholarship opportunities for high school students! Focus on community service scholarships, sportsmanship awards, and athletic scholarships that reward character and achievement.1glass-crystal-awards1Find high-end crystal awards for special recognition at TrophyCentral. Each high-end award includes free engraving.global-crystal-awardsHigh-End Awardscustom-pagehonorrollpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:22%,50:30%,100:35%,500:48%"Honor Roll" "Honor Roll Pins" "Honor Roll Trophies" "School Pins"Find these popular Highest Honor HP Series Pins Discounted at TrophyCentral. Fast 1-2 Days Shipping. Buy in Bulk and Save! Quantity Discounts Apply.hp1002-01-2020Honor Roll, Academiccustom-pagetrophies-ice-hockey1trophies498551-310.452429Trophies1Find this popular Hockey trophy discounted at TrophyCentral. Features a real marble base, stylish 4-inch gold cup, free engraving and fast shipping.hockey-cup-place-trophycustom-pagetrophies-ice-hockey1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%"Hockey Trophies" "Ice Hockey Trophies" "Hockey Trophy" "Ice Hockey Trophy"Find this popular hockey figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at trophyCentral. Ships in a fast 1-2 days!qthockplHockey, 1st / 2nd / 3rd / Etc., Sportscustom-pagetrophies-ice-hockey1"2-4 business days" "Marquette, MI" "UPS"medals498552-40.530012.37MedalsSports, Hobby, Org, Livestock1:14%,100:31%"Sports Medals" "Hockey Medals" "Hockey Awards"hockeymedal08-10-2013Hockey, Sportscustom-pagetrophies-ice-hockey1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%"Hockey Trophies" "Ice Hockey Trophies" "Hockey Trophy" "Ice Hockey Trophy"This popular Hockey trophy features a real marble base, column, figure and trim indicating year of award. Includes up to three lines of free engraving!qthockyrHockey, Sportscustom-pagetrophies-ice-hockey1"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"medals498552-30.3716021.6Trophy CentralMedalsSports, Hobby, Org, Livestock1:14%,10:19%,50:28%,100:34%,500:42%"Hockey Medals"Find These Ice Hockey 3D Medals At A Great Low Price And With Fast Shipping At TrophyCentral. Large Quantity Discounts Available.qush3dhockeymeHockey, Sportscustom-pagetrophies-ice-hockey1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find these hockey cup trophies discounted at TrophyCentral. Each cup trophy Includes a gold hockey figure and free text engraving!cup-hock-pHockey, Sportscustom-pagetrophies-ice-hockey1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these hockey budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqthockscbHockey, Sportscustom-pagetrophies-ice-hockey1498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Find this budget hockey award trophy discounted at Trophy Central. Features a real marble base and plastic hockey figure. Engraving is free. Fast 1-2 day shipping.bdg-hockeyHockey, Sportscustom-pagetrophies-ice-hockey1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511230.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,6:23%,12:24%,24:26%"Hockey Awards"Find this Hockey Cast Stone Trophy Discounted at TrophyCentral. Price Includes 3 Lines of Engraving!tr9921Hockey, Sportscustom-pagetrophies-ice-hockey1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%"Hockey Awards" "Hockey Trophies" "Ice Hockey Trophies" "Hockey Trophy" "Ice Hockey Trophy"Find these fabulous two-tier Hockey Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qthockttHockey, Sportscustom-pagetrophies-ice-hockey1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.2115Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%"Hockey Trophies" "Ice Hockey Trophies" "Hockey Trophy" "Ice Hockey Trophy"See this championship trophy with a Hockey figure at TrophyCentral. Be sure to see all of our Hockey figure awards.qthockttwHockey, Sportscustom-pagetrophies-ice-hockey1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%"Hockey Awards" "Hockey Trophies" "Ice Hockey Trophies" "Hockey Trophy" "Ice Hockey Trophy"This popular Hockey Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qthockscHockey, Sportscustom-pagetrophies-ice-hockey50medals9303310-May1Simba CalMedals1These 2 1/2 inch custom hockey medals come with an outer-ring which allows you to add your school or league name, date and location.Hockey, Sportscustom-pagetrophies-ice-hockey1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451623.65Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%"Hockey Trophies" "Ice Hockey Trophies" "Hockey Trophy" "Ice Hockey Trophy"These quick-ship trophies from TrophyCentral feature an Ice Hockey figure, real marble base and marble trophy figure platform, choice of column size and color.qthockdmHockey, Sportscustom-pagetrophies-ice-hockey1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498852-30.38150030Quick TrophyDog TagsSports, Hobby, Org, Livestock1:14%,10:15%Find these custom hockey dog tags discounted at TrophyCentral. The price of each hockey dog tag includes custom engraving and chain!qtdoghockHockey, Sportscustom-pagetrophies-ice-hockey1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Hockey figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-hock-scbHockey, Sportscustom-pagetrophies-ice-hockey1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.4118Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%"Hockey Trophies" "Ice Hockey Trophies" "Hockey Trophy" "Ice Hockey Trophy"Find these fabulous two-tier, 3-column champion Hockey Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qthock3cHockey, Sportscustom-pageplaques1"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498852-310.45811.6Quick TrophyPlaquesInsert1:14%,3:14%"Hockey Awards"See this stunning Hockey plaque and other Holographic Plaques at TrophyCentral.qsinplaqhockeyHockey, Sportscustom-pagetrophies-ice-hockey1"4-6 business days w/engraving "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511218.45Classic MedallicsTrophiesSports, Hobby, Org, Livestock1:22%,6:24%,12:26%,24:29%,48:31%"Hockey Awards"Find these popular "Little Buddy" Hockey Trophies at TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.tr7049Hockey, Sportse9025tm9978gqush3dhockeymehockeymedaltm9983ghockeyhockey-qcm50245150666111Shop high-quality hockey medals for teams, tournaments, and MVPs. Choose from gold, silver, and bronze hockey award medals with free engraving and fast shipping!Custom Hockey Medals for Champions & Teams

Honor every goal, save, and hard-fought victory with our quality hockey medals. Whether you're awarding an MVP, recognizing team excellence, or celebrating tournament participation, our medals are a perfect way to commemorate the moment.

Our custom hockey medals come in a variety of styles, including gold, silver, and bronze hockey medals to suit any competition level. Add a personal touch with optional engraving - include a player's name, event details, or team logo for a truly special keepsake.

Shop Hockey Medals for Youth & Adult Leagues

We offer youth hockey medals and tournament medals designed to recognize every player's effort. From detailed hockey stick and puck medals to vibrant full-color options, our collection ensures that players of all ages feel celebrated.

Why Choose Our Hockey Medals?


🏒 Bulk discounts for teams, schools, and leagues
🏒 Multiple ribbon colors to match team colors
🏒 Fast shipping on stock medals]]>
trophies-ice-hockeyHockey
custom-pagetrophies-ice-hockey1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%,25:23%,50:29%,100:34%"Hockey Awards" "Hockey Trophies" "Ice Hockey Trophies" "Hockey Trophy" "Ice Hockey Trophy"Our popular Hockey participation trophies feature a real slant-front marble base and free engraving.qthockncHockey, Sportscustom-pagetrophies-ice-hockey1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.41234Quick TrophyTrophiesPerpetual Trophies1:14%,3:15%,10:16%"Hockey Awards" "Hockey Trophies"Find this Perpetual Hockey Trophy Discounted at TrophyCentral. Each Trophy has enough room for 32 names. Ships in just 1-2 days.qthockeyperpHockey, Sportscustom-pagenoname11wallmountdoubleminiwallmountsinglepuck3pucbalholwallmounttriplepuckhockeydisplay-swallmountdoublepuckhockeydisplay-3hockeydisplay-d11Find Hockey Puck Display Cases at TrophyCentral. Our glass and acrylic hockey displays are a great way to share your prized puck! Fast shipping.

Shop for Hockey & Sports Display Cases with Confidence at TrophyCentral

We offer a huge selection, discounted prices and fabulous customer service. Do you need help with some ideas or with ordering? Yes, we sell online, but we have real people who would love to help you! Feel free to call our experts in Michigan, New York and online. TrophyCentral - delivering smiles since 1999!


]]>
trophies-ice-hockey
custom-pagetrophies-ice-hockey1trophies498551-310.452429Trophies1Find our Hockey star column trophy discounted at TrophyCentral. Features a real marble base, 6 inch gold star-shaped column, free engraving and fast shipping.hockey-star-column-trophycustom-pageaward-medalsqtdoghock5024515066611trophies1"Ice Hockey Awards" "Sports Trophies" "Hockey Awards"Find a great selection of hockey trophies at TrophyCentral. Each hockey trophy and award includes free engraving. Hockey medals include a ribbon.Custom Ice Hockey Trophies for Every Game-Winning Moment

Whether you need a single hockey trophy or a complete set of hockey awards for your team or tournament, TrophyCentral makes it easy to recognize players, coaches, and champions with personalized engraving and fast turnaround. Our selection of hockey trophies includes options for youth leagues, high school programs, travel hockey teams, adult leagues, and championship events in a variety of sizes, styles, and price points.

Why Choose Us for Your Ice Hockey Trophies?

🏒 Free engraving on all trophies
🏒 Fast shipping for last-minute awards
🏒 Bulk discounts for teams and leagues
🏒 High-quality designs for every budget]]>
hockeypuckdisplaysHockey
custom-pagetrophies-golf1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular hole-in-one figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at trophyCentral. Ships in a fast 1-2 days!qtholepl1-10-2022Golf, 1st / 2nd / 3rd / Etc., Sportscustom-pagetrophies-golf1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%This popular Hole-in-One trophy features a real marble base, column, figure and trim indicating year of award. Includes up to three lines of free engraving!qtholeyr1-10-2022Golf, Sports, Hole-In-Onecustom-pagetrophies-golf1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with hole-in-one figure discounted at TrophyCentral. Includes free text engraving!cup-hole-p1-10-2022Golf, Sports, Hole-In-Onecustom-pagetrophies-golf1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these hole-in-one budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtholescb1-10-2022Golf, Sports, Hole-In-Onecustom-pagetrophies-golf1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%"Hole-in-One Awards"Find these fabulous two-tier Hole-In-One Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtholett1-10-2022Golf, Sports, Hole-In-Onecustom-pagetrophies-golf1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-411.2115Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%Find this awesome Hole-in-One two tier championship trophy discounted at TrophyCentral. Add up to 3 lines of Free Personalization!qtholettw1-10-2022Golf, Sports, Hole-In-Onecustom-pagetrophies-golf1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%"Hole-in-One Awards"This popular Hole-in-One Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtholesc1-10-2022Golf, Sports, Hole-In-Onecustom-pagetrophies-golf1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451623.65Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%"Hole-in-One Awards"Deluxe Platform Series - Golf Ball Holder. Ideal for leagues, schools, and tournaments. Fast shipping.qtholedm1-10-2022Golf, Sports, Hole-In-Onecustom-pagetrophies-golf1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Hole-in-One figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-hole-scb1-10-2022Golf, Sports, Hole-In-Onecustom-pagetrophies-golf1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-411.4118Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%"Hole-in-One Awards"Find these fabulous Hole-in-One 3-column Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qthole3c1-10-2022Golf, Sports, Hole-In-Onecustom-pagetrophies-golf1"1-4 business days (typically 1-2) w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%,25:23%,50:29%,100:34%"Hole-in-One Awards"Participation Trophy - Hole-in-One Golf Ball Holder. Ideal for leagues, schools, and tournaments. Fast shipping.qtholenc1-10-2022Golf, Sports, Hole-In-Onecustom-pagetrophies-golf1plaques498552-41JDSPlaques1Find this Hole-In-One Plaque discounted at TrophyCentral. Our hole-in-one plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Hole-In-Onecustom-pagetrophies-golf1trophies498551-310.452429Trophies1Find our Hole-in-One star column trophy discounted at TrophyCentral. Features a real marble base, 6 inch gold star-shaped column, free engraving and fast shipping.hole-in-one-star-column-trophygolf-awards1trophies1"Golf Awards"Find hole in one trophies in a variety of sizes and styles discounted at TrophyCentral. Each hole in one trophy Includes up to 3 lines of personalization.

Hole-in-One Trophies - Celebrate Golfing Immortality

A hole-in-one is lightning in a bottle, skill meeting fortune on the fairway, a story you will tell at every golf outing for the rest of your natural life. With odds ranging from 12,500 to 1 for amateur golfers to a still-impressive 2,500 to 1 for touring professionals, achieving an ace deserves more than a handshake and a round of drinks at the 19th hole. Hole-in-one trophies commemorate this singular achievement with specialized awards designed exclusively for golf perfection. These distinctive trophies feature golf ball holders showcasing the actual ball that found the cup, elegant cup designs worthy of country club display cases, detailed figurines capturing the triumphant moment, and premium engraving plates documenting the legendary shot with course name, hole number, yardage, date, and witness signatures. Available in sizes from compact 6-inch desk displays for office bragging rights to impressive 20-inch championship columns for club tournaments, hole-in-one trophies transform a fleeting moment into permanent proof. Whether commemorating your first ace after decades of trying, recognizing tournament hole-in-one prizes, honoring multiple aces by serial perfectionists, or creating club records of every witnessed hole-in-one, these specialized trophies ensure golf glory never fades.

Expand your recognition program: Explore Golf Trophies and Explore Golf Medals for comprehensive tournament awards. Learn more: The Mathematics and History of Holes-in-One.

Frequently Asked Questions About Hole-in-One Trophies

Should I display the actual golf ball that achieved the hole-in-one?

Absolutely, and golf ball holder trophies exist precisely for this purpose. The ball itself becomes an irreplaceable artifact, proof that your shot actually happened and not just another exaggerated tale from the links. Golf ball holder trophies feature secure platforms or cradles that elevate your championship ball while protecting it from curious hands and skeptical friends. Many golfers add extra context by using a permanent marker to note crucial details directly on the ball before mounting: hole number, yardage, club used, and date. The combination of physical evidence plus engraved trophy details creates an irrefutable record. For those who achieved their ace with a premium ball they had been saving, the display becomes even more meaningful. Some perfectionists even photograph the ball in the cup before retrieval as additional documentation, though your playing partners will likely never let you forget it anyway.

What details should hole-in-one trophy engraving include?

Comprehensive engraving immortalizes your achievement beyond fading memory. Essential elements include golfer name, course name, specific hole number, yardage, date, and club used. Examples: Michael Patterson, Hole-in-One, Pinehurst No. 2, 17th Hole, 165 Yards, 7-Iron, June 15 2025 or Sarah Mitchell, Ace, Pebble Beach 7th, 106 Yards, 9-Iron, August 3 2025. Tournament aces benefit from event names like Club Championship Hole-in-One or Member-Guest Tournament Ace. Weather warriors might add conditions such as 20 MPH Crosswind or Morning Frost for extra storytelling. Witness signatures add authentication, though engraving space limits this to names like Witnessed by: James Anderson and Robert Chen. Some golfers include score for the round, especially if the ace contributed to their personal best. The more detail preserved, the richer the story becomes during inevitable retellings at every future golf gathering.

Are hole-in-one trophies only for personal achievements or also for tournament prizes?

Both, and the distinction matters for selection. Personal hole-in-one trophies commemorate individual lifetime achievements, typically purchased by the golfer themselves or given as gifts by family, friends, or club members celebrating the accomplishment. These range from intimate 6-inch desk displays to substantial 12-inch presentations depending on display space and desired prominence. Tournament hole-in-one prizes serve as predetermined awards for any golfer lucky enough to ace a designated hole during competition, often sponsored by local businesses, golf shops, or tournament committees. These tend toward larger 15-20 inch statement pieces befitting the combination of skill and fortune required during high-pressure tournament play. Some country clubs maintain perpetual hole-in-one records with plaques listing every witnessed ace on their course, creating historical documentation of golf excellence. Golf outings and corporate tournaments frequently offer hole-in-one prizes on par-3s, with impressive trophies awaiting potential winners. The trophy size and style should match the context, from personal triumph keepsakes to tournament glory centerpieces.

If you need more information before deciding, see our expert resource section:
]]>
Hole-in-One
custom-pagegift-certificate-templates1"Download Only"certificates4985501Trophy CentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our holiday themed template is free and designed exclusively for Trophy Central. This gift certificate measures 5" x 3" and can be easily downloaded and printed.Holiday-Gift-Certificategc-holiday-521Holiday, Christmas, Gift Certificate12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
498555-8.52
11This Section Has Important Holiday Shipping Information from TrophyCentral.custom-page111custom-pageplaques1"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498852-310.45811.6Quick TrophyPlaquesInsert1:14%,3:14%"Baseball Awards"Baseball Holographic Plaque. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.qsinplaq3dbaseballBaseball / T-Ball, Coach, Sportscustom-pageplaques1"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498852-310.45811.6Quick TrophyPlaquesInsert1:14%,3:14%"Bowling Awards"See this Stunning Bowling Pins "Strike" Plaque and other Holographic Plaque Awards at TrophyCentral.qsinplaqbowlingBowlingunused-products1"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"498552-3811.61Find These Stunning Cherry Finish, Holographic Decal Plaques Discounted At TrophyCentral. Price Includes Engraving!quick-holographic-plaquescustom-pageplaques1"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498852-310.45811.6Quick TrophyPlaquesInsert1:14%,3:14%"Swimming Awards"See this stunning Swimming plaque and other Holographic Plaques at TrophyCentral.qsinplaqswimmingSwimming / Diving, Sportscustom-pageplaques1"1-2 business days w/engraving" "Marquette, Michigan" "UPS (FedEx available on request)"plaques498852-310.45811.6Quick TrophyPlaquesInsert1:14%,3:14%"Music Awards"Find This Music Holographic Decal Plaque With a Cherry Finish Discounted At TrophyCentral. Price Includes Engraving! Fast 1-2 Day Shipping!qsinplaqmusicMusic / Band / Choruscustom-pageribbons1-tiaras1"1-3 business days" "Topeka, Indiana" "UPS (Post Office Priority Mail also available)"465711-21 260.8244.4Tower RibbonSpiritTiaras1:22%Find These 1 1/2" Economical Budget Tiaras Discounted At TrophyCentral! High-Quality, Yet Inexpensive!rtp661208-20-2019custom-pagehonorrollpinsplasticpinboxvelapinbox10105502-30.31150030.3Classic MedallicsLapel Pins11:22%,50:30%,100:33%,500:47%Find These Honor Graduate Pins Discounted At TrophyCentral. Each Honor Graduate Pin Features A Clutch-Back. Fast 1-2 Day Shipping!Honor-Graduate06-14-2019Honor Roll, Academiccustom-pagemusicartpins1plasticpinboxvelapinbox1"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsMusic, Drama, Art, Dance1:30%,50:34%,100:38%"Music Lapel Pins" "Band Lapel Pins" "Band Awards" "School Pins"Find these In Honor of Music Excellence pins discounted at TrophyCentral. Our lapel pins feature a high quality finish and clutch pin back.br571Music / Band / Choruscustom-pagehonor-roll-certificates1certificates290631-31 2 3 230.45100020.45Certificate SourceCertificatesAward Certificates1:22%,25:24%,100:40%,500:50%Find These Printed Honor Roll Airplane certificates at TrophyCentral. Each Honor Roll Airplane certificate measures 11 x 8 1/2 inches.967Honor Roll, Academiccustom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceSealsEmbosser Seals1:22%,3:28%,5:31%Find these Honor Roll (Paw) Embossed Certificate Seals discounted at TrophyCentral.803hrpawHonor Roll, Academiccustom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceSealsEmbosser Seals1:22%,3:28%,5:31%"Honor Roll" "Honor Society" "Honor Society Awards" "Honor Roll Awards" "Honor Roll Trophies"Find these Honor Roll Embossed Certificate Seals discounted at TrophyCentral.802hrHonor Roll, Academiccustom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceSealsEmbosser Seals1:22%,3:28%,5:31%Find these Honor Roll (Round) Embossed Certificate Seals discounted at TrophyCentral. Seals are easy to apply with a pressure-sensitive backing.803hHonor Roll, Academiccustom-pagehonorrollmedals20medals498552-40.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful Honor Roll 2" Epoxy-covered insert decal discounted at TrophyCentral. Fast 1-2 day shipping.Honor Roll, Academiccustom-pagehonorrollpinsplastic-pinbox-t5498551-30.550040.5TrophyCentralLapel Pins11:22%,25:24%,100,27%,500:30%Find our 3D Series gold honor roll pin discounted at TrophyCentral. Fast 1-2 day shipping.Honor Roll, Academic11Complete guide to honor roll, honor societies, and academic awards. Learn requirements, benefits, and strategies for achieving academic recognition in high school and college.coaching-teaching-guides11Creative honor roll award ideas with engraving examples for schools and academic ceremonies. From Valedictorian to Most Improved Scholar, discover 15+ unique ways to recognize academic achievement with actual trophy wording templates.custom-pagehonor-roll-certificates15"1-3 business days" "Columbia, South Carolina; Marquette, Michigan" "UPS (FedEx available on request)"certificates290631-21 2 3 230.45100020.45Certificate SourceCertificatesAward Certificates1:22%,50:38%,100:42%"Honor Society" "Honor Roll"Find these Honor Roll certificates discounted at TrophyCentral. Each Honor Roll certificate measures 8 1/2 x 11 inches and typically ships in 1-2 days.7022Honor Roll, Academiccustom-pagefree-school-certificate-templates1"Download Only"free-academic49855011TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"See this Honor Roll Certificate designed exclusively for TrophyCentral! Honor Roll Certificates can be downloaded for free! Each Honor Roll Certificate measures 11 x 8 1/2 inches.honor-roll-certificatesHonor Roll, Academiccustom-pagehonorrollpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:30%,50:32%,100:35%,500:39%"Honor Roll" "Honor Roll Pins" "Honor Roll Trophies" "School Pins"Find this Honor Roll Award Pin at TrophyCentral. Honor Roll Award and other pins ship in just 1-2 business days!br316Honor Roll, Academiccustom-pagetrophies-honor-roll-society1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Honor Roll Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Honor Roll, Academiccustom-pagefree-school-certificate-templates1"Download Only"free-academic49855011TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Honor Roll template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Honor-Roll-Certificatehonor-roll-freeHonor Roll, Academiccustom-pagetrophies-honor-roll-society703792192692870229677038honorrollhonor-roll-free1awardcertificates11Recognize academic excellence with custom honor roll certificates. Quality USA printing, personalized details, fast shipping. Low minimum order. Order now.Recognize Academic Excellence with Distinctive Designs

Choose from elegant borders, vibrant school colors, and motivational graphics that make each honor roll certificate memorable and meaningful.

Our design library includes classic academic themes, modern layouts, and customizable templates that reflect your institution's unique character. Each certificate features high-quality printing that ensures crisp text and brilliant colors that students will proudly display.

Customization Options to Celebrate Every Achievement

Personalize every honor roll award certificate with student names, dates, grade levels, and other information using our intuitive online design tool. Upload your logo and select custom colors. Digital proofs ensure accuracy before printing, guaranteeing perfect results for your recognition ceremony.

Why Choose Trophy Central for Honor Roll Awards

With over 25 years of experience in academic recognition, Trophy Central delivers exceptional quality certificates printed in the USA with fast turnaround times. Our competitive pricing makes recognition affordable for any budget. Professional customer service and a satisfaction guarantee ensure your complete confidence in every order.

Order with Ease and Reward Success

Our user-friendly online platform makes creating printable honor roll awards simple and efficient, with low minimum order requirements. Bulk discounts automatically apply for larger quantities, and most orders ship within 1-2 business days after approval. Download free templates or design custom certificates that perfectly match your recognition program.

Frequently Asked Questions

How do honor roll certificates encourage students?

Professional certificates validate the hard work that students put in and provide tangible recognition of their success. Quality awards with personalized details motivate continued excellence and create pride in school and at home.

What details can I customize on the certificates?

Customize student names, dates, grade levels, administrator signatures, logos, and more. Every element can be personalized to match your recognition program.

Can I order different certificates for various honor roll levels?

Yes! Create multiple designs to recognize different levels of excellence, like Principal's Honor Roll, A Honor Roll, A/B Honor Roll, and more. Each certificate can feature unique details while maintaining consistent branding.

Are these certificates suitable for classroom display?

Absolutely! Our certificates are designed for display in classrooms, hallways, and homes. Premium cardstock ensures durability, and professional printing quality makes these awards worthy of prominent display.

]]>
trophies-honor-roll-society trophies
custom-pagetrophies-honor-roll-society1trophies498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Honor Roll insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-Honor Roll-InsertHonor Roll, Academiccustom-pagetrophies-honor-roll-society1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our honor roll single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - Honor RollHonor Roll, Academiccustom-pagetrophies-honor-roll-society1trophies498551-311821.06TrophyCentralTrophies1Honor Roll, Academiccustom-pagetrophies-honor-roll-society1trophies498551-310.71217.38Trophies1Honor Roll, Academiccustom-pagetrophies-honor-roll-society1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Honor Roll Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Honor Roll, Academiccustom-pagetrophies-honor-roll-society1medals498552-30.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this Colorful Honor Roll insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Honor Roll, Academiccustom-pagetrophies-honor-roll-society1medals498552-40.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this Honor Roll insert medal With A Personalized Front Rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Honor Roll, Academiccustom-pageplaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these honor roll insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Honor Roll, Honor Societycustom-pagehonorrollmedals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Honor Roll" "Honor Roll Medals" "Honor Roll Trophies" "Award Medals" "School Medals" "Award Medals - All Subjects" "Honor Student Awards"Buy these high-quality Honor Roll Inserts at TrophyCentral. Each Honor Roll Insert can be used to create a unique plaque, medal or trophy.518156Honor Roll, Academic
11Find honor roll medals and honor society medals discounted at TrophyCentral. Each medal includes a free ribbon. Fast 1-2 day shipping.

Honor Roll Medals & Academic Achievement Awards - Celebrate Student Excellence

Honor roll medals transform academic milestones into cherished keepsakes that students proudly display for years. These distinguished awards celebrate consistent excellence across elementary classrooms, middle school honor societies, high school achievement programs, and university dean's list recognition. Featuring timeless educational symbols like lamps of knowledge, open books, and laureate wreaths, each medal combines meaningful design with practical durability through premium metal finishes and custom engraving. Choose from compact 1.25-inch medallions perfect for frequent recognition events to substantial 2.75-inch statement pieces befitting major accomplishments. Every medal includes complimentary neck ribbons available in any school colors, plus personalized engraving that captures the student's name, specific distinction, institution, and date. Whether acknowledging quarterly honor roll status, cumulative GPA excellence, subject mastery, attendance dedication, or honor society induction, these awards create powerful motivation while honoring the hard work behind academic success.

Expand your recognition program: Explore Academic Medals and Explore Academic Trophies for comprehensive educational recognition. Learn more: Honor Roll History and Academic Recognition.

Frequently Asked Questions About Honor Roll Medals

How do I choose the right medal size for different achievement levels?

Medal size should reflect both the significance of achievement and the age of recipients. Elementary students respond enthusiastically to 1.25-inch medals they can wear immediately after award ceremonies, making these ideal for frequent quarterly recognition where affordability matters. Middle schoolers appreciate 2-inch insert medals featuring vibrant academic imagery and ribbon selections matching team colors, striking the right balance between significance and practicality. High school seniors, honor society inductees, and valedictorians deserve the visual impact of 2.5-inch to 2.75-inch premium designs with antique finishes and substantial weight. Consider implementing a medal hierarchy using gold for top-tier distinctions, silver for standard honor roll, and bronze for academic improvement, allowing you to recognize diverse achievement levels without exceeding budget constraints.

What engraving details make academic medals more meaningful?

Thoughtful engraving transforms a generic award into a personal achievement record. Essential elements include the student's full name, precise honor designation, school or institution name, and term or year. Consider this example: Jordan Chen, Summa Cum Laude, Roosevelt High School, Class of 2025. For honor society recognition, always specify which organization such as National Honor Society or Phi Theta Kappa. GPA achievements become more impressive with specific numbers like Highest Honors 4.0 GPA or Dean's List 3.85 GPA. Subject awards gain clarity through discipline identification like Advanced Chemistry Award or Creative Writing Excellence. Graduating seniors particularly value including their graduation year, while multi-term achievers benefit from notation like Four-Year Honor Roll or Eight-Semester Achievement to highlight sustained excellence rather than single-term success.

What recognition strategy works best for different academic milestones?

Smart recognition programs layer different award types to maximize impact while controlling costs. Certificates serve as versatile, economical options for acknowledging every quarterly honor roll student, particularly when managing hundreds of achievers across large schools. Reserve medals for genuinely notable accomplishments that deserve permanent keepsakes: consecutive term honor roll, principal's list designation, year-end cumulative recognition, or honor society membership. This approach gives medals greater prestige while keeping them financially sustainable. Many administrators find success presenting certificates during quarterly classroom celebrations while saving medals for annual awards ceremonies, creating anticipation and elevating perceived value. Trophies then cap the recognition pyramid for your absolute top performers including valedictorian, salutatorian, and departmental excellence, while perpetual plaques displayed in trophy cases immortalize rare four-year perfect achievement records.

]]>
academic-general-medalsHonor Roll
custom-pagehonorrollmedals12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects" "Honor Student Awards" "Honor Roll" "Honor Roll Medals" "Honor Roll Trophies"Buy these quality Mylar Honor Roll Decal Inserts at TrophyCentral. Each Honor Roll Decal can be used to create a unique plaque, medal or trophy.489733Honor Roll, Academic
custom-pagetrophies-honor-roll-society1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our honor roll insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - Honor RollHonor Roll, Academiccustom-pagequickshiptrophies-spellingap05ap06ec67hp12hp10hp08br317hp654-pbhp14br3531school-pins1Shop honor roll pins, 4.0 pins, and honor society awards for student recognition. Quality academic pins with bulk discounts. Fast 1-2 day shipping.

Honor Roll Pins and Honor Society Pins - Academic Recognition for Every Achievement Level

Honor roll pins are among the most widely used student recognition tools in schools because they combine immediate wearable acknowledgment with the kind of affordable per-unit cost that makes it practical to recognize every qualifying student every grading period rather than only at year-end ceremonies. A student who earns their honor roll pin at the end of each quarter has a tangible, accumulating record of sustained academic effort that a single annual award cannot replicate. Our honor roll pin collection covers every academic recognition tier, from honor roll and high honor roll pins that distinguish achievement levels within a single program to 4.0 and perfect GPA pins that recognize the highest academic standard, to honor society pins suited for NHS, junior honor society, and subject-specific honor society induction ceremonies. Each pin features a secure clutch back that attaches safely to backpacks, lanyards, jackets, and ID holders without damaging fabric, and bulk pricing makes it financially practical for schools, districts, and booster organizations to order in quantity for every eligible student across every grade level and every recognition period throughout the academic year.

Frequently Asked Questions About Honor Roll Pins

What is the difference between honor roll pins, high honor roll pins, and 4.0 pins?

Honor roll, high honor roll, and 4.0 pins correspond to the tiered academic achievement levels that most schools use to differentiate student GPA performance within a recognition program. Honor roll pins typically recognize students meeting the baseline GPA threshold set by the school, commonly in the 3.0 to 3.4 range depending on the institution, acknowledging consistent academic effort above the average student performance level. High honor roll pins recognize students in the upper tier, generally 3.5 to 3.9 GPA, distinguishing them from the broader honor roll group and providing an aspirational target for students currently at the standard honor roll level. The 4.0 pin is reserved for students achieving a perfect grade point average for the grading period, representing the highest academic recognition a school can present at the GPA level and carrying a distinction that both students and parents value highly. Using all three pin styles together creates a clear and immediately visible recognition hierarchy where the different pin designs communicate achievement level without any additional explanation, motivating students at every performance tier to maintain or improve their standing each grading period. Schools that present only a single honor roll pin design miss the opportunity to distinguish between a 3.1 student and a 4.0 student in a way that motivates the higher achiever to maintain their standard and encourages the lower achiever to reach the next level.

How do honor roll pins differ from honor society pins?

Honor roll pins recognize GPA achievement for a specific grading period and are typically presented multiple times throughout the academic year to students who meet the threshold each quarter or semester. They are recurring recognition items tied to periodic performance rather than permanent membership in an organization. Honor society pins recognize induction into a formal honor society such as the National Honor Society, National Junior Honor Society, or a subject-specific honor society like the Spanish National Honor Society or Mu Alpha Theta mathematics honor society. These pins represent a one-time formal recognition of membership in a selective organization that considers GPA, leadership, character, and service alongside academic performance, making them a more prestigious and permanent form of recognition than a periodic honor roll pin. Honor society induction ceremonies are typically formal events where the pin is presented as part of a ceremony that includes candle lighting, recitation of the honor society pledge, and recognition by faculty advisors and school leadership. Both types of pins serve important and distinct purposes within a school recognition program, with honor roll pins providing regular motivation throughout the academic year and honor society pins marking a formal milestone of organizational membership that students often wear on graduation attire and include in college applications.

How should schools present honor roll pins to maximize their motivational impact?

The presentation moment significantly affects how much motivational value an honor roll pin delivers, with public recognition producing measurably stronger effects than simply placing a pin in a student's locker or mailing it home with a report card. Presenting honor roll pins at a brief assembly where names are called and students receive their pins in front of peers and teachers creates a social recognition experience that reinforces the academic behavior being rewarded and signals to the broader student body that academic achievement is valued and celebrated. For schools where full assemblies are impractical, classroom presentations where the teacher calls each honor roll recipient by name and presents the pin in front of their classmates still creates meaningful public acknowledgment at an accessible scale. Consistency matters as much as ceremony: students who know they will receive a pin every grading period they qualify develop a genuine incentive to maintain their performance each quarter rather than treating recognition as a one-time event. Allowing students to wear their pins on their school ID lanyard, backpack, or uniform creates ongoing visibility that reminds them daily of their achievement and prompts conversations with teachers and peers that reinforce the positive association with academic effort. See our complete collection of academic medals and award pins for additional recognition options that complement honor roll pins in a complete academic achievement program.

If you need more information before deciding, see our expert resource section:
]]>
trophies-honor-roll-society trophies
custom-pagehonorrollpinsplastic-pinbox-t5lapel pins498551-20.550040.5TrophyCentralLapel Pins11:22%,25:24%,100,27%,500:30%Find this Honor Roll Gold Enamel lapel pin discounted at TrophyCentral. Features a clutch-pin back for easy attachment to clothing.. Fast 1-2 day shipping.honor-roll-u-pbHonor Roll, Academiccustom-pagetrophies-honor-roll-society1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Honor Roll Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Honor Roll, Academiccustom-pagehonorrollpinsplastic-pinbox-t1498551-30.5200040.5TrophyCentralLapel Pins11:22%,25:24%,100,27%,500:30%Find this sleek black honor roll lapel pin discounted at TrophyCentral. Each pin features a clutch back for easy attachment to clothing. Fast 1-2 day shipping.honor-roll-u-pbHonor Roll, Academiccustom-pagemotivational-stickers1"1 - 2 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-21 2 3 230.451224.45Certificate SourceStickersStickers1:22%,3:24%Find these popular Honor Roll Motivational Stickers discounted online at TrophyCentral. Fast 1-2 day shipping!bstick5Honor Roll, Academiccustom-pagecertificate-diploma-covershonor-society-plaque-ihonor-roll-plaque-i1trophies-academic1Shop honor roll and honor society trophies, medals and pins for every grade and recognition program. Hundreds of styles for schools and quarterly awards. Free engraving. Fast shipping.

Custom Honor Roll and Honor Society Trophies - Recognize Every High Achiever

Honor roll and honor society trophies celebrate the academic dedication, consistent effort, and intellectual achievement that set high-achieving students apart at every grade level. From elementary students earning their first Principal's List recognition to middle schoolers qualifying for National Junior Honor Society, from high school students maintaining 4.0 GPAs across demanding course loads to graduates honored at end-of-year academic banquets, quality awards give lasting recognition to achievements that define a student's academic record. Our selection includes participation insert trophies and economy series awards ideal for recognizing every honor roll student affordably each marking period, single and column insert trophies in both Honor Roll and Honor Society designs, champion's trophies for top academic honors and valedictorian recognition, insert plaques suitable for permanent display in school hallways and offices, medals in multiple finishes perfect for large-scale quarterly or semester recognition programs, and lapel pins providing an everyday wearable reminder of academic achievement that students display on backpacks, jackets, and lanyards.

Honor Roll Award Ideas for Your Ceremony or Banquet

Academic excellence deserves recognition that inspires continued learning. Here are award ideas that honor every type of scholar - from straight-A students to those who have shown remarkable improvement - plus engraving examples for each.

Top Academic Honors

  • Valedictorian Award - The pinnacle of academic achievement. Four years of excellence culminating in the top spot.
  • Salutatorian Award - Second in class but first in determination. Excellence that pushes everyone to do better.
  • Straight A Scholar - Perfect grades are not luck - they are dedication. Every assignment, every test, every time.

Subject Excellence Awards

  • Mathematics Master - Solves equations like puzzles for fun. Numbers bow to their calculating prowess.
  • Language Arts Leader - Words are their playground. Essays flow like poetry, grammar is their superpower.
  • Science Scholar - Curiosity meets knowledge. Questions everything and finds the answers.
  • History Hero - Makes the past come alive. Remembers dates like birthdays and context like stories.

Character, Growth, and Leadership Awards

  • Most Improved Scholar - From struggling to soaring. Their academic transformation inspires everyone.
  • Academic All-Star - Excels in every subject. The Renaissance student of the modern age.
  • Perseverance Award - Never gives up, even when it is tough. Shows that effort beats talent when talent does not work.
  • Peer Tutor Excellence - Helps others understand difficult concepts. Makes learning contagious.
  • Scholar Athlete - Balances books and sports perfectly. Proves you can excel in classroom and competition.
  • Community Service Scholar - High grades and a bigger heart. Uses education to make the world better.
  • Perfect Attendance Scholar - Never missed a day of learning. Dedication that sets them apart.
  • Creative Thinker Award - Approaches problems from unique angles. Innovation in every assignment.
  • Future Leader Award - Shows potential beyond their years. Destined for great things.

Engraving Examples

  • Honor Roll Trophy: HONOR ROLL / [Student Name] / 2024-25 School Year
  • Subject Award: EXCELLENCE IN MATHEMATICS / [Student Name] / [School Name] 2025
  • Top Achievement: VALEDICTORIAN / [Student Name] / Class of 2025 - GPA 4.0

Academic awards should celebrate all types of excellence - the student who improved from Cs to As deserves recognition alongside the straight-A student. Recognize effort, improvement, and character along with achievement. Every student has their own path to success.

Frequently Asked Questions About Honor Roll Trophies

Should I use trophies, medals, or pins for honor roll recognition?

The right award depends on your budget, how often you recognize students, and the occasion. Trophies work best for end-of-year academic banquets, top GPA honors, valedictorian and salutatorian recognition, and honor society induction ceremonies where a display piece reflects the importance of the occasion. Medals are a practical choice for quarterly or semester honor roll programs that need to recognize large numbers of students without straining the school budget. Lapel pins are well suited to semester honor roll programs, honor society membership, and classroom achievement milestones where students want something they can wear every day.

What details should honor roll trophy engraving include?

Include the student's name, the award title, the school name, and the year or marking period. When your program distinguishes between recognition levels, noting the tier on the award - whether that is Honor Roll, High Honor Roll, Principal's List, or 4.0 Award - helps students and families understand what the recognition represents. Honor society induction awards are worth adding the society name and chapter. On smaller trophies and medals where space is limited, lead with the student name and award title and trim from there.

Should schools give every honor roll student an award or reserve trophies for top academic honors?

Most schools do both, using different award types for different levels of recognition. Medals and pins work well for broad quarterly or semester honor roll programs because they are affordable at scale and still feel meaningful to students. Trophies are better reserved for end-of-year ceremonies, top GPA distinctions, valedictorian and salutatorian honors, and honor society inductions where a more substantial award fits the occasion. Separating the award type by achievement level also helps students understand the difference between making the honor roll and earning a top academic distinction, which gives the higher honor more weight.

If you need more information before deciding, see our expert resource section:

Be sure to also browse our academic trophies and awards for additional recognition options for schools and educational programs.

]]>
trophiesHonor Roll
custom-pagemedallion-inserts-academic-medallion-inserts20498552-40.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful Honor Society 2" Epoxy-covered insert decal discounted at TrophyCentral. Fast 1-2 day shipping.Honor Society, Academiccustom-pagehonorrollpinsplastic-pinbox-t5498551-30.550040.5TrophyCentralLapel Pins11:22%,25:24%,100,27%,500:30%Find our 3D Series gold honor society pin discounted at TrophyCentral. Fast 1-2 day shipping.Honor Society, Academiccustom-pagetrophies-honor-roll-society1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Honor Society Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Honor Society, Academiccustom-pagetrophies-honor-roll-society1trophies498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Honor Society insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-Honor Society-InsertHonor Society, Academiccustom-pagetrophies-honor-roll-society1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our honor society single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - Honor SocietyHonor Society, Academiccustom-pagetrophies-honor-roll-society1trophies498551-311821.06TrophyCentralTrophies1Honor Society, Academiccustom-pagetrophies-honor-roll-society1trophies498551-310.71217.38Trophies1Honor Society, Academiccustom-pagetrophies-honor-roll-society1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Honor Society Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Honor Society, Academiccustom-pagetrophies-honor-roll-society1medals498552-30.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this Colorful Honor Society insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Honor Society, Academiccustom-pagetrophies-honor-roll-society1medals498552-40.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this Honor Society insert medal With A Personalized Front Rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Honor Society, Academiccustom-pageplaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these honor society insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Honor Roll, Honor Societycustom-pagehonorrollpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:22%,50:28%,100:32%,500:42%"Honor Roll" "Honor Roll Pins" "Honor Roll Trophies" "School Pins"Find Honor Society pins at TrophyCentral. Each AP Series Honor Society pin includes a clutch back.al73Honor Roll, Academiccustom-pagetrophies-honor-roll-society1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our honor society insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - Honor SocietyHonor Society, Academiccustom-pagehonorrollpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:22%,50:30%,100:35%,500:48%"Honor Roll" "Honor Roll Pins" "Honor Society" "Honor Society Awards" "Honor Roll Trophies" "School Pins"Find These Fabulous Honor Society Pins Discounted At Top-Rated TrophyCentral.hp11Honor Roll, Academiccustom-pagehonorrollpinsplastic-pinbox-t5lapel pins498551-20.525040.5TrophyCentralLapel Pins11:22%,25:24%,100,27%,500:30%Find this Honor Society Gold Enamel lapel pin discounted at TrophyCentral. Features a clutch-pin back for easy attachment to clothing.. Fast 1-2 day shipping.honor-soc-u-pbHonor Society, Academiccustom-pagetrophies-honor-roll-society1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Honor Society Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Honor Society, Academiccustom-pagehonorrollpinsplastic-pinbox-t10498551-30.5200040.5TrophyCentralLapel Pins11:22%,25:24%,100,27%,500:30%Find this sleek black honor society lapel pins discounted at TrophyCentral. Each pin features a clutch back for easy attachment to clothing. Fast 1-2 day shipping.honor-soc-u-pbHonor Society, Academiccustom-pagehonorrollpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:22%,50:28%,100:32%,500:42%"Honor Roll" "Honor Roll Pins" "Honor Roll Trophies" "School Pins"Find Honor Student pins at TrophyCentral. Each AP Series Honor Student pin includes a clutch back.ap06Honor Roll, Academiccustom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects" "Honor Student Awards"Buy these high-quality Honor Student Inserts at TrophyCentral. Each Honor Student Insert can be used to create a unique plaque, medal or trophy.518163Honor Roll, Academic
custom-pagetrophies-honor-roll-society12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic MedallicsMedalsAcademic1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "School Medals" "Honor Roll" "Honor Roll Medals" "Honor Roll Trophies"These inexpensive economy 1 1/4 inch Honor Student Medals offer a high quality, but low price for those on a tight budget.e997912-20-2020Honor Roll, Academic
custom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these quality Mylar Honor Student Decal Inserts at TrophyCentral. Each decal can be used to create a unique plaque, medal or trophy.489720Honor Roll, Academic
custom-pagemedallion-inserts-general-medallion-inserts20498552-40.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful Honorable Mention 2" Epoxy-covered insert decal discounted at TrophyCentral. Fast 1-2 day shipping.custom-pageplace-trophies1498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Honorable Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Shipping is free over $99.Honorable Mentioncustom-pageplace-trophies1trophies498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Honorable Mention insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-Honorable-Mention-Insertcustom-pageplace-trophies1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our honorable mention single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - Honorable MentionHonorable Mentioncustom-pageplace-trophies1498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Honorable Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Shipping is free over $99.Honorable Mentioncustom-pageplace-trophies1medals498552-30.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this Colorful Honorable Mention insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Honorable Mentioncustom-pageplace-trophies1medals498552-40.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this Honorable Mention insert medal With A Personalized Front Rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Honorable Mentioncustom-pageplace-trophies1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these Honorable Mention insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.1st / 2nd / 3rd / Etc., Honorable Mentioncustom-pageplace-trophies1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our honorable mention insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - Honorable MentionHonorable Mentioncustom-pageplace-trophies1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Honorable Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Honorable Mentioncustom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceSealsEmbosser Seals1:22%,3:28%,5:31%Find these Honors Certificate Seals discounted at TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.803hsHonor Roll, Academiccustom-pagedraprib138x111105503-610.4511236.45Classic MedallicsRibbons1:0%Shop for Hooks For Drape Ribbons from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.custom-pageaward-ribbons-rosettes11"5-7 business days" "Topeka, Indiana" "UPS (Priority Mail also available)"ribbons465715-71 260.4620016.46Tower RibbonRibbonsAwareness Ribbons1:22%,50:36%"Customized Ribbons" "Yellow Ribbons"Find Hope Ribbons discounted at TrophyCentral. Each yellow awareness ribbon features choice of backing and optional imprint.hoawriHopecustom-pageglass-crystal-awards1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"general410187-1013630JcharlesCrystal Awards1:22%,25:24%Find this beautiful Horizon brushed crystal and aluminum award discounted at TrophyCentral.custom-pageembossed-seals1"1 - 3 business days + shipping time" "Columbia, SC" "UPS (FedEx available on request)"certificates290631-31 2 3 230.453018.45Certificate SourceSealsEmbosser Seals1:22%,3:28%,5:31%Find these Hornet / Bee Embossed Certificate Seals discounted at TrophyCentral. Seals are easy to apply with a pressure-sensitive backing.803hntcustom-pagemascot-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoName Badges1Find These Custom Find Hornet Mascot Badges Discounted At TrophyCentral.mascotbadges-hornetcustom-pagemedallion-inserts-general-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these quality Horse Head English Inserts (Litho) at TrophyCentral. Each Horse Head English Insert can be used to create a unique plaque, medal or trophy.504881Equestrian, Sports
custom-pagenew-trophies-21trophies498551-310.452429Trophies1Find our Horses Rear star column trophy discounted at TrophyCentral. Features a real marble base, 6 inch gold star-shaped column, free engraving and fast shipping.horses-rear-star-column-trophycustom-pagetrophies-funny-horses-rear1"1-4 (typically 1-2) business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.85Quick TrophyTrophiesGeneral1:14%,10:18%,50:22%,100:25%"Gag Trophies" "Gag Trophy" "Joke Trophies" "Joke Trophy" "Funny Trophies" "Funny Trophy"Find this popular horses rear figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at trophyCentral. Ships in a fast 1-2 days!qthorseplFunny / Gag, 1st / 2nd / 3rd / Etc.custom-pagetrophies-funny-horses-rear1"1-4 (typically 1-2) business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.85Quick TrophyTrophiesGeneral1:14%,10:18%,50:22%,100:25%"Gag Trophies" "Gag Trophy" "Joke Trophies" "Joke Trophy" "Funny Trophies" "Funny Trophy"This popular Horses Rear Gag trophy features a real marble base, column, figure and trim indicating year of award. Includes up to three lines of free engraving!qthorseyrFunny / Gagcustom-pagetrophies-funny-horses-rear1trophies498552-311821.06TrophiesGeneral1Find this achievement cup trophy with gag horses-rear figure discounted at TrophyCentral. Includes free text engraving!cup-horse-pFunny / Gagcustom-pagetrophies-funny-horses-rear1trophies498552-312421.33TrophiesGeneral1Find these horses-rear gag budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqthorsescbFunny / Gagcustom-pagetrophies-funny-horses-rear1498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Find this budget horses rear gag award trophy discounted at Trophy Central. Features a real marble base and plastic horses rear figure. Engraving is free. Fast 1-2 day shipping.bdg-horses-rearFunny / Gagcustom-pagetrophies-funny-horses-rear1"1-4 (typically 1-2) business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.75219Quick TrophyTrophiesGeneral1:14%,3:19%,10:27%"Gag Trophies" "Gag Trophy" "Joke Trophies" "Joke Trophy" "Funny Trophies" "Funny Trophy"Find these fabulous two-tier Horses-Rear Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qthorsettFunny / Gagcustom-pagetrophies-funny-horses-rear1"1-4 (typically 1-2) business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-411.2115Quick TrophyTrophiesGeneral1:14%,3:19%,10:28%"Gag Trophies" "Gag Trophy" "Joke Trophies" "Joke Trophy" "Funny Trophies" "Funny Trophy"See this championship trophy with a Horses Rear figure at TrophyCentral. Be sure to see all of our Horses Rear figure awards.qthorsettwFunny / Gagcustom-pagetrophies-funny-horses-rear1"1-4 (typically 1-2) business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.452421.33Quick TrophyTrophiesGeneral1:14%,100:28%"Gag Trophies" "Gag Trophy" "Joke Trophies" "Joke Trophy" "Funny Trophies" "Funny Trophy"This popular Gag Horses-Rear Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qthorsescFunny / Gagcustom-pagetrophies-funny-horses-rear1"1-4 (typically 1-2) business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.451622.05Quick TrophyTrophiesGeneral1:14%,10:15%"Gag Trophies" "Gag Trophy" "Joke Trophies" "Joke Trophy" "Funny Trophies" "Funny Trophy"These quick-ship trophies from TrophyCentral feature a Horses-Rear figure, real marble base and marble trophy figure platform, choice of column size and color.qthorsedmFunny / Gagcustom-pagetrophies-funny-horses-rear1trophies498552-311218.84TrophiesGeneral1Find this unique cup trophy with Gag Horses-Rear figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-horse-scbFunny / Gagcustom-pagetrophies-funny-horses-rear1"1-4 (typically 1-2) business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-411.4118Quick TrophyTrophiesGeneral1:14%,3:19%,10:24%"Gag Trophies" "Gag Trophy" "Joke Trophies" "Joke Trophy" "Funny Trophies" "Funny Trophy"Find these fabulous Horses-Rear Line Champions Line 3-Column Trophies discounted online at TrophyCentral. Quick 1-2 day shipping!qthorse3cFunny / Gagcustom-pagetrophies-funny-horses-rear1"1-4 (typically 1-2) business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-410.453633.4Quick TrophyTrophiesGeneral1:14%,100:28%"Gag Trophies" "Gag Trophy" "Joke Trophies" "Joke Trophy" "Funny Trophies" "Funny Trophy"Our popular Funny Horses-Rear participation trophies feature a real slant-front marble base and free engraving.qthorsencFunny / Gagcustom-pagemedallion-inserts-general-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Award Medals" "Award Medals - All Subjects" "General Award Medals"Buy these quality Horseshoe Pitching Inserts (Litho) at TrophyCentral. Each Horseshoe Pitching Insert can be used to create a unique plaque, medal or trophy.50476106-01-2019Horseshoes
custom-pageaward-medalshorseshoes-eihorseshoes-plaque-i1trophies1Find horseshoe trophies and horseshoe medals discounted at TrophyCentral. Horseshoe trophies include personalization. Medals include a ribbon.Custom Horseshoe Trophies and Awards

TrophyCentral has been supplying horseshoe leagues, equestrian events, county fairs, and competitions with quality awards since 1999. All horseshoe trophies include up to three lines of free engraving. Need awards in a hurry? Orders typically ship in 1-2 business days and sometimes the same day, depending on time of year and when the order is placed. Browse our complete trophy collection for additional styles and designs.

Horseshoe Trophy FAQ

What types of events are horseshoe trophies used for?

Horseshoe trophies and medals are popular across a wide range of events. The most common include backyard and recreational horseshoe tournaments, organized league play, county and state fair competitions, equestrian shows, and 4-H events. Whether you are recognizing a casual summer tournament winner or a competitive horseshoe league champion, TrophyCentral has styles to fit every occasion and budget.

Can I personalize a horseshoe trophy with event and competitor information?

Yes. Every horseshoe trophy includes up to three lines of free engraving. Common examples include "2026 County Fair Horseshoe Champion - John Smith" or "Riverside Horseshoe League - Most Improved Player." Medals can also be engraved to add a personal touch at an affordable price per unit.

How quickly will my horseshoe trophies ship?

Orders typically ship in 1-2 business days and sometimes the same day, depending on time of year and when the order is placed. Engraved orders ship within 1-3 business days in most cases, making it easy to meet event deadlines without last-minute stress.

Are horseshoe trophies available for equestrian and fair events as well?

Yes. Many of our horseshoe-themed awards work equally well for equestrian competitions, county fairs, and 4-H programs where horseshoe imagery is a natural fit. If you are looking for awards specifically designed for equestrian events, be sure to also check our equestrian trophies section for additional styles.

Do you offer bulk pricing for leagues and tournaments?

Yes. TrophyCentral offers quantity discounts on trophy and medal orders. The more you order, the lower the per-unit price, which is ideal for tournament directors and fair organizers recognizing multiple divisions or age groups. Discounted pricing is shown on each product page.

]]>
Horseshoes
custom-pagehorseshoes1498551-30.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful Horseshoes 2" Epoxy-covered insert decal discounted at TrophyCentral. Fast 1-2 day shipping.Horseshoescustom-pagefreeawardcertificates1"Download Only"free-sports4985501Trophy CentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Horseshoes template is free and designed exclusively for Trophy Central. Horseshoes certificate templates measure 11" x 8 1/2" and can be easily downloaded and printed.horseshoes-certificatehorseshoes-frHorseshoescustom-pagehorseshoes1498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Horseshoes Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Horseshoescustom-pagehorseshoes1498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Horseshoes insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-Horseshoes-InsertHorseshoescustom-pagehorseshoes1498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Horseshoes single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - HorseshoesHorseshoescustom-pagehorseshoes1498551-311821.06TrophyCentralTrophies1Horseshoescustom-pagehorseshoes1498551-310.71217.38Trophies1Horseshoescustom-pagehorseshoes1498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Horseshoes Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Horseshoescustom-pagehorseshoes1498551-30.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this Colorful Horseshoes Insert Medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Horseshoescustom-pagehorseshoes1498551-30.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this Horseshoes insert medal With A Personalized Front Rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Horseshoescustom-pageplaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these Horseshoes insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Horseshoes, Equestriancustom-pagehorseshoes1498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Horseshoes insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - HorseshoesHorseshoescustom-pagehorseshoes1498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Horseshoes Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Horseshoescustom-pagename-badges-tagswoyoulipr100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoName Badges1Find These Custom House Shaped (Realtor) Badges Discounted At TrophyCentral.namebadges-house11Arrange trophies by size with largest at eye level center. Learn pyramid arrangement, chronological vs hierarchical display, and spacing tips for professional presentation.custom-pageask-trophy-expert11Order trophies 2-3 weeks before your event for stress-free planning. Learn timing for different order sizes and how to avoid rush fees and delays.custom-pageask-trophy-expert11Most trophy orders ship within 3-5 business days. Learn about production time, shipping options, and how to get trophies faster when you need them quickly.11Custom pennants typically require 250-piece minimums. Learn to calculate team needs, understand bulk pricing, and plan orders for teams, schools, and booster clubs.custom-pageask-trophy-expert11Order one trophy per player plus extras for coaches and MVPs. Learn how to plan trophy quantities for your youth sports team without over or under-ordering.11Plan your youth baseball trophy budget with our complete cost breakdown. Includes per-player costs, money-saving tips, and sample budgets for teams of all sizes.11Section prizes, upset awards, rating milestones, and year-end traditions. A practical guide for chess coaches and tournament directors who want recognition that actually builds a lasting program.employee-resource-hub11Learn how to celebrate retirees with meaningful awards and recognition ideas. Discover creative titles personalizations and event tips to honor years of service.11A comprehensive guide for teachers and others on how to host a spelling bee, including planning, preparation, execution, and follow-up.Spelling Bee, Teacher Guide, School Competition, Education Tips1custom-pagetrophy-award-guides11Learn how to present trophies and awards with style! Whether you're honoring young athletes, dedicated employees, selfless volunteers, or top-notch students, this guide offers fun, motivational tips for a memorable award ceremony. Visit Trophy Central for the perfect award.employee-resource-hub11Learn how to recognize and celebrate donors effectively with creative awards gifts and appreciation strategies. Boost engagement and loyalty through meaningful donor recognition.11Complete guide for students on how to request strong recommendation letters from teachers and coaches. Includes timing, what information to provide and request templates.custom-pagetrophies-campers11A step-by-step ceremony playbook for camp directors: order of awards, who presents what, pacing tips, and how to close the night on a high. From TrophyCentral.employee-resource-hub11Volunteer appreciation ideas organized by tenure and budget -- from first-year recognition to long-service honors. What to give, what to say, and how to build a tiered program.custom-pagemascottrophies1"4-6 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)"trophies105503-610.4511016.25Classic MedallicsTrophiesAcademic1:22%,5:24%,10:28%,50:32%"Mascot Awards"Buy this Howling Wolf mascot trophy and other mascot awards at TrophyCentral.mt203404-15-2018Mascotcustom-pagehonorrollpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:22%,50:30%,100:35%,500:48%"Honor Student Awards" "Honor Awards"Find these popular 4.0 HP Series Pins Discounted at TrophyCentral. Fast 1-2 Days Shipping. Buy in Bulk and Save!hp1405-23-2022Honor Roll, Academiccustom-pagecitizenship-awardsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:22%,50:30%,100:35%,500:48%"School Pins" "School Lapel Pins"Find these popular Citizenship HP Series Pins Discounted at TrophyCentral. Fast 1-2 Days Shipping! Quantity Discounts Available!hp05Citizenshipcustom-pageschool-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:22%,50:30%,100:35%,500:48%"School Pins" "School Lapel Pins"Find these popular Excellence HP Series Pins Discounted at TrophyCentral. Fast 1-2 Days Shipping. Buy in Bulk and Save!hp07Academic, Business, Generalcustom-pagehonorrollpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:22%,50:30%,100:35%,500:48%"Honor Roll" "Honor Roll Pins" "Honor Roll Trophies" "School Pins"Find these popular Honor HP Series Pins Discounted at TrophyCentral. Fast 1-2 Days Shipping. Buy in Bulk and Save!hp0802-01-2020Honor Roll, Academiccustom-pageschool-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:22%,50:30%,100:35%,500:48%"School Pins" "School Lapel Pins"Find these popular Leadership HP Series Pins Discounted at TrophyCentral. Fast 1-2 Days Shipping. Buy in Bulk and Save!hp1302-25-12Academic, Business, General, Leadershipcustom-pageec34plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:22%,50:30%,100:35%,500:48%"School Pins" "School Lapel Pins"Find these popular Perfect Attendance HP Series Award Pins Discounted at TrophyCentral. Fast 1-2 Days Shipping. Buy in Bulk and Save!hp1502-27-2020Academiccustom-pageschool-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:22%,50:30%,100:35%,500:48%Find these popular Physical Education HP Series Pins Discounted at TrophyCentral. Fast 1-2 Days Shipping. Buy in Bulk and Save! Quantity Discounts Available!hp2006-01-2011Physical Educationplasticpinboxvelapinbox1"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"105502-31150030lapel-award-pins1"School Pins" "School Lapel Pins"Our HP series school and wreath pins are available in a large number of subjects - honor roll, honor society, yearbook and much more!1hp-series-school-pinsAcademiccustom-pagebr584plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:22%,50:30%,100:35%,500:48%"Science Awards" "School Pins"Find these popular Science HP Series Pins Discounted at TrophyCentral. Fast 1-2 Days Shipping. Buy in Bulk and Save! Large Quantity Discounts Are Available!hp1806-15-2013Sciencecustom-pagestudent-council-pinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:22%,50:30%,100:35%,500:48%"School Pins"Find these popular Student Council Lapel HP Series Pins Discounted at TrophyCentral. Fast 1-2 Days Shipping. Buy in Bulk and Save!hp2309-01-2015Student Council, Academic11Find hunting and shooting medals discounted at TrophyCentral. Choose from rifle medals, pistol medals and more!

Hunting and Shooting Sports Medals for Gun Clubs and Competitions

Recognition drives excellence in shooting sports organizations and hunting clubs. Whether you manage a local gun club, coordinate trap shooting leagues and skeet competitions, or organize competitive rifle marksmanship events, unique quality medals strengthen your program by honoring marksmanship skill development, celebrating shooting achievements, and reinforcing the firearm safety and sportsmanship values central to shooting sports traditions. From trap and skeet competitions to rifle shooting tournaments and sporting clays events, the right medal awards create memorable moments that keep gun club members engaged season after season.

Our unique shooting sports medals collection features designs specifically crafted for hunting clubs, gun clubs, and marksmanship organizations. Each medal includes a free neck ribbon in your choice of colors to coordinate with your club or competition categories. With quality construction, fast shipping, and budget-friendly options for ordering multiple medals, you can build a complete recognition program that celebrates everyone from first-time trap shooters to expert marksmen. Browse our selection above, and be sure to check our shooting trophies and plaques with free engraving. Also see our view our comprehensive shooting sports awards guide for detailed recommendations on the best unique medals and awards for your hunting club or gun club organization.

]]>
trophies-marksman-shooting-rifleRifle / Hunting
coaching-teaching-guides11Creative hunting award ideas with engraving examples for clubs and competitions. From Marksman Award to Camp Chef Champion, discover 15+ unique ways to recognize hunters with actual trophy wording templates.custom-pagetrophies-marksman-shooting-rifle1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Shooting single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - Shootingcustom-pagetrophies-marksman-shooting-rifle1trophies498551-310.71217.38Trophies1custom-pagetrophies-marksman-shooting-rifle1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our shooting insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - Shootingcustom-pagequickshiptrophies-graduate12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these quality Mylar I Graduated From Kindergarten Decal Inserts at TrophyCentral. Each decal can be used to create a unique plaque, medal or trophy.489829Graduation, Academic
custom-pagequickshiptrophies-graduate12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these quality Mylar I Graduated From Preschool Decal Inserts at TrophyCentral. Each decal can be used to create a unique plaque, medal or trophy.489828Graduation, Academic
custom-pagetm9901whitcarboarbvelourbox1105502-41Lapel Pins1Find these 'I Love to Read' pins discounted at TrophyCentral. Each pin features a clutch-back. Fast 1-2 day shipping!br371Readingcustom-pageteacher-pinsplasticpinboxvelapinbox10"1-2 business days " "Mount Vernon, NY" "UPS"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"Find 'I Make a Difference' pins discounted at TrophyCentral. Each lapel pin features a clutch-back. Perfect for teachers and volunteers.br27109-20-2016General, Volunteer, Thank You, Academiccustom-pageawardcertificates11certificates290631-31 2 3 230.45100020.45Certificate SourceCertificatesAward Certificates1:22%,25:24%,100:40%,500:50%Find These Printed 'I Was Caught Being Good' Certificates discounted at TrophyCentral. Each 'I Was Caught Being Good' Certificate Measures 8 1/2 x 11.909Academiccustom-pageletter-shaped-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoName Badges1Find these popular I-shaped custom mascot badges at TrophyCentral. Great for fundraising! TrophyCentral is a top-rated Yahoo merchant.letterbadges-icustom-pagefree-sports-templates1"Download Only"free-sports4985501TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Ice Hockey template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Ice-Hockey-Certificateice-hockey-freeHockey, Sportscustom-pagetrophies-ice-hockey12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Hockey Medals" "Ice Hockey Medals"Buy these quality Ice Hockey GENERAL Inserts (Litho) at TrophyCentral. Each Ice Hockey GENERAL Insert can be used to create a unique plaque, medal or trophy.506661Hockey, Sports
custom-pagetrophies-ice-hockey12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Hockey Medals" "Ice Hockey Medals"Buy these quality Ice Hockey Inserts (Litho) at TrophyCentral. Each Ice Hockey Insert can be used to create a unique plaque, medal or trophy.502451Hockey, Sports
custom-pagesoccerwaterbottles48"6-8 business days from receipt of camera-ready artwork" "New Kensington, Pennsylvania" "UPS (FedEx available on request)"150686-810.75LeedsPromotional ProductsWater Bottles1Icon Marathon PC from TrophyCentral. See our great selection of engraved and personalized gifts!Sports / Water Bottlescustom-pagesoccerwaterbottles48"6-8 business days from receipt of camera-ready artwork" "New Kensington, Pennsylvania" "UPS (FedEx available on request)"150686-810.453611.25LeedsPromotional ProductsSports / Water Bottles1"Basketball Water Bottles" "Logo Sports Bottles" "Sports Bottles" "Promotional Sports Bottles" "Aluminum Sports Bottles" "Stainless Water Bottles" "Aluminum Water Bottles" "Bike Water Bottles" "Bicycle Water Bottles" "Baseball Water Bottles" "Football Water Bottles" "Promotional Water Bottles" "Soccer Water Bottles"Icon Polycarb Bottle from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.Sports / Water Bottles11Comprehensive guide for teachers to identify and document scholarship-worthy character. Observable indicators for compassion and sportsmanship with real-world examples custom-pageribbons1-tiaras1"1-3 business days" "Topeka, Indiana" "UPS (FedEx available on request)"465711-21 260.8244.4Tower RibbonSpiritTiaras1:22%This Elegant Imperial Series Tiara Measures Almost 2 3/4" Inches High And Is The Perfect Addition To Any Pageant Or Homecoming Gown.03-15-2016custom-page11This page includes an important message regarding the latest tariff situation.1custom-page11Click here to get the latest TrophyCentral COVID updates, including hours of operation and safety procedures.1custom-pagetm977912-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130033.75Classic MedallicsMedalsAcademic1:22%,100:28%,500:34%,1000:45%"Award Medals - All Subjects" "School Medals"These inexpensive 1 1/4 inch Academics (In Honor of Academic Achievement) Medals offer a high quality, but low price for those on a tight budget.e914107-20-2012General, Academic
custom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these high-quality In Honor Of Academic Excellence Inserts at TrophyCentral. Each In Honor Of Academic Excellence Insert can be used to create a unique plaque, medal or trophy.518208General, Academic
custom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these quality Mylar In Honor of Academic Excellence Decal Inserts at TrophyCentral. Each In decal can be used to create a unique plaque, medal or trophy.489779Achievement
custom-pagetm9779plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:30%,50:32%,100:35%,500:39%"School Pins" "School Lapel Pins"Find this In Honor Of Academic Excellence Pin at TrophyCentral. In Honor Of Academic Excellence and other pins ship in just 1-2 business days!br326Academiccustom-pagecorporatepinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsBusiness1:30%,50:32%,100:35%,500:39%"Employee Lapel Pins" "Corporate Lapel Pins"Find In Honor of Excellence pins discounted at TrophyCentral. Each In Honor of Excellence lapel pin features a quality clutch back. Large quantity discounts.br398Business, Generalcustom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these high-quality In Honor Of Excellence Inserts at TrophyCentral. Each In Honor Of Excellence Insert can be used to create a unique plaque, medal or trophy.518234General
custom-pagemedallion-inserts-academic-medallion-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsAcademic1:22%"Award Medals" "School Medals" "Award Medals - All Subjects"Buy these quality Mylar In Honor Of Excellence Decal Inserts at TrophyCentral. Each decal can be used to create a unique plaque, medal or trophy.489778Achievement
custom-pagesports-inserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsBusiness1:22%Buy these high-quality In Honor Of Your Retirement Inserts at TrophyCentral. Each In Honor Of Your Retirement Insert can be used to create a unique plaque, medal or trophy.518220General, Service / Retirement
custom-pagemascot-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoName Badges1Find These Custom Indian-Shaped Mascot Badges Discounted At TrophyCentral.mascotbadges-indian2custom-pagemascotpinsplasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsAcademic1:22%,50:30%,100:33%,500:47%"Mascot Awards" "Mascot Pins"Find these Indian Chief Lapel Pins and other colorful mascot pins at TrophyCentral. Fast 1-2 day shipping!em12Mascotcustom-pagemascot-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoName Badges1Find These Custom Indian Mascot Badges Discounted At TrophyCentral.mascotbadges-indiancustom-pagemascotinserts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-40.3713003.37Classic MedallicsInsertsMascots1Buy these quality Indians Mascot Medal Inserts at TrophyCentral. Each Indians Insert can be used to create a unique plaque, medal or trophy.489938Mascot
trophy-and-award-buying-lists11Explore a wide range of inexpensive trophies that are perfect for any occasion. Discover top picks under $10, $25, and $50 to reward and motivate achievements without breaking the bank.trophiescustom-pageribbons1-tiaras1"1-3 business days" "Topeka, Indiana" "UPS (Post Office Priority Mail also available)"465711-21 260.8244.4Tower RibbonSpiritTiaras1:22%This Popular Infinity Series Tiara Is Sure To Be A Stand Out At Your Next Event! Ships In A Fast 1-2 Days.rtp6620custom-pagefreeawardcertificates1"Download Only"certificates49855011TrophyCentralCertificatesAward Certificates1"Free Certificates" "Free Award Certificates"Our Innovation Award template is free and designed exclusively for TrophyCentral. Certificates measure 11 x 8 1/2 inches and can be easily downloaded and printed.Free-Innovation-Award-Certificateinnovation-freeEntrepreneurshipcustom-pageaward-medalsmedallion-inserts-academic-medallion-insertsmedallion-inserts-general-medallion-insertsmedallion-inserts-military-medallion-insertsmedallion-inserts-motivational--recognition--salesmedallion-inserts-arts-and-music-medallionsmedallion-inserts-government-agencies-and-logosmedallion-inserts-fraternal-organizational-insertsmedallion-inserts-occupational-subjectsmascotinsertsmedallion-inserts-organizationssports-inserts50111111Find insert medals discounted at TrophyCentral. Each insert medals features a frame, 2" insert and ribbon. Each medal includes a neck ribbon. Fast 1-2 day shipping.Insert Medal Awards If you are looking for a unique or hard to find subject, this section is for you. Choose from hundreds of inserts, 2" discs that fit inside a medal frame. Inserts are generally available in color or a gold, silver, or bronze finish. You also can also choose the medal frame which is available in several styles and sizes. Medals in the above sections include a neck ribbon or military-style drape ribbon. Optional engraving is available on the back of any of the medals.]]>11These fabulous insert medals feature and customizable outer ring and a colorful 2" subject insert. Fast 2-3 day shipping; free over $99.1Medals with Custom Front12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx & Post Office Priority Mail available on request)"]]>
498555-8.52Shop for Insert Plaques at TrophyCentral. Free Engraving on Insert Plaques.

Plaques with Inserts

The plaques in this section all accept inserts - 2" or 4" discs that depict various images and subjects. Inserts offer an alternative to traditional awards and trophy figures. Insert subjects include sports, school, business, religion, military, organizations and charities and many more. We also carry a large number of generic inserts - Rising Star, Most Improved, Excellence and many more - that can be used for any number of events. Many inserts are available in color or in gold, silver, bronze finishes to recognize different levels of achievement. Start by choosing the your plaque finish and size. Then select the desired options and enter engraving. Each insert plaque includes engraving (the number of lines depends on the size of the plaque). Most plaques ship in 4 to 6 business days.
]]>
custom-pageaward-medalsengravablemugcomsoonintrohandsawardblank-part-iblank-single-itorch-part-itorch-single-i1achievement-trophies-awards1Find insert trophies discounted at TrophyCentral. Each insert trophy features free personalization. Fast 1-2 day order processing!

Custom Insert Trophies & Awards - Recognition for Every Achievement

Insert trophies deliver flexible, affordable recognition across hundreds of activities, subjects, and organizations. From youth sports leagues honoring every participant at end-of-season banquets to schools presenting awards across academics, arts, and athletics in a single ceremony, insert trophies eliminate the need for separate trophy lines for every occasion. The interchangeable 2-inch subject discs snap into participation bases and single-column designs alike, making it easy to recognize football players and honor roll students, chess champions and volunteer coaches, all within a consistent, professional award format. Engraving plates personalize each trophy with recipient names, award titles, team or organization names, and the season or year, ensuring every insert trophy becomes a meaningful keepsake reflecting the specific achievement it honors.

Frequently Asked Questions About Insert Trophies

What are insert trophies and how do they work?

Insert trophies combine a standard trophy base with an interchangeable 2-inch subject disc that identifies the specific activity or achievement being recognized. Rather than purchasing separate sport-specific or activity-specific trophies for every occasion, coordinators select a base style, either participation height for youth programs or single-column height for individual award categories, and pair it with the appropriate disc from hundreds of available subjects. Subjects span every major and minor sport, academic disciplines including spelling, math, science, and reading, performing arts categories like music and drama, service roles such as coaching and volunteering, and recreational activities ranging from chess and cooking to cornhole and pinewood derby. The engraving plate on the base is then personalized with the recipient's name, award title, organization, and year, creating a fully customized award from a single flexible product line. This approach benefits multi-activity programs ordering in volume, since consistent base styles present a unified, professional appearance across an entire awards ceremony regardless of how many different activities are being recognized.

When should I choose insert trophies over sport-specific or activity-specific trophies?

Insert trophies are the practical choice when recognizing multiple activities within a single program or budget, when ordering participation trophies in volume for large youth leagues, or when an activity falls outside the most popular sports where dedicated figurine trophies are widely available. A recreation department running spring soccer, summer swim league, and fall flag football can stock a single participation base and simply swap subject discs, keeping ordering simple and costs predictable. Schools presenting end-of-year awards across a dozen academic and extracurricular categories benefit similarly, presenting a consistent award format while still honoring the specific achievement each student earned. Activity-specific trophies with dedicated figurines, such as a quarterback mid-throw or a batter mid-swing, remain the stronger choice when the sport is central to the award's meaning and the presentation warrants maximum visual impact, such as championship trophies, MVP awards, or all-star recognition where the figurine itself communicates the achievement. For participation recognition, multi-activity programs, budget-conscious leagues, and less common activities where figurine options are limited, insert trophies deliver equally meaningful recognition at an accessible price point.

Can insert discs be used in medals and plaques as well as trophies?

Yes. The standard 2-inch subject disc is designed to work across multiple award formats, not just trophy bases. Insert medals incorporate the same subject discs into a wearable medal format, making them ideal for track meets, field days, and multi-event competitions where participants receive awards immediately after competing rather than at a banquet. Insert medals include a ribbon and offer the same broad subject selection as trophy inserts, providing consistent visual identity across an entire awards program whether presenting trophies to top finishers and medals to all participants, or using medals exclusively for a large outdoor event where carrying trophies home is impractical. Plaques can also incorporate subject inserts for wall-mounted recognition displays, making them suitable for permanent hallway displays in schools and recreation centers honoring seasonal champions or outstanding students year over year. Mixing formats, such as trophies for top individual award winners, medals for broad participation recognition, and plaques for permanent display purposes, allows program directors to manage budgets strategically while maintaining a cohesive look across every piece of recognition presented at a single event.

If you need more information before deciding, see our expert resource section:
]]>
trophies-victory insert-trophies-awardsInsert
custom-pagegeneral-corporate-awards1"7-10 business days" "Kentucky" "UPS (FedEx available on request)"410187-1010.45424.45JcharlesCrystal Awards1:22%,25:24%"crystal awards"This fabulous Inspiration Series Award with Crystal Base is individually crafted. Price includes personalization and gift box! Check out our discounted prices!030xGeneral11Discover the ultimate instrumental music trophy and medal guide! From concert bands to jazz ensembles, find creative award ideas that celebrate musical excellence and dedication.custom-pageglass-crystal-awards11"15 business days w/engraving" "Ohio" "UPS (FedEx available on request)"458221510.45636.45Vision AwardsTrophies1:22%,26:32%Interlude Award from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.custom-pageglass-crystal-awards1"14 business days" "Erlanger, KY" "UPS"general410187-1010.451 2 3 4 5 6 7 8 9661JcharlesTrophies1:22%,25:25%Intrigue Awards and Trophies from TrophyCentral. TrophyCentral is a Top-Rated Yahoo Merchant.See all:glass-crystal-awards12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105503-60.7530036.751These medals come in gold, silver and bronze finishes and are perfect for recognizing different place winners.1ir-medals-all
custom-pagemedals-ir-series12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic MedallicsMedalsAcademic1:22%,10:27%,100:36%"School Medals" "School Awards"These 1 1/2 Inch Academic Achievement medals come in gold, silver and bronze finishes and are perfect for recognizing different place winners.ir23Academic
custom-pagemedals-ir-series12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic MedallicsMedalsGeneral1:22%,10:27%,100:36%"School Medals" "School Awards"These 1 1/2 Inch Achievement medals come in gold, silver and bronze finishes and are perfect for recognizing different place winners.ir2509-05-2012General, Torch, Achievement, 1st / 2nd / 3rd / Etc.
custom-pagemedals-ir-series12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,10:27%,100:36%"Sports Medals" "Sports Awards"These 1 1/2 Inch All Sports medals come in gold, silver and bronze finishes and are perfect for recognizing different place winners.ir19General
custom-pagetrophies-baseball12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,10:27%,100:36%"Baseball Medals" "Baseball Awards"IR Series Baseball Design - 1 1/2 Inch Medals in Multiple Finishes. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.ir13Baseball / T-Ball, Sports
custom-pagetrophies-basketball12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,10:27%,100:36%"Basketball Medals" "Basketball Awards"IR Series Basketball Design - 1 1/2" Medals. Ideal for leagues, schools, and tournaments. Fast shipping.ir12Basketball, Sports
custom-pagetrophies-football12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,10:27%,100:36%"Football Medals" "Football Awards"IR Series Football Design - 1 1/2" Medals. Ideal for leagues, schools, and tournaments. Fast shipping.ir11Football, Sports
custom-pagetrophies-golf12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,10:27%,100:36%"Golf Medals" "Golf Awards"IR Series Golf Design - 1 1/2" Medals. Ideal for leagues, schools, and tournaments. Fast shipping.ir18Golf, Sports
custom-pagemedals-ir-series12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic MedallicsMedalsGeneral1:22%,10:27%,100:36%"School Medals" "School Awards"These 1 1/2 Inch In Honor of Excellence medals come in gold, silver and bronze finishes and are perfect for recognizing different place winners.ir24Academic (General)
custom-pagemedals-ir-series12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic MedallicsMedalsAcademic1:22%,10:27%,100:36%"School Medals" "School Awards"These 1 1/2 Inch Lamp of Learning medals come in gold, silver and bronze finishes and are perfect for recognizing different place winners.ir33Academic
custom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,10:27%,100:36%"Track Medals" "Track Awards"These 1 1/2 Inch Marathon medals come in gold, silver and bronze finishes and are perfect for recognizing different place winners.ir36
custom-pagereadingawards12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic MedallicsMedalsAcademic1:22%,10:27%,100:36%"Reading Medals" "Reading Awards"These 1 1/2 Inch Reading medals come in gold, silver and bronze finishes and are perfect for recognizing different place winners.ir31Reading
custom-pagetrophies-soccer12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,10:27%,100:36%"Soccer Medals" "Soccer Medals and Trophies" "Soccer Trophies and Medals"IR Series Soccer Design - 1 1/2 Inch Medals. Ideal for leagues, schools, and tournaments. Engraving available with fast shipping.ir14Soccer, Sports
custom-pagestar-trophies12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic MedallicsMedalsGeneral1:22%,10:27%,100:36%"School Medals" "School Awards"These 1 1/2 Inch Star Performer medals come in gold, silver and bronze finishes and are perfect for recognizing different place winners.ir26General, Star
custom-pagetrophies-swimming-diving12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,10:27%,100:36%"Swimming Medals" "Swimming Awards"These 1 1/2 Inch Swimming medals come in gold, silver and bronze finishes and are perfect for recognizing different place winners.ir16Return to the section for other great styles.swimmingmedals1Swimming / Diving, Sports
custom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,10:27%,100:36%"Track Medals" "Track Awards"These 1 1/2 Inch Track medals come in gold, silver and bronze finishes and are perfect for recognizing different place winners.ir15
custom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,10:27%,100:36%"Track Medals" "Track Awards"These 1 1/2 Inch Track Runners w/Scroll, Female medals come in gold, silver and bronze finishes and are perfect for recognizing different place winners.ir38
custom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,10:27%,100:36%"Track Medals" "Track Awards"These 1 1/2 Inch Track, Female medals come in gold, silver and bronze finishes and are perfect for recognizing different place winners.ir21
custom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,10:27%,100:36%"Track Medals" "Track Awards"These 1 1/2 Inch Track w/Scroll, Male medals come in gold, silver and bronze finishes and are perfect for recognizing different place winners.ir39
custom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,10:27%,100:36%"Track Medals" "Track Awards"These 1 1/2 Inch Track, Male medals come in gold, silver and bronze finishes and are perfect for recognizing different place winners.ir20
custom-pagetrophies-wrestling12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,10:27%,100:36%"Wrestling Medals" "Wrestling Awards"These Boy's Wrestling IR Series Medals come in three finishes, measure 1 1/2" and are perfect for recognizing different place winners.ir17Wrestling, Sports
custom-pagetrophies-wrestling12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,10:27%,100:36%"Wrestling Medals" "Wrestling Awards"Find These 1 1/2 Inch Wrestling Hold Medals Discounted at TrophyCentral. Available in gold, silver and bronze finishes.ir35Wrestling, Sports
custom-pagetrophies-track-field12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,10:27%,100:36%"Track Medals" "Track Awards"These 1 1/2 Inch Track w/Scroll, Female medals come in gold, silver and bronze finishes and are perfect for recognizing different place winners.ir40
custom-pageplace-trophies1first-place-ribbons2-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
medals105503-60.75130036.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,10:27%,100:36%"School Medals" "School Awards"These 1 1/2 Inch First Place Olympic Medals come in gold, silver and bronze finishes and are perfect for recognizing different place winners.ir27See our complete selection ofin other popular styles.award-medals11-01-2019General, Torch, Achievement, 1st / 2nd / 3rd / Etc.
custom-pagemedals-ir-series12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
"PT1=Medals" "PC11=105503-60.7530036.75Classic MedallicsMedalsSports, Hobby, Org, Livestock1:22%,10:27%,100:36%"School Medals" "School Awards"These 1 1/2 Inch Third Place Medals come in gold, silver and bronze finishes and are perfect for recognizing different place winners.ir29See all of our fabulousin a huge variety of styles.award-medals03-15-2015General, Torch, Achievement, 1st / 2nd / 3rd Place
custom-pagebadgeribbonsholders1"7-10 business days from receipt of camera-ready artwork" "City of Industry, CA" "UPS (FedEx available on request)"917457-10146022BNRibbonsBadge Holders1nw-3613irblcustom-pageletter-shaped-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoName Badges1Find these popular J-shaped custom mascot badges at TrophyCentral. Great for fundraising! TrophyCentral is a top-rated Yahoo merchant.letterbadges-jcustom-pageacrylicawards11"1-2 business days" "Marquette, MI" "UPS"general498552-310.453021.45JDS-SCrystal Awards1:14%"New Products"Find this fun Jade Acrylic Award with Black Base Discounted at TrophyCentral. Price Includes Engraving of Logo and Text! Fast 1-2 Day Processing!Generalcustom-pagestar-trophies1"1-2 business days" "Marquette, MI" "UPS"trophies498552-310.453021.45Quick TrophyCrystal Awards1:14%"New Products"Find these fun Jade Acrylic Rising Star Awards with Brass Base .custom-pageclocks11"6-10 business days w/engraving, 1-3 without" "Chicago, Illinois" "UPS (FedEx available on request)"personalized gifts606306-101 3 230.451619.65RS OwensGiftsClocks1:22%Jade Awards Clock from TrophyCentral. See our great selection of engraved and personalized gifts!Engraved Clockscustom-pageglass-crystal-awards11"5-10 business days w/engraving" "Mt. Vernon, NY" "UPS (FedEx available on request)"105505-1010.4511216.65Classic MedallicsTrophies1:22%,5:34%"Minuteman" "General Recognition Awards" "Crystal Globe Awards" "Engraved Crystal Awards" "Crystal Star Awards" "Optical Crystal Awards" "Etched Crystal Awards" "Crystal Awards" "Corporate Crystal" "Crystal Trophies" "Crystal Award Section" "Crystal Trophy Section" "Crystal Corporate Gifts" "Crystal Corporate Awards" "Crystal Corporate Award Section" "Corporate Crystal Awards" "Crystal Trophy"Find these jade glass awards discounted at TrophyCentral! Each jade award features free engraving and a gift box. Shipping is also free over $99!custom-pagetrophies-swimming-diving1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.552417.35Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,50:29%Find These Swimming 3D Acrylic Relief Awards Discounted At TrophyCentral. Price Includes Up to 4 Lines of Engraving!qtswimacrSwimming / Diving, Sportscustom-pageplaques1plaques498552-41JDSPlaques1Find this jaguar plaque discounted at TrophyCentral. Our jaguar mascot plaques feature a beautiful Cherry finish, free engraving and fast 1-2 day shipping.Mascotcustom-pagemascottrophies1"4-6 business days" "Mt. Vernon, NY" "UPS (FedEx and Post Office Priority Mail may be available on request)""PT1=Trophies" "PC11=105503-610.4511016.25Classic MedallicsTrophiesAcademic1:22%,5:24%,10:28%,50:32%"Mascot Awards"Buy this Jaguar mascot trophy and other mascot awards at TrophyCentral.mt200612-20-2040Mascot11An in-depth look at the James Beard Award and its 2024-2025 candidates, including a list of previous winners from the past 10 years.1custom-pagemusicartpins1plasticpinboxvelapinbox10"1-3 business days" "Mt. Vernon, New York" "UPS (FedEx and Post Office Priority Mail may be available on request)"lapel pins105502-30.31150030.3Classic MedallicsLapel PinsMusic, Drama, Art, Dance1:22%,50:28%,100:32%,500:42%"Music Lapel Pins" "Band Lapel Pins" "Band Awards" "School Pins"Find Lyre - Jazz Band pins at TrophyCentral. Each AP Series Lyre - Jazz Band pin includes a clutch back.ap6108-01-2024Music / Band / Choruscustom-pagenoname1111"3-4 business days" "Marquette, Michigan" "UPS"display case498552-41 250.451134.00Display Cases11Hockey, Sports11Join the TrophyCentral Mailing List and receive exclusive special discounts and promotions.custom-pagemedallion-inserts-occupational-subjects12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these high-quality Judicial Award Of Excellence Inserts at TrophyCentral. Each Judicial Award Of Excellence Insert can be used to create a unique plaque, medal or trophy.518778Occupations
custom-pagedraprib138x111105502-410.45183.65Classic Medallics1:14%Find jumprings for attaching your ribbons to medals at TrophyCentral. Sold in bags of 100.custom-pagemedallion-inserts-occupational-subjects12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these quality Justice Inserts (Litho) at TrophyCentral. Each Justice Insert can be used to create a unique plaque, medal or trophy.501491General, Occupations
custom-pagemedallion-inserts-occupational-subjects12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%Buy these high-quality Justice Inserts at TrophyCentral. Each Justice Insert can be used to create a unique plaque, medal or trophy.517835General
custom-pageletter-shaped-badges100"10-14 business days from receipt of camera-ready artwork (longer from July-October, please call)" "Wharton, Texas" "UPS (FedEx available on request)"7745310-141350018PepcoName Badges1Find these popular K-shaped custom mascot badges at TrophyCentral. Great for fundraising! TrophyCentral is a top-rated Yahoo merchant.letterbadges-kcoaching-teaching-guides11Transform your elementary classroom with engaging educational games, brain breaks, and learning activities. Includes free award certificates and proven classroom management strategies.custom-pageglass-crystal-awards6"7-10 business days" "Kentucky" "UPS (FedEx available on request)"personalized gifts410187-1010.451218.45JcharlesGiftsCrystal Gifts1:22%,100:22%"personalized gifts"Find the Kaleidoscope Paperweight at TrophyCentral. Add engraving to your paperweight for a special touch!Crystal Giftscustom-pagetrophies-karate-martial-arts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Karate Medals"Buy these quality Karate (501161) Inserts (Litho) at TrophyCentral. Each Karate (501161) Insert can be used to create a unique plaque, medal or trophy.501161Karate / Martial Arts, Sports
custom-pagetrophies-karate-martial-arts12-3 business days
With engraving:
4-6 business days" "Mt. Vernon, NY" "UPS (FedEx available on request)"]]>
105502-41130025Classic MedallicsInsertsSports, Hobby, Org, Livestock1:22%"Karate Medals"Buy these quality Karate (507129) Inserts (Litho) at TrophyCentral. Each Karate (507129) Insert can be used to create a unique plaque, medal or trophy.507129Karate / Martial Arts, Sports
custom-pagetrophies-karate-martial-arts1trophies498551-310.452429Trophies1Find this popular Karate trophy discounted at TrophyCentral. Features a real marble base, stylish 4-inch gold cup, free engraving and fast shipping.karate-cup-place-trophycustom-pagetrophies-karate-martial-arts1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%Find this popular karate figure 1st, 2nd or 3rd place trim trophy, with marble base and free personalization, discounted at trophyCentral. Ships in a fast 1-2 days!1Karate / Martial Arts, 1st / 2nd / 3rd / Etc., Sportscustom-pagetrophies-karate-martial-arts20498552-40.5100021TrophyCentralInserts11:22%,25:24%,100,27%,500:30%Find this colorful Karate 2" Epoxy-covered insert decal discounted at TrophyCentral. Fast 1-2 day shipping.Karate / Martial Arts, Sportscustom-pagetrophies-karate-martial-arts1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451622.85Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:22%,100:25%This popular Karate trophy features a real marble base, column, figure and trim indicating year of award. Includes up to three lines of free engraving!qtkarateyrSee morefor all of your individual and team needs.trophies-karate-martial-artsKarate / Martial Arts, Sportscustom-pagetrophies-karate-martial-arts1trophies498552-311821.06TrophiesSports, Hobby, Org, Livestock1Find this achievement cup trophy with karate figure discounted at TrophyCentral. Includes free text engraving!cup-karate-pKarate / Martial Arts, Sportscustom-pagetrophies-karate-martial-arts1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Karate Epoxy dome insert medals with a bronze frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Karate / Martial Arts, Sportscustom-pagetrophies-karate-martial-arts1trophies498552-312421.33TrophiesSports, Hobby, Org, Livestock1Find these karate budget trophies with a marble base and choice of column color and size at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.mqtkaratescbKarate / Martial Arts, Sportscustom-pagetrophies-karate-martial-arts1498552-310.453633.4Trophy CentralTrophiesSports, Hobby, Org, Livestock1Find this budget karate award trophy discounted at Trophy Central. Features a real marble base and plastic karate figure. Engraving is free. Fast 1-2 day shipping.bdg-karateKarate / Martial Arts, Sportscustom-pagetrophies-karate-martial-arts1trophies498552-411229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find this karate champion's cup trophy discounted at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's Cup - KarateKarate / Martial Arts, Sportscustom-pagetrophies-karate-martial-arts1trophies498552-311.5229TrophyCentralTrophiesSports, Hobby, Org, Livestock1Find our Champion's Cup Trophy with a Karate insert at Trophy Central. Features a Cherry finish wood base and gold cup figure. Engraving is free.Champion's-Trophy-with-Karate-InsertKarate / Martial Arts, Sportscustom-pagetrophies-karate-martial-arts1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.75219Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:27%Find these fabulous two-tier Karate Three-Column Trophies discounted online at TrophyCentral. Available in three sizes and with fast 1-2 day shipping!qtkaratettKarate / Martial Arts, Sportscustom-pagetrophies-karate-martial-arts1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.2115Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:28%See this championship trophy with a Karate figure at TrophyCentral. Be sure to see all of our Karate figure awards.qtkaratettwReturn to thesection to see our complete selection.trophies-karate-martial-artsKarate / Martial Arts, Sportscustom-pagetrophies-karate-martial-arts1trophies498551-310.452421.33TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our Karate single column insert trophy features a choice of column color, a marble base and free trophy engraving.Single Column Insert Trophy - KarateKarate / Martial Arts, Sportscustom-pagetrophies-karate-martial-arts1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.452421.33Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%This popular Karate Award from TrophyCentral features a choice of column color, a marble base and free trophy engraving.qtkaratescKarate / Martial Arts, Sportscustom-pagetrophies-karate-martial-arts1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.451623.65Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:18%,50:24%,100:28%These quick-ship trophies from TrophyCentral feature a Karate figure, real marble base and marble trophy figure platform, choice of column size and color.qtkaratedmKarate / Martial Arts, Sportscustom-pagetrophies-karate-martial-arts1trophies498552-311218.84TrophiesSports, Hobby, Org, Livestock1Find this unique cup trophy with Karate figure discounted at TrophyCentral. This award features a marble base and choice of column color. Fast 1-2 day shipping.cup-karate-scbKarate / Martial Arts, Sportscustom-pagetrophies-karate-martial-arts1trophies498551-310.71217.38Trophies1Karate / Martial Arts, Sportscustom-pagetrophies-karate-martial-arts1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Karate Epoxy dome insert medals with a gold frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Karate / Martial Arts, Sportscustom-pagetrophies-karate-martial-arts1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-311.4118Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,3:19%,10:24%Find these fabulous two-tier, 3-column champion Karate Trophies discounted online at TrophyCentral. Fast 1-2 day shipping!qtkarate3cSee morefor your champions!trophies-karate-martial-artsKarate / Martial Arts, Sportscustom-pagetrophies-karate-martial-arts1medals498552-30.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this Colorful Karate insert medal discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Karate / Martial Arts, Sportscustom-pagetrophies-karate-martial-arts1medals498552-40.525035.5TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find this Karate insert medal With A Personalized Front Rim discounted at TrophyCentral. Each medal includes a neck ribbon. Fast 1-2 day shipping.Karate / Martial Arts, Sportscustom-pageplaques1plaques498552-3121218.8TrophyCentralPlaquesSports, Hobby, Org, Livestock1Find these karate insert plaques discounted at TrophyCentral. Price includes free engraving. Fast 1-2 day shipping.Karate / Martial Arts, Sportscustom-pagetrophies-karate-martial-arts1trophies498551-310.453633.4TrophyCentralTrophiesSports, Hobby, Org, Livestock1Our karate insert participation trophy features a real slant-front white marble base and free personalization. Significant quantity discounts available.Participation Insert Trophy - KarateKarate / Martial Arts, Sportscustom-pagetrophies-karate-martial-arts1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"trophies498552-310.453633.4Quick TrophyTrophiesSports, Hobby, Org, Livestock1:14%,10:17%,25:23%,50:29%,100:34%Our Karate and Martial Arts Participation Trophies feature a real slant-front white marble base and free personalization. Significant quantity discounts available.qtkaratencReturn to the section for other great choices.trophies-karate-martial-artsKarate / Martial Arts, Sportscustom-pagetrophies-karate-martial-arts1"1-2 business days w/engraving (same day service may be available depending on backlog and time order is placed)" "Marquette, Michigan" "UPS (FedEx available on request)"perpetual trophies498552-311.41234Quick TrophyTrophiesPerpetual Trophies1:14%,3:15%,10:16%"Karate Awards" "Karate Trophies"Find this Perpetual Karate Trophy Discounted at TrophyCentral. Each Trophy has enough room for 32 names. Ships in just 1-2 days.qtkarateperpKarate / Martial Arts, Sportscustom-pagetrophies-karate-martial-arts1medals498553-Feb120033TrophyCentralMedals11:22%,25:24%,100,27%,500:30%Find these Karate Epoxy dome insert medals with a silver frame discounted at TrophyCentral. Price includes a neck ribbon. Fast 1-2 day shipping.Karate / Martial Arts, Sportscustom-pagetrophies-karate-martial-arts1trophies498551-310.452429Trophies1Find our Karate star column trophy discounted at TrophyCentral. Features a real marble base, 6 inch gold star-shaped column, free engraving and fast shipping.karate-star-column-trophycustom-pageshop-by-categorykarate-plaque-ikarate-ei5011615071291trophies1"Karate Awards" "Sports Trophies"

Custom Karate Trophies & Awards - Honor Every Belt, Kata, and Champion

Karate trophies celebrate the discipline, perseverance, and martial arts excellence that define a sport where progress is measured one belt at a time and victory is earned through months of dedicated training. From youth recreational programs where young students earn their first colored belt and take part in their first dojo tournament, to competitive club and school programs where advanced students compete in kata and kumite events, from regional open tournaments drawing competitors across multiple styles and weight classes, to black belt promotions and instructor recognition ceremonies honoring years of mastery, quality martial arts awards honor athletes and sensei across every level and discipline. Our versatile selection includes participation trophies and budget series awards ideal for youth class recognition, single and double column trophies featuring karate figure figurines in dynamic action poses, place trim trophies for 1st, 2nd, and 3rd in kata and sparring divisions, two-tier and three-column championship trophies for tournament overall winners, perpetual trophies ideal for passing between annual dojo champions, insert plaques customizable for any school or tournament name, and medals in gold, silver, and bronze perfect for large tournaments recognizing multiple divisions and weight classes.

Frequently Asked Questions About Karate Trophies

What trophy sizes work best for different karate award categories?

Youth class programs and belt promotion ceremonies benefit from 6-inch to 9-inch participation trophies ensuring every student receives recognition for their progress and dedication, building confidence and encouraging continued training. Division placers and category winners at local and club tournaments deserve 10-inch to 14-inch single column trophies with karate figurines that distinguish competitive achievement from participation awards. Overall winners and top finishers across multiple divisions warrant 15-inch to 18-inch premium trophies with substantial presence reflecting superior performance across a full tournament bracket. Grand champions and annual dojo title holders demand 20-inch to 24-inch two-tier or three-column trophies whose height and weight convey the prestige of the achievement. Medals in gold, silver, and bronze work especially well for large open tournaments recognizing multiple divisions, weight classes, and age groups where awarding every placer a trophy is impractical.

What details should karate trophy engraving include?

Essential elements include athlete name, award title, dojo or school name, tournament or event name, and year. For competitive tournaments, adding the division, weight class, and place finish creates a complete record of the achievement. Belt promotion awards gain meaning from including the belt level earned. Instructor and sensei recognition awards benefit from noting years of service or rank. Keep text concise and readable, prioritizing the most meaningful details when space on smaller trophies requires choices.

Do you offer bulk discounts for karate tournaments and dojos?

Yes, Trophy Central offers significant bulk discounts on karate trophies and medals that scale with order quantity, keeping award budgets manageable for tournaments and programs of any size. Tournament directors purchasing medals across multiple divisions and weight classes, dojo owners buying year-end awards for an entire student roster, and schools ordering belt promotion trophies for a full class all benefit from bulk pricing. Browse our karate medals above for the most budget-friendly option when recognizing large fields.

If you need more information before deciding, see our expert resource section:
]]>
trophiesKarate / Martial Arts
custom-pagedisplaycases11display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake Carmel oak floor display case w/ clear glass back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-mkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake Carmel oak floor display case w/ clear glass back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-mkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake Carmel oak floor display case w/ clear glass back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-mkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake Carmel oak floor display case w/ mirror back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-mkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake Carmel oak floor display case w/ mirror back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-mkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake Carmel oak floor display case w/ mirror back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-mkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake Carmel oak floor display case w/ plaque fabric back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-mkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake Carmel oak floor display case w/ plaque fabric back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-mkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake Carmel oak floor display case w/ plaque fabric back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024pb-bz-akFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake Carmel oak lighted display case w/ clear glass back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D .4124cb-bz-akFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake Carmel oak lighted display case w/ clear glass back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D.4124cb-bz-akFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake Carmel oak lighted display case w/ mirror back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D .4124mb-bz-akFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake Carmel oak lighted display case w/ mirror back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"h x 24"W x 24"D.4124mb-bz-akFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake Carmel oak lighted display case w/ mirror back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D .4124mb-bz-akFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake Carmel oak lighted display case w/ plaque fabric back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D .4124pb-bz-akFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake Carmel oak lighted display case w/ plaque fabric back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D .4124pb-bz-akFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake Carmel oak lighted display case w/ plaque fabric back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D .4124pb-bz-akFloor-Standingcustom-pagedisplaycases11display case45135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake driftwood oak floor display case w/ clear glass back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-dkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake driftwood oak floor display case w/ clear glass back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-dkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake driftwood oak floor display case w/ clear glass back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-dkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake driftwood oak floor display case w/ mirror back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-dkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake driftwood oak floor display case w/ mirror back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-dkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake driftwood oak floor display case w/ mirror back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-dkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake driftwood oak floor display case w/ plaque fabric back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-dkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake driftwood oak floor display case w/ plaque fabric back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-dkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake driftwood oak floor display case w/ plaque fabric back and satin natural aluminum frame discounted at TrophyCentral. Made in the US.Measures: 72"H x 24"W x 24"D .4024cb-gd-dkFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake driftwood oak lighted display case w/ clear glass back and champagne aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D .4124cb-bz-akFloor-Standingcustom-pagedisplaycases1145135128-421 3 4 5 6 7 8 9 10 22 231Trophy Cases11Find this Waddell Keepsake driftwood oak lighted display case w/ clear glass back and dark bronze aluminum frame discounted at TrophyCentral. Made in the US.Measures: 80"H x 24"W x 24"D .4124cb-bz-akFloor-Standing